Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDSearch dblp for Publications
export results for "stream:journals/sigir:"
more than 1000 matches, exporting first 1000 hits only!
download as .bib file
@article{DBLP:journals/sigir/AliannejadiAFFGKLTVV23,
author = {Mohammad Aliannejadi and
Avi Arampatzis and
Guglielmo Faggioli and
Nicola Ferro and
Anastasia Giachanou and
Evangelos Kanoulas and
Dan Li and
Theodora Tsikrika and
Michalis Vlachos and
Stefanos Vrochidis},
title = {Report on the 14th Conference and Labs of the Evaluation Forum {(CLEF}
2023): Experimental {IR} Meets Multilinguality, Multimodality, and
Interaction},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {16:1--16:16},
year = {2023},
url = {https://doi.org/10.1145/3642979.3642998},
doi = {10.1145/3642979.3642998},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AliannejadiAFFGKLTVV23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AnandPHVC23,
author = {Avishek Anand and
Maria Soledad Pera and
Maria Heuss and
Venktesh V and
Matteo Corsi},
title = {Report on the 21st Dutch-Belgian Information Retrieval Workshop {(DIR}
2023)},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {22:1--22:5},
year = {2023},
url = {https://doi.org/10.1145/3642979.3643004},
doi = {10.1145/3642979.3643004},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AnandPHVC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BagheriIYZ23,
author = {Ebrahim Bagheri and
Diana Inkpen and
Christopher C. Yang and
Fattane Zarrinkalam},
title = {Report on the 8th International Workshop on Mining Actionable Insights
from Social Networks (MAISoN'22) - Special Edition on Mental Health
and Social Media at TheWebConf 2022},
journal = {{SIGIR} Forum},
volume = {57},
number = {1},
pages = {5:1--5:6},
year = {2023},
url = {https://doi.org/10.1145/3636341.3636349},
doi = {10.1145/3636341.3636349},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BagheriIYZ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BauerCFFBBCCDNDFFFHHHJKKKKLMMPPRS23,
author = {Christine Bauer and
Ben Carterette and
Nicola Ferro and
Norbert Fuhr and
Joeran Beel and
Timo Breuer and
Charles L. A. Clarke and
Anita Crescenzi and
Gianluca Demartini and
Giorgio Maria Di Nunzio and
Laura Dietz and
Guglielmo Faggioli and
Bruce Ferwerda and
Maik Fr{\"{o}}be and
Matthias Hagen and
Allan Hanbury and
Claudia Hauff and
Dietmar Jannach and
Noriko Kando and
Evangelos Kanoulas and
Bart P. Knijnenburg and
Udo Kruschwitz and
Meijie Li and
Maria Maistro and
Lien Michiels and
Andrea Papenmeier and
Martin Potthast and
Paolo Rosso and
Alan Said and
Philipp Schaer and
Christin Seifert and
Damiano Spina and
Benno Stein and
Nava Tintarev and
Juli{\'{a}}n Urbano and
Henning Wachsmuth and
Martijn C. Willemsen and
Justin Zobel},
title = {Report on the Dagstuhl Seminar on Frontiers of Information Access
Experimentation for Research and Education},
journal = {{SIGIR} Forum},
volume = {57},
number = {1},
pages = {7:1--7:28},
year = {2023},
url = {https://doi.org/10.1145/3636341.3636351},
doi = {10.1145/3636341.3636351},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BauerCFFBBCCDNDFFFHHHJKKKKLMMPPRS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BenedictZMYDHJ23,
author = {Gabriel B{\'{e}}n{\'{e}}dict and
Ruqing Zhang and
Donald Metzler and
Andrew Yates and
Romain Deffayet and
Philipp Hager and
Sami Jullien},
title = {Report on the 1st Workshop on Generative Information Retrieval (Gen-IR
2023) at {SIGIR} 2023},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {13:1--13:23},
year = {2023},
url = {https://doi.org/10.1145/3642979.3642995},
doi = {10.1145/3642979.3642995},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BenedictZMYDHJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BrusilovskyGFLPSW23,
author = {Peter Brusilovsky and
Marco de Gemmis and
Alexander Felfernig and
Pasquale Lops and
Marco Polignano and
Giovanni Semeraro and
Martijn C. Willemsen},
title = {Report on the 10th Joint Workshop on Interfaces and Human Decision
Making for Recommender Systems (IntRS 2023) at {ACM} RecSys 2023},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {17:1--17:6},
year = {2023},
url = {https://doi.org/10.1145/3642979.3642999},
doi = {10.1145/3642979.3642999},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BrusilovskyGFLPSW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CamposJJBLCRSM23,
author = {Ricardo Campos and
Al{\'{\i}}pio M. Jorge and
Adam Jatowt and
Sumit Bhatia and
Marina Litvak and
Jo{\~{a}}o Paulo Cordeiro and
Concei{\c{c}}{\~{a}}o Rocha and
Hugo O. Sousa and
Behrooz Mansouri},
title = {Report on the 6th International Workshop on Narrative Extraction from
Texts (Text2Story 2023) at {ECIR} 2023},
journal = {{SIGIR} Forum},
volume = {57},
number = {1},
pages = {10:1--10:12},
year = {2023},
url = {https://doi.org/10.1145/3636341.3636354},
doi = {10.1145/3636341.3636354},
timestamp = {Wed, 14 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CamposJJBLCRSM23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Chua23,
author = {Tat{-}Seng Chua},
title = {Towards Generative Search and Recommendation: {A} keynote at RecSys
2023},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {5:1--5:14},
year = {2023},
url = {https://doi.org/10.1145/3642979.3642986},
doi = {10.1145/3642979.3642986},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Chua23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DacremaCBC23,
author = {Maurizio Ferrari Dacrema and
Pablo Castells and
Justin Basilico and
Paolo Cremonesi},
title = {Report on the Workshop on Learning and Evaluating Recommendations
with Impressions {(LERI)} at RecSys 2023},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {19:1--19:8},
year = {2023},
url = {https://doi.org/10.1145/3642979.3643001},
doi = {10.1145/3642979.3643001},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DacremaCBC23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Dietz23,
author = {Laura Dietz},
title = {{ACM} {SIGIR} Annual Business Meeting 2023: Secretary's Notes},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {2:1--2:11},
year = {2023},
url = {https://doi.org/10.1145/3642979.3642982},
doi = {10.1145/3642979.3642982},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Dietz23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Faggioli23,
author = {Guglielmo Faggioli},
title = {Modelling and Explaining {IR} System Performance Towards Predictive
Evaluation},
journal = {{SIGIR} Forum},
volume = {57},
number = {1},
pages = {15:1--15:2},
year = {2023},
url = {https://doi.org/10.1145/3636341.3636361},
doi = {10.1145/3636341.3636361},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Faggioli23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FaggioliFMRF23,
author = {Guglielmo Faggioli and
Nicola Ferro and
Josiane Mothe and
Fiana Raiber and
Maik Fr{\"{o}}be},
title = {Report on the 1st Workshop on Query Performance Prediction and Its
Evaluation in New Tasks {(QPP++} 2023) at {ECIR} 2023},
journal = {{SIGIR} Forum},
volume = {57},
number = {1},
pages = {12:1--12:7},
year = {2023},
url = {https://doi.org/10.1145/3636341.3636356},
doi = {10.1145/3636341.3636356},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/FaggioliFMRF23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FaggioliFNT23,
author = {Guglielmo Faggioli and
Antonio Ferrara and
Franco Maria Nardini and
Nicola Tonellotto},
title = {Report on the 13th Italian Information Retrieval Workshop {(IIR} 2023)},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {8:1--8:12},
year = {2023},
url = {https://doi.org/10.1145/3642979.3642990},
doi = {10.1145/3642979.3642990},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/FaggioliFNT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GurrinKK23,
author = {Cathal Gurrin and
Udo Kruschwitz and
Jaap Kamps},
title = {Report on the 45th European Conference on Information Retrieval {(ECIR}
2023)},
journal = {{SIGIR} Forum},
volume = {57},
number = {1},
pages = {11:1--11:11},
year = {2023},
url = {https://doi.org/10.1145/3636341.3636355},
doi = {10.1145/3636341.3636355},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/GurrinKK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GwizdkaR23,
author = {Jacek Gwizdka and
Soo Young Rieh},
title = {Report on the 8th {ACM} {SIGIR} Conference on Human Information Interaction
and Retrieval {(CHIIR} 2023)},
journal = {{SIGIR} Forum},
volume = {57},
number = {1},
pages = {9:1--9:7},
year = {2023},
url = {https://doi.org/10.1145/3636341.3636353},
doi = {10.1145/3636341.3636353},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/GwizdkaR23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jeunen23,
author = {Olivier Jeunen},
title = {A Common Misassumption in Online Experiments with Machine Learning
Models},
journal = {{SIGIR} Forum},
volume = {57},
number = {1},
pages = {13:1--13:9},
year = {2023},
url = {https://doi.org/10.1145/3636341.3636358},
doi = {10.1145/3636341.3636358},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Jeunen23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KatoMP23,
author = {Makoto P. Kato and
Josiane Mothe and
Barbara Poblete},
title = {Report on the 46th {ACM} {SIGIR} Conference on Research and Development
in Information Retrieval {(SIGIR} 2023): Reflections from the Program
Co-Chairs},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {9:1--9:20},
year = {2023},
url = {https://doi.org/10.1145/3642979.3642991},
doi = {10.1145/3642979.3642991},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KatoMP23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KilleLOLZE23,
author = {Benjamin Kille and
Andreas Lommatzsch and
{\"{O}}zlem {\"{O}}zg{\"{o}}bek and
Peng Liu and
Lemei Zhang and
Simen Eide},
title = {Report on the 11th International Workshop on News Recommendation and
Analytics {(INRA} 2023) at {ACM} RecSys 2023},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {15:1--15:4},
year = {2023},
url = {https://doi.org/10.1145/3642979.3642997},
doi = {10.1145/3642979.3642997},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KilleLOLZE23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LauwCSTTT23,
author = {Hady W. Lauw and
Tat{-}Seng Chua and
Luo Si and
Evimaria Terzi and
Panayiotis Tsaparas and
Andrew Tomkins},
title = {Report on the 16th {ACM} International Conference on Web Search and
Data Mining {(WSDM} 2023)},
journal = {{SIGIR} Forum},
volume = {57},
number = {1},
pages = {8:1--8:5},
year = {2023},
url = {https://doi.org/10.1145/3636341.3636352},
doi = {10.1145/3636341.3636352},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LauwCSTTT23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lerner23,
author = {Paul Lerner},
title = {Knowledge-based Visual Question Answering about Named Entities},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {25:1--25:2},
year = {2023},
url = {https://doi.org/10.1145/3642979.3643009},
doi = {10.1145/3642979.3643009},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Lerner23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Li23,
author = {Roger Zhe Li},
title = {Metric Optimization and Mainstream Bias Mitigation in Recommender
Systems},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {26:1--26:2},
year = {2023},
url = {https://doi.org/10.1145/3642979.3643010},
doi = {10.1145/3642979.3643010},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Li23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LitvakRCJJ23,
author = {Marina Litvak and
Irina Rabaev and
Ricardo Campos and
Al{\'{\i}}pio M. Jorge and
Adam Jatowt},
title = {Report on the 1st Workshop on Implicit Author Characterization from
Texts for Search and Retrieval {(IACT} 2023) at {SIGIR} 2023},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {12:1--12:6},
year = {2023},
url = {https://doi.org/10.1145/3642979.3642994},
doi = {10.1145/3642979.3642994},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LitvakRCJJ23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Liu23,
author = {Ling Liu},
title = {Ensemble Learning Methods for Dirty Data: {A} Keynote at {CIKM} 2022},
journal = {{SIGIR} Forum},
volume = {57},
number = {1},
pages = {3:1--3:12},
year = {2023},
url = {https://doi.org/10.1145/3636341.3636346},
doi = {10.1145/3636341.3636346},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Liu23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LiuB23,
author = {Haiming Liu and
Christine Bauer},
title = {Report on the PhD Symposium at {CIKM} 2023},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {21:1--21:5},
year = {2023},
url = {https://doi.org/10.1145/3642979.3643003},
doi = {10.1145/3642979.3643003},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LiuB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Merra23,
author = {Felice Antonio Merra},
title = {Adversarial Machine Learning in Recommender Systems},
journal = {{SIGIR} Forum},
volume = {57},
number = {1},
pages = {14:1--14:2},
year = {2023},
url = {https://doi.org/10.1145/3636341.3636360},
doi = {10.1145/3636341.3636360},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Merra23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Murdock23,
author = {Vanessa Murdock},
title = {Letter from the Chair},
journal = {{SIGIR} Forum},
volume = {57},
number = {1},
pages = {1:1--1:2},
year = {2023},
url = {https://doi.org/10.1145/3636341.3636343},
doi = {10.1145/3636341.3636343},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Murdock23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Murdock23a,
author = {Vanessa Murdock},
title = {Letter from the Chair},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {1:1--1:2},
year = {2023},
url = {https://doi.org/10.1145/3642979.3642981},
doi = {10.1145/3642979.3642981},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Murdock23a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/RaoMS23,
author = {Preeti Rao and
Hema A. Murthy and
Ajay Srinivasamurthy},
title = {Report on the 23rd International Society for Music Information Retrieval
Conference {(ISMIR} 2022)},
journal = {{SIGIR} Forum},
volume = {57},
number = {1},
pages = {6:1--6:15},
year = {2023},
url = {https://doi.org/10.1145/3636341.3636350},
doi = {10.1145/3636341.3636350},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/RaoMS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SaidZB23,
author = {Alan Said and
Eva Zangerle and
Christine Bauer},
title = {Report on the 3rd Workshop on the Perspectives on the Evaluation of
Recommender Systems {(PERSPECTIVES} 2023) at RecSys 2023},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {18:1--18:4},
year = {2023},
url = {https://doi.org/10.1145/3642979.3643000},
doi = {10.1145/3642979.3643000},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SaidZB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sakai23,
author = {Tetsuya Sakai},
title = {On a Few Responsibilities of {(IR)} Researchers (Fairness, Awareness,
and Sustainability): {A} Keynote at {ECIR} 2023},
journal = {{SIGIR} Forum},
volume = {57},
number = {1},
pages = {4:1--4:7},
year = {2023},
url = {https://doi.org/10.1145/3636341.3636347},
doi = {10.1145/3636341.3636347},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Sakai23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sakai23a,
author = {Tetsuya Sakai},
title = {Evaluating Parrots and Sociopathic Liars: {A} keynote at {ICTIR} 2023},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {3:1--3:7},
year = {2023},
url = {https://doi.org/10.1145/3642979.3642984},
doi = {10.1145/3642979.3642984},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Sakai23a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SandersonLHGS23,
author = {Mark Sanderson and
Ramon Lobato and
Kieran Hegarty and
Lisa M. Given and
Chirag Shah},
title = {Report on The Web Search Revolution: Symposium},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {14:1--14:10},
year = {2023},
url = {https://doi.org/10.1145/3642979.3642996},
doi = {10.1145/3642979.3642996},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SandersonLHGS23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SenSB23,
author = {Procheta Sen and
Tulika Saha and
Danushka Bollegala},
title = {Report on the 1st Symposium on {NLP} for Social: Good {(NSG} 2023)},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {7:1--7:9},
year = {2023},
url = {https://doi.org/10.1145/3642979.3642989},
doi = {10.1145/3642979.3642989},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SenSB23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ShahW23,
author = {Chirag Shah and
Ryen W. White},
title = {Report on the 1st Workshop on Task Focused {IR} in the Era of Generative
{AI}},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {20:1--20:8},
year = {2023},
url = {https://doi.org/10.1145/3642979.3643002},
doi = {10.1145/3642979.3643002},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ShahW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SpaniolBA23,
author = {Marc Spaniol and
Ricardo Baeza{-}Yates and
Omar Alonso},
title = {Report on the 13th Workshop on Temporal Web Analytics (TempWeb 2023)
at {WWW} 2023},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {6:1--6:6},
year = {2023},
url = {https://doi.org/10.1145/3642979.3642988},
doi = {10.1145/3642979.3642988},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SpaniolBA23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Teevan23,
author = {Jaime Teevan},
title = {How the Web Will Shape the Hybrid Work Era: {A} Keynote at {WWW} 2022},
journal = {{SIGIR} Forum},
volume = {57},
number = {1},
pages = {2:1--2:4},
year = {2023},
url = {https://doi.org/10.1145/3636341.3636345},
doi = {10.1145/3636341.3636345},
timestamp = {Tue, 02 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Teevan23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/VerberneSSG23,
author = {Suzan Verberne and
Hussein Suleman and
Luca Soldaini and
Avijit Ghosh},
title = {Report on the {SIGIR} 2023 Session on Diversity, Equity and Inclusivity},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {11:1--11:2},
year = {2023},
url = {https://doi.org/10.1145/3642979.3642993},
doi = {10.1145/3642979.3642993},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/VerberneSSG23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WangN23,
author = {Haixun Wang and
Taesik Na},
title = {Rethinking E-Commerce Search},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {24:1--24:19},
year = {2023},
url = {https://doi.org/10.1145/3642979.3643007},
doi = {10.1145/3642979.3643007},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/WangN23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WangYHYMW23,
author = {Liang Wang and
Nan Yang and
Xiaolong Huang and
Linjun Yang and
Rangan Majumder and
Furu Wei},
title = {Large Search Model: Redefining Search Stack in the Era of LLMs},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {23:1--23:16},
year = {2023},
url = {https://doi.org/10.1145/3642979.3643006},
doi = {10.1145/3642979.3643006},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/WangYHYMW23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/White23,
author = {Ryen W. White},
title = {Tasks, Copilots, and the Future of Search: {A} Keynote at {SIGIR}
2023},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {4:1--4:8},
year = {2023},
url = {https://doi.org/10.1145/3642979.3642985},
doi = {10.1145/3642979.3642985},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/White23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/YoshiokaAK23,
author = {Masaharu Yoshioka and
Mohammad Aliannejadi and
Julia Kiseleva},
title = {Report on the 9th {ACM} {SIGIR} / the 13th International Conference
on the Theory of Information Retrieval {(ICTIR} 2023)},
journal = {{SIGIR} Forum},
volume = {57},
number = {2},
pages = {10:1--10:5},
year = {2023},
url = {https://doi.org/10.1145/3642979.3642992},
doi = {10.1145/3642979.3642992},
timestamp = {Fri, 23 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/YoshiokaAK23.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AhlersW22,
author = {Dirk Ahlers and
Erik Wilde},
title = {Report on the 12th International Workshop on Location and the Web
(LocWeb 2022) at {WWW} 2022},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {6:1--6:6},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582910},
doi = {10.1145/3582900.3582910},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AhlersW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BalogMSW22,
author = {Krisztian Balog and
Paramita Mirza and
Martin G. Skj{\ae}veland and
Zhilin Wang},
title = {Report on the Workshop on Personal Knowledge Graphs {(PKG} 2021) at
{AKBC} 2021},
journal = {{SIGIR} Forum},
volume = {56},
number = {1},
pages = {4:1--4:11},
year = {2022},
url = {https://doi.org/10.1145/3582524.3582531},
doi = {10.1145/3582524.3582531},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BalogMSW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BalogNS22,
author = {Krisztian Balog and
Kjetil N{\o}rv{\aa}g and
Vinay Setty},
title = {Report on the 44th European Conference on Information Retrieval {(ECIR}
2022): The First Major Hybrid {IR} Conference},
journal = {{SIGIR} Forum},
volume = {56},
number = {1},
pages = {8:1--8:12},
year = {2022},
url = {https://doi.org/10.1145/3582524.3582535},
doi = {10.1145/3582524.3582535},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BalogNS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BarronCedenoMEFFHMPPS22,
author = {Alberto Barr{\'{o}}n{-}Cede{\~{n}}o and
Giovanni Da San Martino and
Mirko Degli Esposti and
Guglielmo Faggioli and
Nicola Ferro and
Allan Hanbury and
Craig Macdonald and
Gabriella Pasi and
Martin Potthast and
Fabrizio Sebastiani},
title = {Report on the 13th Conference and Labs of the Evaluation Forum {(CLEF}
2022): Experimental {IR} Meets Multilinguality, Multimodality, and
Interaction},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {13:1--13:15},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582917},
doi = {10.1145/3582900.3582917},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BarronCedenoMEFFHMPPS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BruchLN22,
author = {Sebastian Bruch and
Claudio Lucchese and
Franco Maria Nardini},
title = {Report on the 1st Workshop on Reaching Efficiency in Neural Information
Retrieval (ReNeuIR 2022) at {SIGIR} 2022},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {12:1--12:14},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582916},
doi = {10.1145/3582900.3582916},
timestamp = {Sun, 06 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/BruchLN22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CamposJJBLCRSM22,
author = {Ricardo Campos and
Al{\'{\i}}pio M. Jorge and
Adam Jatowt and
Sumit Bhatia and
Marina Litvak and
Jo{\~{a}}o Paulo Cordeiro and
Concei{\c{c}}{\~{a}}o Rocha and
Hugo O. Sousa and
Behrooz Mansouri},
title = {Report on the 5th International Workshop on Narrative Extraction from
Texts (Text2Story 2022) at {ECIR} 2022},
journal = {{SIGIR} Forum},
volume = {56},
number = {1},
pages = {10:1--10:10},
year = {2022},
url = {https://doi.org/10.1145/3582524.3582537},
doi = {10.1145/3582524.3582537},
timestamp = {Wed, 14 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CamposJJBLCRSM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Carterette22,
author = {Ben Carterette},
title = {Chair's Letter},
journal = {{SIGIR} Forum},
volume = {56},
number = {1},
pages = {1:1--1:3},
year = {2022},
url = {https://doi.org/10.1145/3582524.3582526},
doi = {10.1145/3582524.3582526},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Carterette22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Chatterjee22,
author = {Shubham Chatterjee},
title = {Answering Topical Information Needs Using Neural Entity-Oriented Information
Retrieval and Extraction},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {20:1--20:2},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582926},
doi = {10.1145/3582900.3582926},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Chatterjee22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Chen22,
author = {Zhiyu Chen},
title = {Dataset Search and Augmentation},
journal = {{SIGIR} Forum},
volume = {56},
number = {1},
pages = {15:1--15:2},
year = {2022},
url = {https://doi.org/10.1145/3582524.3582544},
doi = {10.1145/3582524.3582544},
timestamp = {Tue, 27 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Chen22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DeffayetTRR22,
author = {Romain Deffayet and
Thibaut Thonet and
Jean{-}Michel Renders and
Maarten de Rijke},
title = {Offline Evaluation for Reinforcement Learning-Based Recommendation:
{A} Critical Issue and Some Alternatives},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {3:1--3:14},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582905},
doi = {10.1145/3582900.3582905},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DeffayetTRR22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DemartiniYS22,
author = {Gianluca Demartini and
Jie Yang and
Shazia W. Sadiq},
title = {Report on the 1st Workshop on Human-in-the-Loop Data Curation {(HIL-DC}
2022) at {CIKM} 2022},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {17:1--17:8},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582921},
doi = {10.1145/3582900.3582921},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DemartiniYS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Dietz22,
author = {Laura Dietz},
title = {{ACM} {SIG} {IR} Annual Business Meeting 2022: Secretary's Notes},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {2:1--2:8},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582903},
doi = {10.1145/3582900.3582903},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Dietz22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Dignum22,
author = {Virginia Dignum},
title = {Responsible Artificial Intelligence - From Principles to Practice:
{A} Keynote at TheWebConf 2022},
journal = {{SIGIR} Forum},
volume = {56},
number = {1},
pages = {3:1--3:6},
year = {2022},
url = {https://doi.org/10.1145/3582524.3582529},
doi = {10.1145/3582524.3582529},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Dignum22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DrakopoulosK22,
author = {Georgios Drakopoulos and
Eleanna Kafeza},
title = {Report on the 2nd International Workshop on Transforms in Behavioral
and Affective Computing {(THECOG} 2022) at {CIKM} 2022},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {18:1--18:7},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582922},
doi = {10.1145/3582900.3582922},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DrakopoulosK22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Flach22,
author = {Peter A. Flach},
title = {Empirical Evaluation of Predictive Models: {A} keynote at {ECIR} 2022},
journal = {{SIGIR} Forum},
volume = {56},
number = {1},
pages = {2:1--2:5},
year = {2022},
url = {https://doi.org/10.1145/3582524.3582528},
doi = {10.1145/3582524.3582528},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Flach22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GhoshGGBCGPRMRBSBDBAN22,
author = {Saptarshi Ghosh and
Kripabandhu Ghosh and
Debasis Ganguly and
Arnab Bhattacharya and
Partha Pratim Chakrabarti and
Shouvik Kumar Guha and
Arindam Pal and
Koustav Rudra and
Prasenjit Majumder and
Dwaipayan Roy and
Ayan Bandopadhyay and
Procheta Sen and
Paheli Bhattacharya and
Aniket Deroy and
Upal Bhattacharya and
Subinay Adhikary and
Subham Kumar Nigam},
title = {Report on the 2nd Symposium on Artificial Intelligence and Law {(SAIL)}
2022},
journal = {{SIGIR} Forum},
volume = {56},
number = {1},
pages = {11:1--11:7},
year = {2022},
url = {https://doi.org/10.1145/3582524.3582538},
doi = {10.1145/3582524.3582538},
timestamp = {Fri, 08 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/GhoshGGBCGPRMRBSBDBAN22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GoharianHMV22,
author = {Nazli Goharian and
Faegheh Hasibi and
Maria Maistro and
Suzan Verberne},
title = {Report on the {SIGIR} 2022 Session on Women in {IR} {(WIR)}},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {10:1--10:2},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582914},
doi = {10.1145/3582900.3582914},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/GoharianHMV22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hiemstra22,
author = {Djoerd Hiemstra},
title = {Was Fairness in {IR} Discussed by Cooper and Robertson in the 1970's?},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {19:1--19:5},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582924},
doi = {10.1145/3582900.3582924},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Hiemstra22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HuibersPMLF22,
author = {Theo Huibers and
Maria Soledad Pera and
Emiliana Murgia and
Monica Landoni and
Jerry Alan Fails},
title = {Report on the 6th International and Interdisciplinary Perspectives
on Children {\&} Recommender and Information Retrieval Systems
(KidRec 2022) Workshop at {ACM} {IDC} 2022: Information Retrieval
Systems for Children in the {COVID-19} Era},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {8:1--8:5},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582912},
doi = {10.1145/3582900.3582912},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/HuibersPMLF22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JonesECCJKS22,
author = {Gareth J. F. Jones and
Maria Eskevich and
Ben Carterette and
Joana Correia and
Rosie Jones and
Jussi Karlgren and
Ian Soboroff},
title = {Report on the 1st Workshop on Audio Collection Human Interaction (AudioCHI
2022) at {CHIIR} 2022},
journal = {{SIGIR} Forum},
volume = {56},
number = {1},
pages = {7:1--7:5},
year = {2022},
url = {https://doi.org/10.1145/3582524.3582534},
doi = {10.1145/3582524.3582534},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/JonesECCJKS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LopesRNPF22,
author = {Carla Teixeira Lopes and
Cristina Ribeiro and
Franco Niccolucci and
Mar{\'{\i}}a Poveda{-}Villal{\'{o}}n and
Nuno Freire},
title = {Report on the 2nd Linked Archives International Workshop (LinkedArchives
2022) at {TPDL} 2022},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {14:1--14:8},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582918},
doi = {10.1145/3582900.3582918},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LopesRNPF22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MackenzieS22,
author = {Joel Mackenzie and
Damiano Spina},
title = {Report on the 25th Australasian Document Computing Symposium {(ADCS}
2021)},
journal = {{SIGIR} Forum},
volume = {56},
number = {1},
pages = {5:1--5:5},
year = {2022},
url = {https://doi.org/10.1145/3582524.3582532},
doi = {10.1145/3582524.3582532},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/MackenzieS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Moraes22,
author = {Felipe Moraes},
title = {Examining the Effectiveness of Collaborative Search Engines},
journal = {{SIGIR} Forum},
volume = {56},
number = {1},
pages = {14:1--14:2},
year = {2022},
url = {https://doi.org/10.1145/3582524.3582543},
doi = {10.1145/3582524.3582543},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Moraes22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Murdock22,
author = {Vanessa Murdock},
title = {Letter from the Chair},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {1:1--1:3},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582902},
doi = {10.1145/3582900.3582902},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Murdock22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PetrocchiV22,
author = {Marinella Petrocchi and
Marco Viviani},
title = {Report on the 2nd Workshop on Reducing Online Misinformation through
Credible Information Retrieval {(ROMCIR} 2022) at {ECIR} 2022},
journal = {{SIGIR} Forum},
volume = {56},
number = {1},
pages = {9:1--9:9},
year = {2022},
url = {https://doi.org/10.1145/3582524.3582536},
doi = {10.1145/3582524.3582536},
timestamp = {Mon, 21 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/PetrocchiV22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PiscopoIVMB22,
author = {Alessandro Piscopo and
Oana Inel and
Sanne Vrijenhoek and
Martijn Millecamp and
Krisztian Balog},
title = {Report on the 1st Workshop on Measuring the Quality of Explanations
in Recommender Systems {(QUARE} 2022) at {SIGIR} 2022},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {11:1--11:16},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582915},
doi = {10.1145/3582900.3582915},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/PiscopoIVMB22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sabir22,
author = {Ahmed Sabir},
title = {Enhancing Scene Text Recognition with Visual Context Information},
journal = {{SIGIR} Forum},
volume = {56},
number = {1},
pages = {13:1--13:2},
year = {2022},
url = {https://doi.org/10.1145/3582524.3582542},
doi = {10.1145/3582524.3582542},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Sabir22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SalampasisPH22,
author = {Michail Salampasis and
Florina Piroi and
Allan Hanbury},
title = {Report on the 1st Training School on Domain Specific Systems for Information
Extraction and Retrieval (DoSSIER 2022)},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {16:1--16:8},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582920},
doi = {10.1145/3582900.3582920},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SalampasisPH22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sarikaya22,
author = {Ruhi Sarikaya},
title = {Intelligent Conversational Agents for Ambient Computing: {A} Keynote
at {SIGIR} 2022},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {4:1--4:10},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582907},
doi = {10.1145/3582900.3582907},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Sarikaya22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SpaniolBA22,
author = {Marc Spaniol and
Ricardo Baeza{-}Yates and
Omar Alonso},
title = {Report on the 12th Temporal Web Analytics Workshop (TempWeb 2022)
at {WWW} 2022},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {5:1--5:6},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582909},
doi = {10.1145/3582900.3582909},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SpaniolBA22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TamineAM22,
author = {Lynda Tamine and
Enrique Amig{\'{o}} and
Josiane Mothe},
title = {Report on the 2nd Joint Conference of the Information Retrieval Communities
in Europe {(CIRCLE} 2022)},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {9:1--9:10},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582913},
doi = {10.1145/3582900.3582913},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/TamineAM22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TrippasMABCCIMOPPTX22,
author = {Johanne Trippas and
David Maxwell and
Abdulaziz AlQatan and
Miriam Boom and
Catherine Chavula and
Anita Crescenzi and
Luis{-}Daniel Ib{\'{a}}{\~{n}}ez and
Selina Meyer and
Anna{-}Marie Ortloff and
Srishti Palani and
Dolinkumar Patel and
Wiebke Thode and
Zhaopeng Xing},
title = {Report on the 1st Early Career Researchers' Roundtable for Information
Access Research (ECRs4IR 2022) at {CHIIR} 2022},
journal = {{SIGIR} Forum},
volume = {56},
number = {1},
pages = {6:1--6:10},
year = {2022},
url = {https://doi.org/10.1145/3582524.3582533},
doi = {10.1145/3582524.3582533},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/TrippasMABCCIMOPPTX22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/YamamotoDKCKL22,
author = {Takehiro Yamamoto and
Zhicheng Dou and
Noriko Kando and
Charles L. A. Clarke and
Makoto P. Kato and
Yiqun Liu},
title = {Report on the 16th Round of {NII} Testbeds and Community for Information
Access Research {(NTCIR-16)}},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {7:1--7:8},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582911},
doi = {10.1145/3582900.3582911},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/YamamotoDKCKL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZangerleBS22,
author = {Eva Zangerle and
Christine Bauer and
Alan Said},
title = {Report on the 2nd Workshop on the Perspectives on the Evaluation of
Recommender Systems {(PERSPECTIVES} 2022) at RecSys 2022},
journal = {{SIGIR} Forum},
volume = {56},
number = {2},
pages = {15:1--15:4},
year = {2022},
url = {https://doi.org/10.1145/3582900.3582919},
doi = {10.1145/3582900.3582919},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ZangerleBS22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zobel22,
author = {Justin Zobel},
title = {When Measurement Misleads: The Limits of Batch Assessment of Retrieval
Systems},
journal = {{SIGIR} Forum},
volume = {56},
number = {1},
pages = {12:1--12:20},
year = {2022},
url = {https://doi.org/10.1145/3582524.3582540},
doi = {10.1145/3582524.3582540},
timestamp = {Sun, 26 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Zobel22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AhlersWSBA21,
author = {Dirk Ahlers and
Erik Wilde and
Marc Spaniol and
Ricardo Baeza{-}Yates and
Omar Alonso},
title = {Report on the 11th international workshop on location and the web
(LocWeb 2021) and the 11th temporal web analytics workshop (TempWeb2021)
at {WWW2021}},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {6:1--6:7},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527555},
doi = {10.1145/3527546.3527555},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AhlersWSBA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlonsoMNS21,
author = {Omar Alonso and
Stefano Marchesin and
Marc Najork and
Gianmaria Silvello},
title = {Report on the 2nd international conference on design of experimental
search {\&} information retrieval systems {(DESIRES} 2021)},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {14:1--14:13},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527563},
doi = {10.1145/3527546.3527563},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AlonsoMNS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AnelliBBNDMMNPP21,
author = {Vito Walter Anelli and
Pierpaolo Basile and
Toine Bogers and
Tommaso Di Noia and
Francesco Maria Donini and
Bamshad Mobasher and
Cataldo Musto and
Fedelucio Narducci and
Casper Petersen and
Maria Soledad Pera and
Markus Zanker},
title = {Report on the 3rd workshop of knowledge-aware and conversational recommender
systems (KARS/ComplexRec) at RecSys 2021},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {17:1--17:9},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527566},
doi = {10.1145/3527546.3527566},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AnelliBBNDMMNPP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BalogMTZ21,
author = {Krisztian Balog and
David Maxwell and
Paul Thomas and
Shuo Zhang},
title = {Report on the 1st simulation for information retrieval workshop (Sim4IR
2021) at {SIGIR} 2021},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {10:1--10:16},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527559},
doi = {10.1145/3527546.3527559},
timestamp = {Fri, 24 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BalogMTZ21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CamposJJBFCRRMA21,
author = {Ricardo Campos and
Al{\'{\i}}pio M. Jorge and
Adam Jatowt and
Sumit Bhatia and
Mark A. Finlayson and
Jo{\~{a}}o Paulo Cordeiro and
Concei{\c{c}}{\~{a}}o Rocha and
Alexandre Ribeiro and
Behrooz Mansouri and
Jeffery Ansah and
Arian Pasquali},
title = {Report on the 4th international workshop on narrative extraction from
texts (Text2Story 2021) at {ECIR} 2021},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {5:1--5:9},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527554},
doi = {10.1145/3527546.3527554},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/CamposJJBFCRRMA21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CandanFFGIJLMMP21,
author = {K. Sel{\c{c}}uk Candan and
Guglielmo Faggioli and
Nicola Ferro and
Lorraine Goeuriot and
Bogdan Ionescu and
Alexis Joly and
Birger Larsen and
Maria Maistro and
Henning M{\"{u}}ller and
Florina Piroi},
title = {Report on the 12th conference and labs of the evaluation forum {(CLEF}
2021): experimental {IR} meets multilinguality, multimodality, and
interaction},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {15:1--15:12},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527564},
doi = {10.1145/3527546.3527564},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CandanFFGIJLMMP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Carterette21,
author = {Ben Carterette},
title = {Chair's letter},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {1:1--1:2},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527548},
doi = {10.1145/3527546.3527548},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Carterette21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Devezas21,
author = {Jos{\'{e}} Devezas},
title = {Graph-based entity-oriented search},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {15:1--15:2},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476430},
doi = {10.1145/3476415.3476430},
timestamp = {Tue, 10 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Devezas21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FailsLHP21,
author = {Jerry Alan Fails and
Monica Landoni and
Theo Huibers and
Maria Soledad Pera},
title = {Report on the 5th workshop on international and interdisciplinary
perspectives on children {\&} recommender and information retrieval
systems (KidRec 2021) at {IDC} 2021: the teacher lens},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {7:1--7:6},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527556},
doi = {10.1145/3527546.3527556},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/FailsLHP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FrommholzCMV21,
author = {Ingo Frommholz and
Guillaume Cabanac and
Philipp Mayr and
Suzan Verberne},
title = {Report on the 11th bibliometric-enhanced information retrieval workshop
{(BIR} 2021)},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {11:1--11:9},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476426},
doi = {10.1145/3476415.3476426},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/FrommholzCMV21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FrommholzLM21,
author = {Ingo Frommholz and
Haiming Liu and
Massimo Melucci},
title = {Report on the 2nd workshop on bridging the gap between information
science, information retrieval and data science {(BIRDS} 2021)},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {8:1--8:6},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476423},
doi = {10.1145/3476415.3476423},
timestamp = {Tue, 10 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/FrommholzLM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GangulyJSVP21,
author = {Debasis Ganguly and
Gareth J. F. Jones and
Procheta Sen and
Manisha Verma and
Dipasree Pal},
title = {Report on supporting and understanding of conversational dialogues
workshop {(SUD} 2021) at {WSDM} 2021},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {5:1--5:7},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476420},
doi = {10.1145/3476415.3476420},
timestamp = {Tue, 10 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/GangulyJSVP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Gao21,
author = {Ruoyuan Gao},
title = {Toward a fairer information retrieval system},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {14:1--14:2},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476429},
doi = {10.1145/3476415.3476429},
timestamp = {Tue, 21 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Gao21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Ghosal21,
author = {Tirthankar Ghosal},
title = {Studies in aspects of peer review: novelty, scope, research lineage,
review significance, and peer review outcome},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {26:1--26:2},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527577},
doi = {10.1145/3527546.3527577},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Ghosal21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GhosalKHWF21,
author = {Tirthankar Ghosal and
Khalid Al Khatib and
Yufang Hou and
Anita de Waard and
Dayne Freitag},
title = {Report on the 1st workshop on argumentation knowledge graphs (ArgKG
2021) at {AKBC} 2021},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {19:1--19:12},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527568},
doi = {10.1145/3527546.3527568},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/GhosalKHWF21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GhosalSNB21,
author = {Tirthankar Ghosal and
Muskaan Singh and
Anja Nedoluzhko and
Ondrej Bojar},
title = {Report on the SIGDial 2021 special session on summarization of dialogues
and multi-party meetings (SummDial)},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {12:1--12:17},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527561},
doi = {10.1145/3527546.3527561},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/GhosalSNB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GoharianB21,
author = {Nazli Goharian and
Hannah Bast},
title = {Report on women in {IR} {(WIR} 2021) at {SIGIR} 2021},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {9:1--9:3},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527558},
doi = {10.1145/3527546.3527558},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/GoharianB21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GrausBKGV21,
author = {David Graus and
Toine Bogers and
Mesut Kaya and
Francisco Guti{\'{e}}rrez and
Katrien Verbert},
title = {Report on the 1st workshop on recommender systems for human resources
(RecSys in {HR} 2021) at RecSys 2021},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {18:1--18:14},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527567},
doi = {10.1145/3527546.3527567},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/GrausBKGV21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hauff21,
author = {Claudia Hauff},
title = {{ACM} {SIGIR} annual business meeting 2021: secretary's notes},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {2:1--2:5},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527549},
doi = {10.1145/3527546.3527549},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Hauff21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hiemstra21,
author = {Djoerd Hiemstra},
title = {Report on the {ECIR} 2021 discussion panel on open access},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {10:1--10:4},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476425},
doi = {10.1145/3476415.3476425},
timestamp = {Tue, 10 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Hiemstra21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JonesBKP21,
author = {Gareth J. F. Jones and
Nicholas J. Belkin and
Noriko Kando and
Gabriella Pasi},
title = {Report on the {CHIIR} 2021 third workshop on evaluation of personalisation
in information retrieval {(WEPIR} 2021)},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {7:1--7:11},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476422},
doi = {10.1145/3476415.3476422},
timestamp = {Tue, 10 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/JonesBKP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KatoLKC21,
author = {Makoto P. Kato and
Yiqun Liu and
Noriko Kando and
Charles L. A. Clarke},
title = {Report on the 15th round of {NII} testbeds and community for information
access research {(NTCIR-15)}},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {21:1--21:6},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527570},
doi = {10.1145/3527546.3527570},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KatoLKC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kim21,
author = {Jaehun Kim},
title = {Increasing trust in complex machine learning systems: studies in the
music domain},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {20:1--20:3},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476435},
doi = {10.1145/3476415.3476435},
timestamp = {Tue, 10 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Kim21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KleanthousOBGHK21,
author = {Styliani Kleanthous and
Jahna Otterbacher and
Jo Bates and
Fausto Giunchiglia and
Frank Hopfgartner and
Tsvi Kuflik and
Kalia Orphanou and
Monica Lestari Paramita and
Michael Rovatsos and
Avital Shulner{-}Tal},
title = {Report on the CyCAT winter school on fairness, accountability, transparency
and ethics {(FATE)} in {AI}},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {4:1--4:9},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476419},
doi = {10.1145/3476415.3476419},
timestamp = {Sat, 29 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/KleanthousOBGHK21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KosmerljGL21,
author = {Aljaz Kosmerlj and
Marko Grobelnik and
Jure Leskovec},
title = {Report on the 30th the web conference 2021 (TheWebConf2021)},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {12:1--12:9},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476427},
doi = {10.1145/3476415.3476427},
timestamp = {Tue, 10 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/KosmerljGL21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LandoniMHP21,
author = {Monica Landoni and
Emiliana Murgia and
Theo Huibers and
Maria Soledad Pera},
title = {Report on the 1st {IR} for children 2000-2020: where are we now? {(IR4C)}
workshop at {SIGIR} 2021: the need to spotlight research on children
information retrieval},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {11:1--11:7},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527560},
doi = {10.1145/3527546.3527560},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/LandoniMHP21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Li21,
author = {Chang Li},
title = {Optimizing ranking systems online as bandits},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {24:1--24:2},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527575},
doi = {10.1145/3527546.3527575},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Li21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lin21,
author = {Jimmy Lin},
title = {A proposed conceptual framework for a representational approach to
information retrieval},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {4:1--4:29},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527552},
doi = {10.1145/3527546.3527552},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Lin21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LopesRNRF21,
author = {Carla Teixeira Lopes and
Cristina Ribeiro and
Franco Niccolucci and
Irene Pimenta Rodrigues and
Nuno Miguel Antunes Freire},
title = {Report on the 1st linked archives international workshop (LinkedArchives
2021) at {TPDL} 2021},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {13:1--13:11},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527562},
doi = {10.1145/3527546.3527562},
timestamp = {Mon, 28 Mar 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/LopesRNRF21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MacAvaney21,
author = {Sean MacAvaney},
title = {Effective and practical neural ranking},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {17:1--17:2},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476432},
doi = {10.1145/3476415.3476432},
timestamp = {Tue, 10 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/MacAvaney21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Mani21,
author = {Ganesh Mani},
title = {The web conference keynote - {AI} grand challenges: past, present
and future},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {1:1--1:4},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476416},
doi = {10.1145/3476415.3476416},
timestamp = {Tue, 10 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Mani21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Marchesin21,
author = {Stefano Marchesin},
title = {Developing unsupervised knowledge-enhanced models to reduce the semantic
gap in information retrieval},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {18:1--18:2},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476433},
doi = {10.1145/3476415.3476433},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Marchesin21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MedlarG21,
author = {Alan Medlar and
Dorota Glowacka},
title = {Game over?: a review of gamification in information retrieval},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {3:1--3:18},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527551},
doi = {10.1145/3527546.3527551},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/MedlarG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MehtaMMG21,
author = {Parth Mehta and
Thomas Mandl and
Prasenjit Majumder and
Surupendu Gangopadhyay},
title = {Report on the {FIRE} 2020 evaluation initiative},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {3:1--3:11},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476418},
doi = {10.1145/3476415.3476418},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/MehtaMMG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MetzlerTBN21,
author = {Donald Metzler and
Yi Tay and
Dara Bahri and
Marc Najork},
title = {Rethinking search: making domain experts out of dilettantes},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {13:1--13:27},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476428},
doi = {10.1145/3476415.3476428},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/MetzlerTBN21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Mitra21,
author = {Bhaskar Mitra},
title = {Neural methods for effective, efficient, and exposure-aware information
retrieval},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {19:1--19:2},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476434},
doi = {10.1145/3476415.3476434},
timestamp = {Thu, 28 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Mitra21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MoffatM21,
author = {Alistair Moffat and
Joel Mackenzie},
title = {Conferences, journals, preprints, and reviewer expectations},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {22:1--22:8},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527572},
doi = {10.1145/3527546.3527572},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/MoffatM21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PeregoS21,
author = {Raffaele Perego and
Fabrizio Sebastiani},
title = {Report on the 43rd european conference on information retrieval {(ECIR}
2021)},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {9:1--9:5},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476424},
doi = {10.1145/3476415.3476424},
timestamp = {Tue, 10 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/PeregoS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PotthastSH21,
author = {Martin Potthast and
Benno Stein and
Matthias Hagen},
title = {The information retrieval anthology 2021: inaugural status report
and challenges ahead},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {2:1--2:18},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476417},
doi = {10.1145/3476415.3476417},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/PotthastSH21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sen21,
author = {Procheta Sen},
title = {Proactive information retrieval},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {25:1--25:2},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527576},
doi = {10.1145/3527546.3527576},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Sen21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ShahSDMPSV21,
author = {Chirag Shah and
Torsten Suel and
Fernando Diaz and
Bhaskar Mitra and
B{\'{a}}rbara Poblete and
Hussein Suleman and
Suzan Verberne},
title = {Report on the 44th international {ACM} {SIGIR} conference on research
and development in information retrieval {(SIGIR} 2021)},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {8:1--8:14},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527557},
doi = {10.1145/3527546.3527557},
timestamp = {Wed, 27 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/ShahSDMPSV21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SpinaTTJBCCCEFG21,
author = {Damiano Spina and
Johanne R. Trippas and
Paul Thomas and
Hideo Joho and
Katriina Bystr{\"{o}}m and
Leigh Clark and
Nick Craswell and
Mary Czerwinski and
David Elsweiler and
Alexander Frummet and
Souvick Ghosh and
Johannes Kiesel and
Irene Lopatovska and
Daniel McDuff and
Selina Meyer and
Ahmed Mourad and
Paul Owoicho and
Sachin Pathiyan Cherumanal and
Daniel Russell and
Laurianne Sitbon},
title = {Report on the future conversations workshop at {CHIIR} 2021},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {6:1--6:22},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476421},
doi = {10.1145/3476415.3476421},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SpinaTTJBCCCEFG21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/VakulenkoDC21,
author = {Svitlana Vakulenko and
Ondrej Dusek and
Leigh Clark},
title = {Report on the 6th workshop on search-oriented conversational {AI}
{(SCAI} 2021)},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {20:1--20:14},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527569},
doi = {10.1145/3527546.3527569},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/VakulenkoDC21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Voskarides21,
author = {Nikos Voskarides},
title = {Supporting search engines with knowledge and context},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {23:1--23:2},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527573},
doi = {10.1145/3527546.3527573},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Voskarides21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZangerleBS21,
author = {Eva Zangerle and
Christine Bauer and
Alan Said},
title = {Report on the 1st workshop on the perspectives on the evaluation of
recommender systems {(PERSPECTIVES} 2021) at RecSys 2021},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {16:1--16:5},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527565},
doi = {10.1145/3527546.3527565},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/ZangerleBS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zimmerman21,
author = {Steven Zimmerman},
title = {Exploring strategies to prevent harm from web search},
journal = {{SIGIR} Forum},
volume = {55},
number = {1},
pages = {16:1--16:2},
year = {2021},
url = {https://doi.org/10.1145/3476415.3476431},
doi = {10.1145/3476415.3476431},
timestamp = {Tue, 10 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Zimmerman21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zou21,
author = {Jie Zou},
title = {Improving search and recommendation by asking clarifying questions},
journal = {{SIGIR} Forum},
volume = {55},
number = {2},
pages = {27:1--27:2},
year = {2021},
url = {https://doi.org/10.1145/3527546.3527578},
doi = {10.1145/3527546.3527578},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Zou21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgostiACT20,
author = {Maristella Agosti and
Maurizio Atzori and
Paolo Ciaccia and
Letizia Tanca},
title = {Report on {SEBD} 2020: the 28th Italian symposium on advanced database
systems},
journal = {{SIGIR} Forum},
volume = {54},
number = {2},
pages = {7:1--7:5},
year = {2020},
url = {https://doi.org/10.1145/3483382.3483392},
doi = {10.1145/3483382.3483392},
timestamp = {Tue, 14 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AgostiACT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AhlersWSA20,
author = {Dirk Ahlers and
Erik Wilde and
Rossano Schifanella and
Jalal S. Alowibdi},
title = {Report on the tenth international workshop on location and the web
(LocWeb 2020): workshop held at the web conference, {WWW2020}},
journal = {{SIGIR} Forum},
volume = {54},
number = {1},
pages = {8:1--8:8},
year = {2020},
url = {https://doi.org/10.1145/3451964.3451972},
doi = {10.1145/3451964.3451972},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AhlersWSA20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AnandCHJSS20,
author = {Avishek Anand and
Lawrence Cavedon and
Matthias Hagen and
Hideo Joho and
Mark Sanderson and
Benno Stein},
title = {Dagstuhl seminar 19461 on conversational search: seminar goals and
working group outcomes},
journal = {{SIGIR} Forum},
volume = {54},
number = {1},
pages = {3:1--3:11},
year = {2020},
url = {https://doi.org/10.1145/3451964.3451967},
doi = {10.1145/3451964.3451967},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AnandCHJSS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ArampatzisCEFJK20,
author = {Avi Arampatzis and
Linda Cappellato and
Carsten Eickhoff and
Nicola Ferro and
Hideo Joho and
Evangelos Kanoulas and
Christina Lioma and
Aur{\'{e}}lie N{\'{e}}v{\'{e}}ol and
Theodora Tsikrika and
Stefanos Vrochidis},
title = {Report on {CLEF} 2020},
journal = {{SIGIR} Forum},
volume = {54},
number = {2},
pages = {11:1--11:10},
year = {2020},
url = {https://doi.org/10.1145/3483382.3483396},
doi = {10.1145/3483382.3483396},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ArampatzisCEFJK20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Bauer20,
author = {Christine Bauer},
title = {Report on the {ISMIR} 2020 special session: how do we help artists?},
journal = {{SIGIR} Forum},
volume = {54},
number = {2},
pages = {13:1--13:7},
year = {2020},
url = {https://doi.org/10.1145/3483382.3483398},
doi = {10.1145/3483382.3483398},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Bauer20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Berger-WolfCEKS20,
author = {Tanya Y. Berger{-}Wolf and
Ben Carterette and
Tamer Elsayed and
C. Maria Keet and
Fabrizio Sebastiani and
Hussein Suleman},
title = {Report on the 2nd {ACM} {SIGIR/SIGKDD} Africa school on machine learning
for data mining and search},
journal = {{SIGIR} Forum},
volume = {54},
number = {1},
pages = {4:1--4:6},
year = {2020},
url = {https://doi.org/10.1145/3451964.3451968},
doi = {10.1145/3451964.3451968},
timestamp = {Wed, 26 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Berger-WolfCEKS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BogersKMPT20,
author = {Toine Bogers and
Marijn Koolen and
Bamshad Mobasher and
Casper Petersen and
Alexander Tuzhilin},
title = {Report on the fourth workshop on recommendation in complex environments:
(ComplexRec 2020)},
journal = {{SIGIR} Forum},
volume = {54},
number = {2},
pages = {12:1--12:7},
year = {2020},
url = {https://doi.org/10.1145/3483382.3483397},
doi = {10.1145/3483382.3483397},
timestamp = {Tue, 14 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/BogersKMPT20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BorattoFMS20,
author = {Ludovico Boratto and
Stefano Faralli and
Mirko Marras and
Giovanni Stilo},
title = {Report on the international workshop on algorithmic bias in search
and recommendation (Bias 2020)},
journal = {{SIGIR} Forum},
volume = {54},
number = {1},
pages = {9:1--9:5},
year = {2020},
url = {https://doi.org/10.1145/3451964.3451973},
doi = {10.1145/3451964.3451973},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/BorattoFMS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BulathwelaPMOHS20,
author = {Sahan Bulathwela and
Mar{\'{\i}}a P{\'{e}}rez{-}Ortiz and
Rishabh Mehrotra and
Davor Orlic and
Colin de la Higuera and
John Shawe{-}Taylor and
Emine Yilmaz},
title = {Report on the {WSDM} 2020 workshop on state-based user modelling (SUM'20)},
journal = {{SIGIR} Forum},
volume = {54},
number = {1},
pages = {5:1--5:11},
year = {2020},
url = {https://doi.org/10.1145/3451964.3451969},
doi = {10.1145/3451964.3451969},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/BulathwelaPMOHS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Butnaru20,
author = {Andrei Madalin Butnaru},
title = {Machine learning applied in natural language processing},
journal = {{SIGIR} Forum},
volume = {54},
number = {1},
pages = {15:1--15:3},
year = {2020},
url = {https://doi.org/10.1145/3451964.3451979},
doi = {10.1145/3451964.3451979},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Butnaru20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CabanacFM20,
author = {Guillaume Cabanac and
Ingo Frommholz and
Philipp Mayr},
title = {Report on the 10th anniversary workshop on bibliometric-enhanced information
retrieval {(BIR} 2020)},
journal = {{SIGIR} Forum},
volume = {54},
number = {1},
pages = {10:1--10:9},
year = {2020},
url = {https://doi.org/10.1145/3451964.3451974},
doi = {10.1145/3451964.3451974},
timestamp = {Wed, 19 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/CabanacFM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CambazogluSSC20,
author = {Berkant Barla Cambazoglu and
Mark Sanderson and
Falk Scholer and
W. Bruce Croft},
title = {A review of public datasets in question answering research},
journal = {{SIGIR} Forum},
volume = {54},
number = {2},
pages = {5:1--5:23},
year = {2020},
url = {https://doi.org/10.1145/3483382.3483389},
doi = {10.1145/3483382.3483389},
timestamp = {Sun, 10 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/CambazogluSSC20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CamposJJBPCRMS20,
author = {Ricardo Campos and
Al{\'{\i}}pio M. Jorge and
Adam Jatowt and
Sumit Bhatia and
Arian Pasquali and
Jo{\~{a}}o Paulo Cordeiro and
Concei{\c{c}}{\~{a}}o Rocha and
Behrooz Mansouri and
Brenda Salenave Santana},
title = {Report on the third international workshop on narrative extraction
from texts (Text2Story 2020)},
journal = {{SIGIR} Forum},
volume = {54},
number = {1},
pages = {11:1--11:8},
year = {2020},
url = {https://doi.org/10.1145/3451964.3451975},
doi = {10.1145/3451964.3451975},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/CamposJJBPCRMS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CantadorCMM20,
author = {Iv{\'{a}}n Cantador and
Max Chevalier and
Massimo Melucci and
Josiane Mothe},
title = {{CIRCLE} 2020: the first joint conference of the information retrieval
communities in Europe},
journal = {{SIGIR} Forum},
volume = {54},
number = {2},
pages = {9:1--9:9},
year = {2020},
url = {https://doi.org/10.1145/3483382.3483394},
doi = {10.1145/3483382.3483394},
timestamp = {Tue, 14 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/CantadorCMM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fuhr20,
author = {Norbert Fuhr},
title = {Proof by experimentation?: towards better {IR} research},
journal = {{SIGIR} Forum},
volume = {54},
number = {2},
pages = {2:1--2:4},
year = {2020},
url = {https://doi.org/10.1145/3483382.3483385},
doi = {10.1145/3483382.3483385},
timestamp = {Tue, 14 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Fuhr20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Garigliotti20,
author = {Dar{\'{\i}}o Garigliotti},
title = {Task-based support in search engines},
journal = {{SIGIR} Forum},
volume = {54},
number = {1},
pages = {16:1--16:2},
year = {2020},
url = {https://doi.org/10.1145/3451964.3451980},
doi = {10.1145/3451964.3451980},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Garigliotti20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GoharianMV20,
author = {Nazli Goharian and
Xin Ma and
Suzan Verberne},
title = {Women and disparities in leadership and wages},
journal = {{SIGIR} Forum},
volume = {54},
number = {2},
pages = {10:1--10:3},
year = {2020},
url = {https://doi.org/10.1145/3483382.3483395},
doi = {10.1145/3483382.3483395},
timestamp = {Tue, 14 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/GoharianMV20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HiemstraMPS20,
author = {Djoerd Hiemstra and
Marie{-}Francine Moens and
Raffaele Perego and
Fabrizio Sebastiani},
title = {Transitioning the information retrieval literature to a fully open
access model},
journal = {{SIGIR} Forum},
volume = {54},
number = {1},
pages = {13:1--13:10},
year = {2020},
url = {https://doi.org/10.1145/3451964.3451977},
doi = {10.1145/3451964.3451977},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/HiemstraMPS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HuangRRSHYR20,
author = {Xiao Huang and
Pengjie Ren and
Zhaochun Ren and
Fei Sun and
Xiangnan He and
Dawei Yin and
Maarten de Rijke},
title = {Report on the international workshop on natural language processing
for recommendations {(NLP4REC} 2020) workshop held at {WSDM} 2020},
journal = {{SIGIR} Forum},
volume = {54},
number = {1},
pages = {6:1--6:5},
year = {2020},
url = {https://doi.org/10.1145/3451964.3451970},
doi = {10.1145/3451964.3451970},
timestamp = {Tue, 07 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/HuangRRSHYR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LandoniPFMKH20,
author = {Monica Landoni and
Maria Soledad Pera and
Jerry Alan Fails and
Emiliana Murgia and
Natalia Kucirkova and
Theo Huibers},
title = {4\emph{\({}^{\mbox{th}}\)} KidRec - what does good look like: from
design, research, and practice to policy},
journal = {{SIGIR} Forum},
volume = {54},
number = {2},
pages = {6:1--6:7},
year = {2020},
url = {https://doi.org/10.1145/3483382.3483391},
doi = {10.1145/3483382.3483391},
timestamp = {Tue, 14 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/LandoniPFMKH20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Li20,
author = {Dan Li},
title = {Effective collection construction for information retrieval evaluation
and optimization},
journal = {{SIGIR} Forum},
volume = {54},
number = {2},
pages = {15:1--15:2},
year = {2020},
url = {https://doi.org/10.1145/3483382.3483401},
doi = {10.1145/3483382.3483401},
timestamp = {Mon, 10 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Li20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LiuMXZM20,
author = {Yiqun Liu and
Jiaxin Mao and
Xiaohui Xie and
Min Zhang and
Shaoping Ma},
title = {Challenges in designing a brain-machine search interface},
journal = {{SIGIR} Forum},
volume = {54},
number = {2},
pages = {3:1--3:13},
year = {2020},
url = {https://doi.org/10.1145/3483382.3483387},
doi = {10.1145/3483382.3483387},
timestamp = {Tue, 14 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/LiuMXZM20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Mackenzie20,
author = {Joel M. Mackenzie},
title = {Managing tail latency in large scale information retrieval systems},
journal = {{SIGIR} Forum},
volume = {54},
number = {1},
pages = {18:1--18:2},
year = {2020},
url = {https://doi.org/10.1145/3451964.3451982},
doi = {10.1145/3451964.3451982},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Mackenzie20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Mishra20,
author = {Shubhanshu Mishra},
title = {Information extraction from digital social trace data with applications
to social media and scholarly communication data},
journal = {{SIGIR} Forum},
volume = {54},
number = {1},
pages = {17:1--17:2},
year = {2020},
url = {https://doi.org/10.1145/3451964.3451981},
doi = {10.1145/3451964.3451981},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Mishra20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/NunesLBBCCCFFJJ20,
author = {S{\'{e}}rgio Nunes and
Suzanne Little and
Sumit Bhatia and
Ludovico Boratto and
Guillaume Cabanac and
Ricardo Campos and
Francisco M. Couto and
Stefano Faralli and
Ingo Frommholz and
Adam Jatowt and
Al{\'{\i}}pio Jorge and
Mirko Marras and
Philipp Mayr and
Giovanni Stilo},
title = {{ECIR} 2020 workshops: assessing the impact of going online},
journal = {{SIGIR} Forum},
volume = {54},
number = {1},
pages = {7:1--7:11},
year = {2020},
url = {https://doi.org/10.1145/3451964.3451971},
doi = {10.1145/3451964.3451971},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/NunesLBBCCCFFJJ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Oosterhuis20,
author = {Harrie Oosterhuis},
title = {Learning from user interactions with rankings: a unification of the
field},
journal = {{SIGIR} Forum},
volume = {54},
number = {2},
pages = {16:1--16:2},
year = {2020},
url = {https://doi.org/10.1145/3483382.3483402},
doi = {10.1145/3483382.3483402},
timestamp = {Tue, 14 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Oosterhuis20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PotthastHS20,
author = {Martin Potthast and
Matthias Hagen and
Benno Stein},
title = {The dilemma of the direct answer},
journal = {{SIGIR} Forum},
volume = {54},
number = {1},
pages = {14:1--14:12},
year = {2020},
url = {https://doi.org/10.1145/3451964.3451978},
doi = {10.1145/3451964.3451978},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/PotthastHS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Roitero20,
author = {Kevin Roitero},
title = {Cheap {IR} evaluation: fewer topics, no relevance judgements, and
crowdsourced assessments},
journal = {{SIGIR} Forum},
volume = {54},
number = {2},
pages = {14:1--14:2},
year = {2020},
url = {https://doi.org/10.1145/3483382.3483400},
doi = {10.1145/3483382.3483400},
timestamp = {Tue, 14 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Roitero20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SafaviMORDX20,
author = {Tara Safavi and
Edgar Meij and
Fatma {\"{O}}zcan and
Miriam Redi and
Gianluca Demartini and
Chenyan Xiong},
title = {Report on the first workshop on bias in automatic knowledge graph
construction at {AKBC} 2020},
journal = {{SIGIR} Forum},
volume = {54},
number = {2},
pages = {8:1--8:9},
year = {2020},
url = {https://doi.org/10.1145/3483382.3483393},
doi = {10.1145/3483382.3483393},
timestamp = {Tue, 14 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/SafaviMORDX20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sakai20,
author = {Tetsuya Sakai},
title = {On Fuhr's guideline for {IR} evaluation},
journal = {{SIGIR} Forum},
volume = {54},
number = {1},
pages = {12:1--12:8},
year = {2020},
url = {https://doi.org/10.1145/3451964.3451976},
doi = {10.1145/3451964.3451976},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Sakai20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TsagkiasKKMR20,
author = {Manos Tsagkias and
Tracy Holloway King and
Surya Kallumadi and
Vanessa Murdock and
Maarten de Rijke},
title = {Challenges and research opportunities in eCommerce search and recommendations},
journal = {{SIGIR} Forum},
volume = {54},
number = {1},
pages = {2:1--2:23},
year = {2020},
url = {https://doi.org/10.1145/3451964.3451966},
doi = {10.1145/3451964.3451966},
timestamp = {Sun, 06 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/TsagkiasKKMR20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Voorhees20,
author = {Ellen M. Voorhees},
title = {Coopetition in {IR} research},
journal = {{SIGIR} Forum},
volume = {54},
number = {2},
pages = {1:1--1:3},
year = {2020},
url = {https://doi.org/10.1145/3483382.3483384},
doi = {10.1145/3483382.3483384},
timestamp = {Tue, 14 Sep 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Voorhees20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/VoorheesABDHLRS20,
author = {Ellen M. Voorhees and
Tasmeer Alam and
Steven Bedrick and
Dina Demner{-}Fushman and
William R. Hersh and
Kyle Lo and
Kirk Roberts and
Ian Soboroff and
Lucy Lu Wang},
title = {{TREC-COVID:} constructing a pandemic information retrieval test collection},
journal = {{SIGIR} Forum},
volume = {54},
number = {1},
pages = {1:1--1:12},
year = {2020},
url = {https://doi.org/10.1145/3451964.3451965},
doi = {10.1145/3451964.3451965},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/VoorheesABDHLRS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZanibbiMAO20,
author = {Richard Zanibbi and
Behrooz Mansouri and
Anurag Agarwal and
Douglas W. Oard},
title = {ARQMath: a new benchmark for math-aware {CQA} and math formula retrieval},
journal = {{SIGIR} Forum},
volume = {54},
number = {2},
pages = {4:1--4:9},
year = {2020},
url = {https://doi.org/10.1145/3483382.3483388},
doi = {10.1145/3483382.3483388},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ZanibbiMAO20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgostiFPV19,
author = {Maristella Agosti and
Nicola Ferro and
Gabriella Pasi and
Marco Viviani},
title = {Report on {ESSIR} 2019: the 12th European Summer School in Information
Retrieval},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {54--61},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458559},
doi = {10.1145/3458553.3458559},
timestamp = {Mon, 21 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AgostiFPV19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AhlersWSA19,
author = {Dirk Ahlers and
Erik Wilde and
Rossano Schifanella and
Jalal S. Alowibdi},
title = {Report on the Ninth International Workshop on Location and the Web
(LocWeb 2019): workshop held at the web conference, {WWW2019}},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {82--87},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458562},
doi = {10.1145/3458553.3458562},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AhlersWSA19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Ai19,
author = {Qingyao Ai},
title = {Neural generative models and representation learning for information
retrieval},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {97},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458565},
doi = {10.1145/3458553.3458565},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Ai19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Aliannejadi19,
author = {Mohammad Aliannejadi},
title = {Modeling user information needs on mobile devices: from recommendation
to conversation},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {98--99},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458566},
doi = {10.1145/3458553.3458566},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Aliannejadi19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlonsoS19,
author = {Omar Alonso and
Gianmaria Silvello},
title = {Report on the International Conference on Design of Experimental Search
{\&} Information Retrieval Systems {(DESIRES} 2018)},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {45--53},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458558},
doi = {10.1145/3458553.3458558},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AlonsoS19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BraschlerCCFBLM19,
author = {Martin Braschler and
Linda Cappellato and
Fabio Crestani and
Nicola Ferro and
Gundula Heinatz B{\"{u}}rki and
David E. Losada and
Henning M{\"{u}}ller and
Andreas Rauber and
Jacques Savoy},
title = {Report on {CLEF} 2019},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {108--118},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458571},
doi = {10.1145/3458553.3458571},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/BraschlerCCFBLM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CabanacFM19,
author = {Guillaume Cabanac and
Ingo Frommholz and
Philipp Mayr},
title = {Report on the 8th International Workshop on Bibliometric-Enhanced
Information Retrieval {(BIR} 2019)},
journal = {{SIGIR} Forum},
volume = {53},
number = {1},
pages = {21--28},
year = {2019},
url = {https://doi.org/10.1145/3458537.3458540},
doi = {10.1145/3458537.3458540},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/CabanacFM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CarteretteSO19,
author = {Ben Carterette and
Hussein Suleman and
Douglas W. Oard},
title = {Report on the 1st {ACM} {SIGIR/SIGKDD} Africa School on Machine Learning
for Data Mining and Search},
journal = {{SIGIR} Forum},
volume = {53},
number = {1},
pages = {3--13},
year = {2019},
url = {https://doi.org/10.1145/3458537.3458538},
doi = {10.1145/3458537.3458538},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/CarteretteSO19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ChandrasekaranM19,
author = {Muthu Kumar Chandrasekaran and
Philipp Mayr},
title = {Report on the 4th Joint Workshop on Bibliometric-Enhanced Information
Retrieval and Natural Language Processing for Digital Libraries at
{SIGIR} 2019},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {3--10},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458554},
doi = {10.1145/3458553.3458554},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/ChandrasekaranM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DegenhardtKPT19,
author = {Jon Degenhardt and
Surya Kallumadi and
Utkarsh Porwal and
Andrew Trotman},
title = {Report on the {SIGIR} 2019 Workshop on eCommerce {(ECOM19)}},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {11--19},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458555},
doi = {10.1145/3458553.3458555},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/DegenhardtKPT19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DietzMPAABBCDDD19,
author = {Laura Dietz and
Bhaskar Mitra and
Jeremy Pickens and
Hana Anber and
Sandeep Avula and
Asia Biega and
Adrian Boteanu and
Shubham Chatterjee and
Jeff Dalton and
Shiri Dori{-}Hacohen and
John Foley and
Henry Feild and
Ben Gamari and
Rosie Jones and
Pallika Kanani and
Sumanta Kashyapi and
Widad Machmouchi and
Matthew Mitsui and
Steve Nole and
Alexandre Tachard Passos and
Jordan Ramsdell and
Adam Roegiest and
David Smith and
Alessandro Sordoni},
title = {Report on the First HIPstIR Workshop on the Future of Information
Retrieval},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {62--75},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458560},
doi = {10.1145/3458553.3458560},
timestamp = {Wed, 27 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/DietzMPAABBCDDD19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/EnglJM19,
author = {Felix Engl and
Robin Jegan and
Leon Martin},
title = {Autumn School for Information Retrieval and Information Foraging 2019},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {119--123},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458572},
doi = {10.1145/3458553.3458572},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/EnglJM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fang19,
author = {Anjie Fang},
title = {Analysing political events on Twitter: topic modelling and user community
classification},
journal = {{SIGIR} Forum},
volume = {53},
number = {1},
pages = {38--39},
year = {2019},
url = {https://doi.org/10.1145/3458537.3458542},
doi = {10.1145/3458537.3458542},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Fang19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GoharianV19,
author = {Nazli Goharian and
Suzan Verberne},
title = {Addressing gender inequality},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {44},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458557},
doi = {10.1145/3458553.3458557},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/GoharianV19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Gupta19,
author = {Dhruv Gupta},
title = {Search and analytics using semantic annotations},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {100--101},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458567},
doi = {10.1145/3458553.3458567},
timestamp = {Tue, 08 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Gupta19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hauff19,
author = {Claudia Hauff},
title = {{ACM} {SIGIR} annual business meeting 2019: secretary's notes},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {124--127},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458573},
doi = {10.1145/3458553.3458573},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Hauff19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HuibersLPFMK19,
author = {Theo Huibers and
Monica Landoni and
Maria Soledad Pera and
Jerry Alan Fails and
Emiliana Murgia and
Natalia Kucirkova},
title = {What does good look like?: report on the 3\({}^{\mbox{\emph{rd}}}\)
International and Interdisciplinary Perspectives on Children {\&}
Recommender and Information Retrieval Systems (KidRec) at {IDC} 2019},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {76--81},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458561},
doi = {10.1145/3458553.3458561},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/HuibersLPFMK19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JonesBLP19,
author = {Gareth J. F. Jones and
Nicholas J. Belkin and
S{\'{e}}amus Lawless and
Gabriella Pasi},
title = {Report on the {CHIIR} 2019 Second Workshop on Evaluation of Personalisation
in Information Retrieval {(WEPIR} 2019)},
journal = {{SIGIR} Forum},
volume = {53},
number = {1},
pages = {29--37},
year = {2019},
url = {https://doi.org/10.1145/3458537.3458541},
doi = {10.1145/3458537.3458541},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/JonesBLP19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JorgeCJBPCRM19,
author = {Al{\'{\i}}pio M. Jorge and
Ricardo Campos and
Adam Jatowt and
Sumit Bhatia and
Arian Pasquali and
Jo{\~{a}}o Paulo Cordeiro and
Concei{\c{c}}{\~{a}}o Rocha and
V{\'{\i}}tor Mangaravite},
title = {Report on the Second International Workshop on Narrative Extraction
from Texts (Text2Story 2019)},
journal = {{SIGIR} Forum},
volume = {53},
number = {1},
pages = {14--20},
year = {2019},
url = {https://doi.org/10.1145/3458537.3458539},
doi = {10.1145/3458537.3458539},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/JorgeCJBPCRM19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lin19,
author = {Jimmy Lin},
title = {The neural hype, justified!: a recantation},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {88--93},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458563},
doi = {10.1145/3458553.3458563},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Lin19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Manotumruksa19,
author = {Jarana Manotumruksa},
title = {Effective neural architectures for context-aware venue recommendation},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {102--103},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458568},
doi = {10.1145/3458553.3458568},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Manotumruksa19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Maxwell19,
author = {David Maxwell},
title = {Modelling search and stopping in interactive information retrieval},
journal = {{SIGIR} Forum},
volume = {53},
number = {1},
pages = {40--41},
year = {2019},
url = {https://doi.org/10.1145/3458537.3458543},
doi = {10.1145/3458537.3458543},
timestamp = {Fri, 24 Feb 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Maxwell19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/McDonald19,
author = {Graham McDonald},
title = {A framework for technology-assisted sensitivity review: using sensitivity
classification to prioritise documents for review},
journal = {{SIGIR} Forum},
volume = {53},
number = {1},
pages = {42--43},
year = {2019},
url = {https://doi.org/10.1145/3458537.3458544},
doi = {10.1145/3458537.3458544},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/McDonald19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/OlteanuGRERLBOL19,
author = {Alexandra Olteanu and
Jean Garcia{-}Gathright and
Maarten de Rijke and
Michael D. Ekstrand and
Adam Roegiest and
Aldo Lipani and
Alex Beutel and
Ana Lucic and
Ana{-}Andreea Stoica and
Anubrata Das and
Asia Biega and
Bart Voorn and
Claudia Hauff and
Damiano Spina and
David D. Lewis and
Douglas W. Oard and
Emine Yilmaz and
Faegheh Hasibi and
Gabriella Kazai and
Graham McDonald and
Hinda Haned and
Iadh Ounis and
Ilse van der Linden and
Joris Baan and
Kamuela N. Lau and
Krisztian Balog and
Mahmoud F. Sayed and
Maria Panteli and
Mark Sanderson and
Matthew Lease and
Preethi Lahoti and
Toshihiro Kamishima},
title = {{FACTS-IR:} fairness, accountability, confidentiality, transparency,
and safety in information retrieval},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {20--43},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458556},
doi = {10.1145/3458553.3458556},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/OlteanuGRERLBOL19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Trippas19,
author = {Johanne R. Trippas},
title = {Spoken conversational search: audio-only interactive information retrieval},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {106--107},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458570},
doi = {10.1145/3458553.3458570},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Trippas19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Valcarce19,
author = {Daniel Valcarce},
title = {Information retrieval models for recommender systems},
journal = {{SIGIR} Forum},
volume = {53},
number = {1},
pages = {44--45},
year = {2019},
url = {https://doi.org/10.1145/3458537.3458545},
doi = {10.1145/3458537.3458545},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Valcarce19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Yang19,
author = {Grace Hui Yang},
title = {Information retrieval and its sister disciplines},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {94--96},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458564},
doi = {10.1145/3458553.3458564},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Yang19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zamani19,
author = {Hamed Zamani},
title = {Neural models for information retrieval without labeled data},
journal = {{SIGIR} Forum},
volume = {53},
number = {2},
pages = {104--105},
year = {2019},
url = {https://doi.org/10.1145/3458553.3458569},
doi = {10.1145/3458553.3458569},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Zamani19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/000118,
author = {Diane Kelly},
title = {{SIGIR} Community Survey on Preprint Services},
journal = {{SIGIR} Forum},
volume = {52},
number = {1},
pages = {11--33},
year = {2018},
url = {https://doi.org/10.1145/3274784.3274787},
doi = {10.1145/3274784.3274787},
timestamp = {Wed, 21 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/000118.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgichteinBD18,
author = {Eugene Agichtein and
Eric Brill and
Susan T. Dumais},
title = {Improving Web Search Ranking by Incorporating User Behavior Information},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {11--18},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308778},
doi = {10.1145/3308774.3308778},
timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AgichteinBD18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AhlersWSA18,
author = {Dirk Ahlers and
Erik Wilde and
Rossano Schifanella and
Jalal S. Alowibdi},
title = {Report on the Eighth International Workshop on Location and the Web
(LocWeb 2018)},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {145--152},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308798},
doi = {10.1145/3308774.3308798},
timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AhlersWSA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlbakourCGMPV18,
author = {Dyaa Albakour and
David P. A. Corney and
Julio Gonzalo and
Miguel Martinez{-}Alvarez and
Barbara Poblete and
Andreas Vlachos},
title = {Report on the 2nd International Workshop on Recent Trends in News
Information Retrieval (NewsIR'18)},
journal = {{SIGIR} Forum},
volume = {52},
number = {1},
pages = {140--146},
year = {2018},
url = {https://doi.org/10.1145/3274784.3274799},
doi = {10.1145/3274784.3274799},
timestamp = {Thu, 06 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AlbakourCGMPV18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BellotCFMMNSST18,
author = {Patrice Bellot and
Linda Cappellato and
Nicola Ferro and
Josiane Mothe and
Fionn Murtagh and
Jian{-}Yun Nie and
Eric SanJuan and
Laure Soulier and
Chiraz Trabelsi},
title = {Report on {CLEF} 2018: Experimental {IR} Meets Multilinguality, Multimodality,
and Interaction},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {72--82},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308785},
doi = {10.1145/3308774.3308785},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BellotCFMMNSST18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BogersGHFKPS18,
author = {Toine Bogers and
Maria G{\"{a}}de and
Mark Michael Hall and
Luanne Freund and
Marijn Koolen and
Vivien Petras and
Mette Skov},
title = {Report on the Workshop on Barriers to Interactive {IR} Resources Re-use
{(BIIRRR} 2018)},
journal = {{SIGIR} Forum},
volume = {52},
number = {1},
pages = {119--128},
year = {2018},
url = {https://doi.org/10.1145/3274784.3274795},
doi = {10.1145/3274784.3274795},
timestamp = {Fri, 27 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BogersGHFKPS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BorattoS18,
author = {Ludovico Boratto and
Giovanni Stilo},
title = {Report on the Workshop on Social Aspects in Personalization And Search
(SoAPS)},
journal = {{SIGIR} Forum},
volume = {52},
number = {1},
pages = {147--149},
year = {2018},
url = {https://doi.org/10.1145/3274784.3274800},
doi = {10.1145/3274784.3274800},
timestamp = {Wed, 21 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BorattoS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Buccio18,
author = {Emanuele Di Buccio},
title = {Report on the Quantum Information Access and Retrieval Theory Winter
School},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {92--99},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308789},
doi = {10.1145/3308774.3308789},
timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Buccio18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Castillo18,
author = {Carlos Castillo},
title = {Fairness and Transparency in Ranking},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {64--71},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308783},
doi = {10.1145/3308774.3308783},
timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Castillo18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Cohan18,
author = {Arman Cohan},
title = {Text Summarization and Categorization for Scientific and Health-Related
Data},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {169},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308802},
doi = {10.1145/3308774.3308802},
timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Cohan18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ColeA18,
author = {Amelia W. Cole and
Linda Achilles},
title = {Autumn School for Information Retrieval and Foraging 2018},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {87--91},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308788},
doi = {10.1145/3308774.3308788},
timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ColeA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Culpepper0S18,
author = {J. Shane Culpepper and
Fernando Diaz and
Mark D. Smucker},
title = {Research Frontiers in Information Retrieval: Report from the Third
Strategic Workshop on Information Retrieval in Lorne {(SWIRL} 2018)},
journal = {{SIGIR} Forum},
volume = {52},
number = {1},
pages = {34--90},
year = {2018},
url = {https://doi.org/10.1145/3274784.3274788},
doi = {10.1145/3274784.3274788},
timestamp = {Wed, 21 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Culpepper0S18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DodsonZ18,
author = {Samuel Dodson and
Steven Zimmerman},
title = {Autumn School for Information Retrieval and Information Foraging {(ASIRF}
2017)},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {83--86},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308787},
doi = {10.1145/3308774.3308787},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/DodsonZ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FailsPK18,
author = {Jerry Alan Fails and
Maria Soledad Pera and
Natalia Kucirkova},
title = {Building Community: Report on the 2nd International and Interdisciplinary
Perspectives on Children {\&} Recommender Systems (KidRec) at
{IDC} 2018},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {138--144},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308797},
doi = {10.1145/3308774.3308797},
timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/FailsPK18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Ferro018,
author = {Nicola Ferro and
Diane Kelly},
title = {{SIGIR} Initiative to Implement {ACM} Artifact Review and Badging},
journal = {{SIGIR} Forum},
volume = {52},
number = {1},
pages = {4--10},
year = {2018},
url = {https://doi.org/10.1145/3274784.3274786},
doi = {10.1145/3274784.3274786},
timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Ferro018.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FerroFGKCDDEGGK18,
author = {Nicola Ferro and
Norbert Fuhr and
Gregory Grefenstette and
Joseph A. Konstan and
Pablo Castells and
Elizabeth M. Daly and
Thierry Declerck and
Michael D. Ekstrand and
Werner Geyer and
Julio Gonzalo and
Tsvi Kuflik and
Krister Lind{\'{e}}n and
Bernardo Magnini and
Jian{-}Yun Nie and
Raffaele Perego and
Bracha Shapira and
Ian Soboroff and
Nava Tintarev and
Karin Verspoor and
Martijn C. Willemsen and
Justin Zobel},
title = {The Dagstuhl Perspectives Workshop on Performance Modeling and Prediction},
journal = {{SIGIR} Forum},
volume = {52},
number = {1},
pages = {91--101},
year = {2018},
url = {https://doi.org/10.1145/3274784.3274789},
doi = {10.1145/3274784.3274789},
timestamp = {Thu, 17 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/FerroFGKCDDEGGK18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FerroS18,
author = {Nicola Ferro and
Ian Soboroff},
title = {Report on {EVIA} 2017},
journal = {{SIGIR} Forum},
volume = {52},
number = {1},
pages = {162--166},
year = {2018},
url = {https://doi.org/10.1145/3274784.3274804},
doi = {10.1145/3274784.3274804},
timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/FerroS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fetahu18,
author = {Besnik Fetahu},
title = {Approaches for Enriching and Improving Textual Knowledge Bases},
journal = {{SIGIR} Forum},
volume = {52},
number = {1},
pages = {167--168},
year = {2018},
url = {https://doi.org/10.1145/3274784.3274806},
doi = {10.1145/3274784.3274806},
timestamp = {Wed, 21 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Fetahu18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GhoshGGCJM18,
author = {Saptarshi Ghosh and
Kripabandhu Ghosh and
Debasis Ganguly and
Tanmoy Chakraborty and
Gareth J. F. Jones and
Marie{-}Francine Moens},
title = {Report on the Second Workshop on Exploitation of Social Media for
Emergency Relief and Preparedness {(SMERP} 2018) at the Web Conference
{(WWW)} 2018},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {163--168},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308800},
doi = {10.1145/3308774.3308800},
timestamp = {Fri, 27 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/GhoshGGCJM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jarvelin18,
author = {Kalervo J{\"{a}}rvelin},
title = {Salton Award Keynote: Information Interaction in Context},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {52--63},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308782},
doi = {10.1145/3308774.3308782},
timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Jarvelin18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JonesBLP18,
author = {Gareth J. F. Jones and
Nicholas J. Belkin and
S{\'{e}}amus Lawless and
Gabriella Pasi},
title = {Report on the {CHIIR} 2018 Workshop on Evaluation of Personalisation
in Information Retrieval {(WEPIR} 2018)},
journal = {{SIGIR} Forum},
volume = {52},
number = {1},
pages = {129--134},
year = {2018},
url = {https://doi.org/10.1145/3274784.3274796},
doi = {10.1145/3274784.3274796},
timestamp = {Wed, 21 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/JonesBLP18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jorge0JNRCPM18,
author = {Al{\'{\i}}pio Jorge and
Ricardo Campos and
Adam Jatowt and
S{\'{e}}rgio Nunes and
Concei{\c{c}}{\~{a}}o Rocha and
Jo{\~{a}}o Paulo Cordeiro and
Arian Pasquali and
V{\'{\i}}tor Mangaravite},
title = {{ECIR} 2018: Text2Story Workshop - Narrative Extraction from Texts},
journal = {{SIGIR} Forum},
volume = {52},
number = {1},
pages = {150--152},
year = {2018},
url = {https://doi.org/10.1145/3274784.3274801},
doi = {10.1145/3274784.3274801},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Jorge0JNRCPM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kim18,
author = {Yubin Kim},
title = {Robust Selective Search},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {170--171},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308803},
doi = {10.1145/3308774.3308803},
timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Kim18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KoestenMGSR18,
author = {Laura Koesten and
Philipp Mayr and
Paul Groth and
Elena Simperl and
Maarten de Rijke},
title = {Report on the {DATA:} SEARCH'18 workshop - Searching Data on the Web},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {117--124},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308794},
doi = {10.1145/3308774.3308794},
timestamp = {Tue, 04 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/KoestenMGSR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lin18,
author = {Jimmy Lin},
title = {The Neural Hype and Comparisons Against Weak Baselines},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {40--51},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308781},
doi = {10.1145/3308774.3308781},
timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Lin18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lipani18,
author = {Aldo Lipani},
title = {On Biases in Information Retrieval Models and Evaluation},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {172--173},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308804},
doi = {10.1145/3308774.3308804},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Lipani18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LiuKCKS18,
author = {Yiqun Liu and
Makoto P. Kato and
Charles L. A. Clarke and
Noriko Kando and
Tetsuya Sakai},
title = {Report on {NTCIR-13:} The Thirteenth Round of {NII} Testbeds and Community
for Information Access Research},
journal = {{SIGIR} Forum},
volume = {52},
number = {1},
pages = {102--110},
year = {2018},
url = {https://doi.org/10.1145/3274784.3274791},
doi = {10.1145/3274784.3274791},
timestamp = {Wed, 16 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/LiuKCKS18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Maistro18,
author = {Maria Maistro},
title = {Exploiting User Signals and Stochastic Models to Improve Information
Retrieval Systems and Evaluation},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {174--175},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308805},
doi = {10.1145/3308774.3308805},
timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Maistro18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MarkovR18,
author = {Ilya Markov and
Maarten de Rijke},
title = {What Should We Teach in Information Retrieval?},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {19--39},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308780},
doi = {10.1145/3308774.3308780},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/MarkovR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MayrCJ18,
author = {Philipp Mayr and
Muthu Kumar Chandrasekaran and
Kokil Jaidka},
title = {Report on the 3rd Joint Workshop on Bibliometric-enhanced Information
Retrieval and Natural Language Processing for Digital Libraries {(BIRNDL}
2018)},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {105--110},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308792},
doi = {10.1145/3308774.3308792},
timestamp = {Thu, 25 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/MayrCJ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MayrFC18,
author = {Philipp Mayr and
Ingo Frommholz and
Guillaume Cabanac},
title = {Report on the 7th International Workshop on Bibliometric-enhanced
Information Retrieval {(BIR} 2018)},
journal = {{SIGIR} Forum},
volume = {52},
number = {1},
pages = {135--139},
year = {2018},
url = {https://doi.org/10.1145/3274784.3274798},
doi = {10.1145/3274784.3274798},
timestamp = {Mon, 16 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/MayrFC18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Mehrotra18,
author = {Rishabh Mehrotra},
title = {Inferring User Needs {\&} Tasks from User Interactions},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {176--177},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308806},
doi = {10.1145/3308774.3308806},
timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Mehrotra18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MejovaCTB18,
author = {Yelena Mejova and
Ekaterina Chernyak and
Elena Tutubalina and
Pavel Braslavski},
title = {Report on the 12th Russian Summer School in Information Retrieval
(RuSSIR 2018)},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {100--104},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308790},
doi = {10.1145/3308774.3308790},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/MejovaCTB18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PeraFGG18,
author = {Maria Soledad Pera and
Jerry Alan Fails and
Mirko Gelsomini and
Franca Garzotto},
title = {Building Community: Report on KidRec Workshop on Children and Recommender
Systems at RecSys 2017},
journal = {{SIGIR} Forum},
volume = {52},
number = {1},
pages = {153--161},
year = {2018},
url = {https://doi.org/10.1145/3274784.3274803},
doi = {10.1145/3274784.3274803},
timestamp = {Sat, 05 Sep 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/PeraFGG18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Radhakrishnan18,
author = {Priya Radhakrishnan},
title = {Named Entity Extraction for Knowledgebase Enhancement},
journal = {{SIGIR} Forum},
volume = {52},
number = {1},
pages = {169--170},
year = {2018},
url = {https://doi.org/10.1145/3274784.3274807},
doi = {10.1145/3274784.3274807},
timestamp = {Wed, 21 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Radhakrishnan18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Scells18,
author = {Harrisen Scells},
title = {11th European Summer School in Information Retrieval {(ESSIR} 2017)},
journal = {{SIGIR} Forum},
volume = {52},
number = {1},
pages = {111--118},
year = {2018},
url = {https://doi.org/10.1145/3274784.3274793},
doi = {10.1145/3274784.3274793},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Scells18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SoboroffFF18,
author = {Ian Soboroff and
Nicola Ferro and
Norbert Fuhr},
title = {Report on {GLARE} 2018: 1st Workshop on Generalization in Information
Retrieval},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {132--137},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308796},
doi = {10.1145/3308774.3308796},
timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/SoboroffFF18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Soldaini18,
author = {Luca Soldaini},
title = {The Knowledge and Language Gap in Medical Information Seeking},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {178--179},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308807},
doi = {10.1145/3308774.3308807},
timestamp = {Wed, 16 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Soldaini18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SpinaAJKR18,
author = {Damiano Spina and
Jaime Arguello and
Hideo Joho and
Julia Kiseleva and
Filip Radlinski},
title = {CAIR'18: Second International Workshop on Conversational Approaches
to Information Retrieval at {SIGIR} 2018},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {111--116},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308793},
doi = {10.1145/3308774.3308793},
timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/SpinaAJKR18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/VerberneHKWLRV18,
author = {Suzan Verberne and
Jiyin He and
Udo Kruschwitz and
Gineke Wiggers and
Birger Larsen and
Tony Russell{-}Rose and
Arjen P. de Vries},
title = {First International Workshop on Professional Search},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {153--162},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308799},
doi = {10.1145/3308774.3308799},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/VerberneHKWLRV18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Xiong18,
author = {Chenyan Xiong},
title = {Text Representation, Retrieval, and Understanding with Knowledge Graphs},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {180--181},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308808},
doi = {10.1145/3308774.3308808},
timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Xiong18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Yilmaz18,
author = {Emine Yilmaz},
title = {{ACM} {SIGIR} Annual Business Meeting 2018: Secretary's Notes},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {5--10},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308776},
doi = {10.1145/3308774.3308776},
timestamp = {Thu, 28 Mar 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Yilmaz18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZhangZZ18,
author = {Yongfeng Zhang and
Yi Zhang and
Min Zhang},
title = {Report on EARS'18: 1st International Workshop on ExplainAble Recommendation
and Search},
journal = {{SIGIR} Forum},
volume = {52},
number = {2},
pages = {125--131},
year = {2018},
url = {https://doi.org/10.1145/3308774.3308795},
doi = {10.1145/3308774.3308795},
timestamp = {Mon, 22 Nov 2021 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ZhangZZ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/000117,
author = {Mostafa Dehghani},
title = {Toward Document Understanding for Information Retrieval},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {27--31},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190585},
doi = {10.1145/3190580.3190585},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/000117.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/0001KKRY17,
author = {Hui Fang and
Jaap Kamps and
Evangelos Kanoulas and
Maarten de Rijke and
Emine Yilmaz},
title = {Report on the 2017 {ACM} {SIGIR} International Conference Theory of
Information Retrieval (ICTIR?17)},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {78--87},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190591},
doi = {10.1145/3190580.3190591},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/0001KKRY17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AhlersW17,
author = {Dirk Ahlers and
Erik Wilde},
title = {Report on the Seventh International Workshop on Location and the Web
(LocWeb 2017)},
journal = {{SIGIR} Forum},
volume = {51},
number = {1},
pages = {52--57},
year = {2017},
url = {https://doi.org/10.1145/3130332.3130342},
doi = {10.1145/3130332.3130342},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AhlersW17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AliannejadiHMST17,
author = {Mohammad Aliannejadi and
Maram Hasanain and
Jiaxin Mao and
Jaspreet Singh and
Johanne R. Trippas and
Hamed Zamani and
Laura Dietz},
title = {{ACM} {SIGIR} Student Liaison Program},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {42--45},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190587},
doi = {10.1145/3190580.3190587},
timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AliannejadiHMST17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanBBCCDDFHHR17,
author = {James Allan and
Nicholas J. Belkin and
Paul N. Bennett and
Jamie Callan and
Charles L. A. Clarke and
Fernando Diaz and
Susan T. Dumais and
Nicola Ferro and
Donna Harman and
Djoerd Hiemstra and
Ian Ruthven and
Tetsuya Sakai and
Mark D. Smucker and
Justin Zobel},
title = {Overview of Special Issue},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {1--25},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130350},
doi = {10.1145/3130348.3130350},
timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AllanBBCCDDFHHR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanPL17,
author = {James Allan and
Ron Papka and
Victor Lavrenko},
title = {On-Line New Event Detection and Tracking},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {185--193},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130366},
doi = {10.1145/3130348.3130366},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AllanPL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Amigo0MZ17,
author = {Enrique Amig{\'{o}} and
Hui Fang and
Stefano Mizzaro and
ChengXiang Zhai},
title = {Report on the {SIGIR} 2017 Workshop on Axiomatic Thinking for Information
Retrieval and Related Tasks {(ATIR)}},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {99--106},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190596},
doi = {10.1145/3190580.3190596},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Amigo0MZ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AzzopardiMOH17,
author = {Leif Azzopardi and
Craig Macdonald and
Iadh Ounis and
Martin Halvey},
title = {Report on the Information Retrieval Festival (IRFest2017)},
journal = {{SIGIR} Forum},
volume = {51},
number = {1},
pages = {12--28},
year = {2017},
url = {https://doi.org/10.1145/3130332.3130336},
doi = {10.1145/3130332.3130336},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AzzopardiMOH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AzzopardiPSST17,
author = {Leif Azzopardi and
Jeremy Pickens and
Chirag Shah and
Laure Soulier and
Lynda Tamine},
title = {Report on the Second International Workshop on the Evaluation on Collaborative
Information Seeking and Retrieval (ECol?2017 @ {CHIIR)}},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {122--127},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190599},
doi = {10.1145/3190580.3190599},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AzzopardiPSST17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belew17,
author = {Richard K. Belew},
title = {Adaptive Information Retrieval: Using a Connectionist Representation
to Retrieve and Leasrn about Documents},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {106--115},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130359},
doi = {10.1145/3130348.3130359},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Belew17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BergerL17,
author = {Adam L. Berger and
John D. Lafferty},
title = {Information Retrieval as Statistical Translation},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {219--226},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130371},
doi = {10.1145/3130348.3130371},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BergerL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BharatH17,
author = {Krishna Bharat and
Monika Henzinger},
title = {Improved Algorithms for Topic Distillation in a Hyperlinked Environment},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {194--201},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130367},
doi = {10.1145/3130348.3130367},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BharatH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Boer17,
author = {Maaike H. T. de Boer},
title = {Semantic Mapping in Video Retrieval},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {161--162},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190606},
doi = {10.1145/3190580.3190606},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Boer17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BogersKMLS17,
author = {Toine Bogers and
Marijn Koolen and
Cataldo Musto and
Pasquale Lops and
Giovanni Semeraro},
title = {Report on RecSys 2016Workshop on New Trends in Content-Based Recommender
Systems},
journal = {{SIGIR} Forum},
volume = {51},
number = {1},
pages = {45--51},
year = {2017},
url = {https://doi.org/10.1145/3130332.3130341},
doi = {10.1145/3130332.3130341},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BogersKMLS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BorattoKS17,
author = {Ludovico Boratto and
Andreas Kaltenbrunner and
Giovanni Stilo},
title = {Report on the Workshop on Social Media for Personalization And Search
(SoMePeAS)},
journal = {{SIGIR} Forum},
volume = {51},
number = {1},
pages = {42--44},
year = {2017},
url = {https://doi.org/10.1145/3130332.3130339},
doi = {10.1145/3130332.3130339},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BorattoKS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BraslavskiKKH17,
author = {Pavel Braslavski and
Jaap Kamps and
Julia Kiseleva and
Alexander Halperin},
title = {Report on the 11th Russian Summer School in Information Retrieval
(RuSSIR 2017)},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {94--98},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190594},
doi = {10.1145/3190580.3190594},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BraslavskiKKH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BuckleyV17,
author = {Chris Buckley and
Ellen M. Voorhees},
title = {Evaluating Evaluation Measure Stability},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {235--242},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130373},
doi = {10.1145/3130348.3130373},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BuckleyV17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CallanLC17,
author = {James P. Callan and
Zhihong Lu and
W. Bruce Croft},
title = {Searching Distributed Collections With Inference Networks},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {160--167},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130363},
doi = {10.1145/3130348.3130363},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CallanLC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CappellatoFGGJK17,
author = {Linda Cappellato and
Nicola Ferro and
Lorraine Goeuriot and
Julio Gonzalo and
Gareth J. F. Jones and
Liadh Kelly and
S{\'{e}}amus Lawless and
Thomas Mandl},
title = {Report on {CLEF} 2017: Experimental {IR} Meets Multilinguality, Multimodality,
and Interaction},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {67--77},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190590},
doi = {10.1145/3190580.3190590},
timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/CappellatoFGGJK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CarbinellG17,
author = {Jaime G. Carbonell and
Jade Goldstein},
title = {The Use of MMR, Diversity-Based Reranking for Reordering Documents
and Producing Summaries},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {209--210},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130369},
doi = {10.1145/3130348.3130369},
timestamp = {Sat, 19 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CarbinellG17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Catena17,
author = {Matteo Catena},
title = {Energy Efficiency in Large Scale Information Retrieval Systems},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {159--160},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190605},
doi = {10.1145/3190580.3190605},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Catena17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CraswellCRGM17,
author = {Nick Craswell and
W. Bruce Croft and
Maarten de Rijke and
Jiafeng Guo and
Bhaskar Mitra},
title = {Report on the Second {SIGIR} Workshop on Neural Information Retrieval
(Neu-IR'17)},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {152--158},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190603},
doi = {10.1145/3190580.3190603},
timestamp = {Wed, 27 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/CraswellCRGM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CuttingKPT17,
author = {Douglas R. Cutting and
David R. Karger and
Jan O. Pedersen and
John W. Tukey},
title = {Scatter/Gather: {A} Cluster-based Approach to Browsing Large Document
Collections},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {148--159},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130362},
doi = {10.1145/3130348.3130362},
timestamp = {Thu, 08 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/CuttingKPT17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DegenhardtKLRST17,
author = {Jon Degenhardt and
Surya Kallumadi and
Yiu{-}Chang Lin and
Maarten de Rijke and
Luo Si and
Andrew Trotman and
Sindhuja Venkatesh and
Yinghui Xu},
title = {Report on the {SIGIR} 2017 Workshop on eCommerce {(ECOM17)}},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {128--138},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190600},
doi = {10.1145/3190580.3190600},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DegenhardtKLRST17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DietzXM17,
author = {Laura Dietz and
Chenyan Xiong and
Edgar Meij},
title = {Overview of The First Workshop on Knowledge Graphs and Semantics for
Text Retrieval and Analysis {(KG4IR)}},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {139--144},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190601},
doi = {10.1145/3190580.3190601},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DietzXM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fagan17,
author = {Joel L. Fagan},
title = {Automatic {P} h r a s e Indexing for Document Retrieval: An Examination
of Syntactic and Non-Syntactic Methods},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {51--61},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130355},
doi = {10.1145/3130348.3130355},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Fagan17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FerroLMP17,
author = {Nicola Ferro and
Claudio Lucchese and
Maria Maistro and
Raffaele Perego},
title = {Report on {LEARNER} 2017: 1st International Workshop on LEARning Next
gEneration Rankers},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {145--151},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190602},
doi = {10.1145/3190580.3190602},
timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/FerroLMP17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fuhr17,
author = {Norbert Fuhr},
title = {Some Common Mistakes In {IR} Evaluation, And How They Can Be Avoided},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {32--41},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190586},
doi = {10.1145/3190580.3190586},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Fuhr17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FuhrGGGHJJLMNPS17,
author = {Norbert Fuhr and
Anastasia Giachanou and
Gregory Grefenstette and
Iryna Gurevych and
Andreas Hanselowski and
Kalervo J{\"{a}}rvelin and
Rosie Jones and
Yiqun Liu and
Josiane Mothe and
Wolfgang Nejdl and
Isabella Peters and
Benno Stein},
title = {An Information Nutritional Label for Online Documents},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {46--66},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190588},
doi = {10.1145/3190580.3190588},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/FuhrGGGHJJLMNPS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FurnasDDLHSL17,
author = {George W. Furnas and
Scott C. Deerwester and
Susan T. Dumais and
Thomas K. Landauer and
Richard A. Harshman and
Lynn A. Streeter and
Karen E. Lochbaum},
title = {Information Retrieval using a Singular Value Decomposition Model of
Latent Semantic Structure},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {90--105},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130358},
doi = {10.1145/3130348.3130358},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/FurnasDDLHSL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GhoshGGCJM17,
author = {Saptarshi Ghosh and
Kripabandhu Ghosh and
Debasis Ganguly and
Tanmoy Chakraborty and
Gareth J. F. Jones and
Marie{-}Francine Moens},
title = {{ECIR} 2017 Workshop on Exploitation of Social Media for Emergency
Relief and Preparedness {(SMERP} 2017)},
journal = {{SIGIR} Forum},
volume = {51},
number = {1},
pages = {36--41},
year = {2017},
url = {https://doi.org/10.1145/3130332.3130338},
doi = {10.1145/3130332.3130338},
timestamp = {Fri, 27 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/GhoshGGCJM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harman17,
author = {Donna Harman},
title = {Towards Interactive Query Expansion},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {79--89},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130357},
doi = {10.1145/3130348.3130357},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Harman17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HerlockerKBR17,
author = {Jonathan L. Herlocker and
Joseph A. Konstan and
Al Borchers and
John Riedl},
title = {An Algorithmic Framework for Performing Collaborative Filtering},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {227--234},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130372},
doi = {10.1145/3130348.3130372},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/HerlockerKBR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hofmann17,
author = {Thomas Hofmann},
title = {Probabilistic Latent Semantic Indexing},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {211--218},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130370},
doi = {10.1145/3130348.3130370},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Hofmann17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Htun17,
author = {Nyi Nyi Htun},
title = {Non-Uniform Information Access in Collaborative Information Retrieval},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {163--164},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190607},
doi = {10.1145/3190580.3190607},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Htun17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Ibrahim17,
author = {Muhammad Ibrahim},
title = {Scalability and Performance of Random Forest based Learning-to-Rank
for Information Retrieval},
journal = {{SIGIR} Forum},
volume = {51},
number = {1},
pages = {73--74},
year = {2017},
url = {https://doi.org/10.1145/3130332.3130346},
doi = {10.1145/3130332.3130346},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Ibrahim17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JarvelinK17,
author = {Kalervo J{\"{a}}rvelin and
Jaana Kek{\"{a}}l{\"{a}}inen},
title = {{IR} evaluation methods for retrieving highly relevant documents},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {243--250},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130374},
doi = {10.1145/3130348.3130374},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/JarvelinK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JoachimsGPHG17,
author = {Thorsten Joachims and
Laura A. Granka and
Bing Pan and
Helene Hembrooke and
Geri Gay},
title = {Accurately Interpreting Clickthrough Data as Implicit Feedback},
journal = {{SIGIR} Forum},
volume = {51},
number = {1},
pages = {4--11},
year = {2017},
url = {https://doi.org/10.1145/3130332.3130334},
doi = {10.1145/3130332.3130334},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/JoachimsGPHG17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JohoCASR17,
author = {Hideo Joho and
Lawrence Cavedon and
Jaime Arguello and
Milad Shokouhi and
Filip Radlinski},
title = {CAIR'17: First International Workshop on Conversational Approaches
to Information Retrieval at {SIGIR} 2017},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {114--121},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190598},
doi = {10.1145/3190580.3190598},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/JohoCASR17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jones17,
author = {Karen Sparck Jones},
title = {A Look Back and a Look Forward},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {62--78},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130356},
doi = {10.1145/3130348.3130356},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Jones17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KanoulasK17,
author = {Evangelos Kanoulas and
Jussi Karlgren},
title = {Practical Issues in Information Access System Evaluation},
journal = {{SIGIR} Forum},
volume = {51},
number = {1},
pages = {67--72},
year = {2017},
url = {https://doi.org/10.1145/3130332.3130344},
doi = {10.1145/3130332.3130344},
timestamp = {Wed, 07 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KanoulasK17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KatoYJY17,
author = {Makoto P. Kato and
Takehiro Yamamoto and
Hideo Joho and
Masatoshi Yoshikawa},
title = {Asian Summer School in Information Access {(ASSIA} 2017)},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {88--93},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190593},
doi = {10.1145/3190580.3190593},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KatoYJY17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KatzerTFD17,
author = {Jeffrey Katzer and
Judith A. Tessier and
William B. Frakes and
Padmini Das{-}Gupta},
title = {A Study of the Overlap Among Document Representations},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {26--34},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130352},
doi = {10.1145/3130348.3130352},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KatzerTFD17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KoolenKBBKY17,
author = {Marijn Koolen and
Jaap Kamps and
Toine Bogers and
Nicholas J. Belkin and
Diane Kelly and
Emine Yilmaz},
title = {Report on the Second Workshop on Supporting Complex Search Tasks},
journal = {{SIGIR} Forum},
volume = {51},
number = {1},
pages = {58--66},
year = {2017},
url = {https://doi.org/10.1145/3130332.3130343},
doi = {10.1145/3130332.3130343},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KoolenKBBKY17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kopeinik17,
author = {Simone Kopeinik},
title = {Applying Cognitive Learner Models for Recommender Systems in Sparse
Data Learning Environments},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {165},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190608},
doi = {10.1145/3190580.3190608},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Kopeinik17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kowald17,
author = {Dominik Kowald},
title = {Modeling Activation Processes in Human Memory to Improve Tag Recommendations},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {166},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190609},
doi = {10.1145/3190580.3190609},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Kowald17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LaffertyZ17,
author = {John D. Lafferty and
Chengxiang Zhai},
title = {Document Language Models, Query Models, and Risk Minimization for
Information Retrieval},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {251--259},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130375},
doi = {10.1145/3130348.3130375},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LaffertyZ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LavrenkoC17,
author = {Victor Lavrenko and
W. Bruce Croft},
title = {Relevance-Based Language Models},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {260--267},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130376},
doi = {10.1145/3130348.3130376},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LavrenkoC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MayrCJ17,
author = {Philipp Mayr and
Muthu Kumar Chandrasekaran and
Kokil Jaidka},
title = {Report on the 2nd Joint Workshop on Bibliometric-enhanced Information
Retrieval and Natural Language Processing for Digital Libraries {(BIRNDL}
2017)},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {107--113},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190597},
doi = {10.1145/3190580.3190597},
timestamp = {Thu, 25 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/MayrCJ17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MayrFC17,
author = {Philipp Mayr and
Ingo Frommholz and
Guillaume Cabanac},
title = {Report on the 5th International Workshop on Bibliometric-enhanced
Information Retrieval {(BIR} 2017)},
journal = {{SIGIR} Forum},
volume = {51},
number = {1},
pages = {29--35},
year = {2017},
url = {https://doi.org/10.1145/3130332.3130337},
doi = {10.1145/3130332.3130337},
timestamp = {Thu, 25 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/MayrFC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Pejtersen17,
author = {Annelise Mark Pejtersen},
title = {A Library System for Information Retrieval based on a Cognitive Task
Analysis and Supported by an Icon-Based Interface},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {116--123},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130360},
doi = {10.1145/3130348.3130360},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Pejtersen17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PonteC17,
author = {Jay M. Ponte and
W. Bruce Croft},
title = {A Language Modeling Approach to Information Retrieval},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {202--208},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130368},
doi = {10.1145/3130348.3130368},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/PonteC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Rijsbergen17,
author = {C. J. van Rijsbergen},
title = {A New Theoretical Framework For Information Retrieval},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {44--50},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130354},
doi = {10.1145/3130348.3130354},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Rijsbergen17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sebastian17,
author = {Yakub Sebastian},
title = {Literature-Based Discovery by Learning Heterogeneous Bibliographic
Information Networks},
journal = {{SIGIR} Forum},
volume = {51},
number = {1},
pages = {75--76},
year = {2017},
url = {https://doi.org/10.1145/3130332.3130347},
doi = {10.1145/3130332.3130347},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Sebastian17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SinghalBM17,
author = {Amit Singhal and
Chris Buckley and
Manclar Mitra},
title = {Pivoted Document Length Normalization},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {176--184},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130365},
doi = {10.1145/3130348.3130365},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/SinghalBM17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TeevanDH17,
author = {Jaime Teevan and
Susan T. Dumais and
Eric Horvitz},
title = {Personalizing Search via Automated Analysis of Interests and Activities},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {10--17},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190582},
doi = {10.1145/3190580.3190582},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/TeevanDH17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TurtleC17,
author = {Howard R. Turtle and
W. Bruce Croft},
title = {Inference Networks for Document Retrieval},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {124--147},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130361},
doi = {10.1145/3130348.3130361},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/TurtleC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Vdorhees17,
author = {Ellen M. Vdorhees},
title = {The Cluster Hypothesis Revisited},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {35--43},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130353},
doi = {10.1145/3130348.3130353},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Vdorhees17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/XuC17,
author = {Jinxi Xu and
W. Bruce Croft},
title = {Quary Expansion Using Local and Global Document Analysis},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {168--175},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130364},
doi = {10.1145/3130348.3130364},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/XuC17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZhaiL17,
author = {Chengxiang Zhai and
John D. Lafferty},
title = {A Study of Smoothing Methods for Language Models Applied to Ad Hoc
Information Retrieval},
journal = {{SIGIR} Forum},
volume = {51},
number = {2},
pages = {268--276},
year = {2017},
url = {https://doi.org/10.1145/3130348.3130377},
doi = {10.1145/3130348.3130377},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ZhaiL17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zobel17,
author = {Justin Zobel},
title = {What We Talk About When We Talk About Information Retrieval},
journal = {{SIGIR} Forum},
volume = {51},
number = {3},
pages = {18--26},
year = {2017},
url = {https://doi.org/10.1145/3190580.3190584},
doi = {10.1145/3190580.3190584},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Zobel17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgostiARP16,
author = {Maristella Agosti and
Omar Alonso and
Maarten de Rijke and
Raffaele Perego},
title = {Data-Driven Information Retrieval},
journal = {{SIGIR} Forum},
volume = {50},
number = {2},
pages = {10--14},
year = {2016},
url = {https://doi.org/10.1145/3053408.3053410},
doi = {10.1145/3053408.3053410},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AgostiARP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AhlersW16,
author = {Dirk Ahlers and
Erik Wilde},
title = {Report on the Sixth International Workshop on Location and the Web
(LocWeb 2016)},
journal = {{SIGIR} Forum},
volume = {50},
number = {2},
pages = {51--57},
year = {2016},
url = {https://doi.org/10.1145/3053408.3053420},
doi = {10.1145/3053408.3053420},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AhlersW16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AzzopardiMHABBC16,
author = {Leif Azzopardi and
Yashar Moshfeghi and
Martin Halvey and
Rami Suleiman Alkhawaldeh and
Krisztian Balog and
Emanuele Di Buccio and
Diego Ceccarelli and
Juan M. Fern{\'{a}}ndez{-}Luna and
Charlie Hull and
Jake Mannix and
Sauparna Palchowdhury},
title = {Lucene4IR: Developing Information Retrieval Evaluation Resources using
Lucene},
journal = {{SIGIR} Forum},
volume = {50},
number = {2},
pages = {58--75},
year = {2016},
url = {https://doi.org/10.1145/3053408.3053421},
doi = {10.1145/3053408.3053421},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AzzopardiMHABBC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BalogDDI16,
author = {Krisztian Balog and
Jeffrey Dalton and
Antoine Doucet and
Yusra Ibrahim},
title = {Report on the Eighth Workshop on Exploiting Semantic Annotations in
Information Retrieval {(ESAIR} '15)},
journal = {{SIGIR} Forum},
volume = {50},
number = {1},
pages = {49--57},
year = {2016},
url = {https://doi.org/10.1145/2964797.2964806},
doi = {10.1145/2964797.2964806},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BalogDDI16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CabanacCFJKMW16,
author = {Guillaume Cabanac and
Muthu Kumar Chandrasekaran and
Ingo Frommholz and
Kokil Jaidka and
Min{-}Yen Kan and
Philipp Mayr and
Dietmar Wolfram},
title = {Report on the Joint Workshop on Bibliometric-enhanced Information
Retrieval and Natural Language Processing for Digital Libraries {(BIRNDL}
2016)},
journal = {{SIGIR} Forum},
volume = {50},
number = {2},
pages = {36--43},
year = {2016},
url = {https://doi.org/10.1145/3053408.3053417},
doi = {10.1145/3053408.3053417},
timestamp = {Sun, 25 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/CabanacCFJKMW16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Calumby16,
author = {Rodrigo Tripodi Calumby},
title = {Diversity-oriented Multimodal and Interactive Information Retrieval},
journal = {{SIGIR} Forum},
volume = {50},
number = {1},
pages = {86},
year = {2016},
url = {https://doi.org/10.1145/2964797.2964811},
doi = {10.1145/2964797.2964811},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Calumby16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ClarkeY16,
author = {Charles L. A. Clarke and
Emine Yilmaz},
title = {{EVIA} 2016: The Seventh International Workshop on Evaluating Information
Access},
journal = {{SIGIR} Forum},
volume = {50},
number = {2},
pages = {44--46},
year = {2016},
url = {https://doi.org/10.1145/3053408.3053418},
doi = {10.1145/3053408.3053418},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ClarkeY16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Crane16,
author = {Matt Crane},
title = {Improved Indexing {\&} Searching Throughput},
journal = {{SIGIR} Forum},
volume = {50},
number = {1},
pages = {87},
year = {2016},
url = {https://doi.org/10.1145/2964797.2964812},
doi = {10.1145/2964797.2964812},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Crane16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CraswellCGMR16,
author = {Nick Craswell and
W. Bruce Croft and
Jiafeng Guo and
Bhaskar Mitra and
Maarten de Rijke},
title = {Report on the {SIGIR} 2016 Workshop on Neural Information Retrieval
(Neu-IR)},
journal = {{SIGIR} Forum},
volume = {50},
number = {2},
pages = {96--103},
year = {2016},
url = {https://doi.org/10.1145/3053408.3053425},
doi = {10.1145/3053408.3053425},
timestamp = {Wed, 27 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/CraswellCGMR16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DebattistaFU16,
author = {Jeremy Debattista and
Javier D. Fern{\'{a}}ndez and
J{\"{u}}rgen Umbrich},
title = {Report on the 2nd Workshop on Managing the Evolution and Preservation
of the Data Web (MEPDaW 2016)},
journal = {{SIGIR} Forum},
volume = {50},
number = {2},
pages = {82--88},
year = {2016},
url = {https://doi.org/10.1145/3053408.3053423},
doi = {10.1145/3053408.3053423},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DebattistaFU16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Diaz16,
author = {Fernando Diaz},
title = {Worst Practices for Designing Production Information Access Systems},
journal = {{SIGIR} Forum},
volume = {50},
number = {1},
pages = {2--11},
year = {2016},
url = {https://doi.org/10.1145/2964797.2964799},
doi = {10.1145/2964797.2964799},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Diaz16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DietzBDV16,
author = {Laura Dietz and
Elinor Brondwine and
Shiri Dori{-}Hacohen and
Ellen M. Voorhees},
title = {Women in {IR}},
journal = {{SIGIR} Forum},
volume = {50},
number = {2},
pages = {15--17},
year = {2016},
url = {https://doi.org/10.1145/3053408.3053411},
doi = {10.1145/3053408.3053411},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DietzBDV16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Edwards16,
author = {Ashlee Edwards},
title = {Engaged or Frustrated?: Disambiguating engagement and frustration
in search},
journal = {{SIGIR} Forum},
volume = {50},
number = {1},
pages = {88--89},
year = {2016},
url = {https://doi.org/10.1145/2964797.2964813},
doi = {10.1145/2964797.2964813},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Edwards16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fafalios16,
author = {Pavlos Fafalios},
title = {Exploiting Linked Data in Exploratory Search},
journal = {{SIGIR} Forum},
volume = {50},
number = {2},
pages = {104--105},
year = {2016},
url = {https://doi.org/10.1145/3053408.3053427},
doi = {10.1145/3053408.3053427},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Fafalios16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FerroCMMSKRCPLM16,
author = {Nicola Ferro and
Fabio Crestani and
Marie{-}Francine Moens and
Josiane Mothe and
Fabrizio Silvestri and
Jaana Kek{\"{a}}l{\"{a}}inen and
Paolo Rosso and
Paul D. Clough and
Gabriella Pasi and
Christina Lioma and
Stefano Mizzaro and
Giorgio Maria Di Nunzio and
Claudia Hauff and
Omar Alonso and
Pavel Serdyukov and
Gianmaria Silvello},
title = {Report on {ECIR} 2016: 38th European Conference on Information Retrieval},
journal = {{SIGIR} Forum},
volume = {50},
number = {1},
pages = {12--27},
year = {2016},
url = {https://doi.org/10.1145/2964797.2964801},
doi = {10.1145/2964797.2964801},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/FerroCMMSKRCPLM16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FerroFJKLZ16,
author = {Nicola Ferro and
Norbert Fuhr and
Kalervo J{\"{a}}rvelin and
Noriko Kando and
Matthias Lippold and
Justin Zobel},
title = {Increasing Reproducibility in {IR:} Findings from the Dagstuhl Seminar
on "Reproducibility of Data-Oriented Experiments in e-Science"},
journal = {{SIGIR} Forum},
volume = {50},
number = {1},
pages = {68--82},
year = {2016},
url = {https://doi.org/10.1145/2964797.2964808},
doi = {10.1145/2964797.2964808},
timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/FerroFJKLZ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GoeuriotBJKMP16,
author = {Lorraine Goeuriot and
Steven Bedrick and
Gareth J. F. Jones and
Anastasia Krithara and
Henning M{\"{u}}ller and
George Paliouras},
title = {Report on the {SIGIR} 2016 Workshop on Medical Information Retrieval
(MedIR)},
journal = {{SIGIR} Forum},
volume = {50},
number = {2},
pages = {76--81},
year = {2016},
url = {https://doi.org/10.1145/3053408.3053422},
doi = {10.1145/3053408.3053422},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/GoeuriotBJKMP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Gossen16,
author = {Tatiana Gossen},
title = {Targeted Search Engines for Children: Search User Interfaces and Information-Seeking
Behaviour},
journal = {{SIGIR} Forum},
volume = {50},
number = {2},
pages = {106},
year = {2016},
url = {https://doi.org/10.1145/3053408.3053428},
doi = {10.1145/3053408.3053428},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Gossen16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/IencoRRRT16,
author = {Dino Ienco and
Mathieu Roche and
Salvatore Romeo and
Paolo Rosso and
Andrea Tagarelli},
title = {{ECIR} 2016 Workshop on Modeling, Learning and Mining for Cross/Multilinguality
(MultiLingMine '16)},
journal = {{SIGIR} Forum},
volume = {50},
number = {2},
pages = {89--95},
year = {2016},
url = {https://doi.org/10.1145/3053408.3053424},
doi = {10.1145/3053408.3053424},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/IencoRRRT16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KatoKKSS16,
author = {Makoto P. Kato and
Kazuaki Kishida and
Noriko Kando and
Tetsuya Sakai and
Mark Sanderson},
title = {Report on {NTCIR-12:} The Twelfth Round of {NII} Testbeds and Community
for Information Access Research},
journal = {{SIGIR} Forum},
volume = {50},
number = {2},
pages = {18--27},
year = {2016},
url = {https://doi.org/10.1145/3053408.3053413},
doi = {10.1145/3053408.3053413},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KatoKKSS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kong16,
author = {Weize Kong},
title = {Extending Faceted Search to the Open-Domain Web},
journal = {{SIGIR} Forum},
volume = {50},
number = {1},
pages = {90--91},
year = {2016},
url = {https://doi.org/10.1145/2964797.2964814},
doi = {10.1145/2964797.2964814},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Kong16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KotovTBIVEB16,
author = {Alexander Kotov and
Elena Treshcheva and
Leonid Bessonov and
Dmitry I. Ignatov and
Yana Volkovich and
Maria Eskevich and
Pavel Braslavski},
title = {10th Russian Summer School in Information Retrieval (RuSSIR 2016)},
journal = {{SIGIR} Forum},
volume = {50},
number = {2},
pages = {28--35},
year = {2016},
url = {https://doi.org/10.1145/3053408.3053415},
doi = {10.1145/3053408.3053415},
timestamp = {Fri, 12 Jan 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KotovTBIVEB16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Liu16,
author = {Xitong Liu},
title = {Entity Centric Information Retrieval},
journal = {{SIGIR} Forum},
volume = {50},
number = {1},
pages = {92},
year = {2016},
url = {https://doi.org/10.1145/2964797.2964815},
doi = {10.1145/2964797.2964815},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Liu16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Martinez-Alvarez16,
author = {Miguel Martinez{-}Alvarez and
Udo Kruschwitz and
Gabriella Kazai and
Frank Hopfgartner and
David P. A. Corney and
Ricardo Campos and
Dyaa Albakour},
title = {Report on the 1st International Workshop on Recent Trends in News
Information Retrieval (NewsIR16)},
journal = {{SIGIR} Forum},
volume = {50},
number = {1},
pages = {58--67},
year = {2016},
url = {https://doi.org/10.1145/2964797.2964807},
doi = {10.1145/2964797.2964807},
timestamp = {Thu, 06 May 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Martinez-Alvarez16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MayrFC16,
author = {Philipp Mayr and
Ingo Frommholz and
Guillaume Cabanac},
title = {Report on the 3rd International Workshop on Bibliometric-enhanced
Information Retrieval {(BIR} 2016)},
journal = {{SIGIR} Forum},
volume = {50},
number = {1},
pages = {28--34},
year = {2016},
url = {https://doi.org/10.1145/2964797.2964803},
doi = {10.1145/2964797.2964803},
timestamp = {Thu, 25 Jul 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/MayrFC16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MederHKK16,
author = {Michael Meder and
Frank Hopfgartner and
Gabriella Kazai and
Udo Kruschwitz},
title = {GamifIR 2016: {SIGIR} 2016 Workshop on Gamification for Information
Retrieval},
journal = {{SIGIR} Forum},
volume = {50},
number = {2},
pages = {47--50},
year = {2016},
url = {https://doi.org/10.1145/3053408.3053419},
doi = {10.1145/3053408.3053419},
timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/MederHKK16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MullerKHFSPKCTN16,
author = {Henning M{\"{u}}ller and
Jayashree Kalpathy{-}Cramer and
Allan Hanbury and
Keyvan Farahani and
Rinat Sergeev and
Jin H. Paik and
Arno Klein and
Antonio Criminisi and
Andrew D. Trister and
Thea Norman and
David N. Kennedy and
Ganapati Srinivasa and
Artem Mamonov and
Nina Preuss},
title = {Report on the Cloud-Based Evaluation Approaches Workshop 2015},
journal = {{SIGIR} Forum},
volume = {50},
number = {1},
pages = {38--41},
year = {2016},
url = {https://doi.org/10.1145/2964797.2964804},
doi = {10.1145/2964797.2964804},
timestamp = {Thu, 13 Apr 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/MullerKHFSPKCTN16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/NielekWJT16,
author = {Radoslaw Nielek and
Adam Wierzbicki and
Adam Jatowt and
Katsumi Tanaka},
title = {Report on the WebQuality 2015 Workshop},
journal = {{SIGIR} Forum},
volume = {50},
number = {1},
pages = {83--85},
year = {2016},
url = {https://doi.org/10.1145/2964797.2964809},
doi = {10.1145/2964797.2964809},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/NielekWJT16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Odijk16,
author = {Daan Odijk},
title = {Context {\&} Semantics in News {\&} Web Search},
journal = {{SIGIR} Forum},
volume = {50},
number = {1},
pages = {93--94},
year = {2016},
url = {https://doi.org/10.1145/2964797.2964816},
doi = {10.1145/2964797.2964816},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Odijk16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sappelli16,
author = {Maya Sappelli},
title = {Knowledge Work in Context: User Centered Knowledge Worker Support},
journal = {{SIGIR} Forum},
volume = {50},
number = {2},
pages = {107--108},
year = {2016},
url = {https://doi.org/10.1145/3053408.3053429},
doi = {10.1145/3053408.3053429},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Sappelli16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Schuth16,
author = {Anne Schuth},
title = {Search Engines that Learn from Their Users},
journal = {{SIGIR} Forum},
volume = {50},
number = {1},
pages = {95--96},
year = {2016},
url = {https://doi.org/10.1145/2964797.2964817},
doi = {10.1145/2964797.2964817},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Schuth16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SoulierTSAP16,
author = {Laure Soulier and
Lynda Tamine and
Tetsuya Sakai and
Leif Azzopardi and
Jeremy Pickens},
title = {Report on the First International Workshop on the Evaluation on Collaborative
Information Seeking and Retrieval (ECol'2015)},
journal = {{SIGIR} Forum},
volume = {50},
number = {1},
pages = {42--48},
year = {2016},
url = {https://doi.org/10.1145/2964797.2964805},
doi = {10.1145/2964797.2964805},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SoulierTSAP16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Whiting16,
author = {Stewart Whiting},
title = {Temporal Dynamics in Information Retrieval},
journal = {{SIGIR} Forum},
volume = {50},
number = {1},
pages = {97--98},
year = {2016},
url = {https://doi.org/10.1145/2964797.2964818},
doi = {10.1145/2964797.2964818},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Whiting16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zhao16,
author = {Xiaoxue Zhao},
title = {Cold-Start Collaborative Filtering},
journal = {{SIGIR} Forum},
volume = {50},
number = {1},
pages = {99--100},
year = {2016},
url = {https://doi.org/10.1145/2964797.2964819},
doi = {10.1145/2964797.2964819},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Zhao16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AhlersWM15,
author = {Dirk Ahlers and
Erik Wilde and
Bruno Martins},
title = {Report on the Fourth Workshop on Locatio and the Web (LocWeb 2014)},
journal = {{SIGIR} Forum},
volume = {49},
number = {1},
pages = {35--40},
year = {2015},
url = {https://doi.org/10.1145/2795403.2795413},
doi = {10.1145/2795403.2795413},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AhlersWM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AhlersWM15a,
author = {Dirk Ahlers and
Erik Wilde and
Bruno Martins},
title = {Report on the Fifth International Workshop on Location and the Web
(LocWeb 2015)},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {123--128},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888442},
doi = {10.1145/2888422.2888442},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AhlersWM15a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlonsoHK15,
author = {Omar Alonso and
Marti A. Hearst and
Jaap Kamps},
title = {Report on the First {SIGIR} Workshop on Graph Search and Beyond (GSB'15)},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {89--97},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888436},
doi = {10.1145/2888422.2888436},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AlonsoHK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlonsoKK15,
author = {Omar Alonso and
Jaap Kamps and
Jussi Karlgren},
title = {Report on the Seventh Workshop on Exploiting Semantic Annotations
in Information Retrieval (ESAIR'14)},
journal = {{SIGIR} Forum},
volume = {49},
number = {1},
pages = {27--34},
year = {2015},
url = {https://doi.org/10.1145/2795403.2795412},
doi = {10.1145/2795403.2795412},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AlonsoKK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ArguelloCDLT15,
author = {Jaime Arguello and
Matt Crane and
Fernando Diaz and
Jimmy Lin and
Andrew Trotman},
title = {Report on the {SIGIR} 2015 Workshop on Reproducibility, Inexplicability,
and Generalizability of Results {(RIGOR)}},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {107--116},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888439},
doi = {10.1145/2888422.2888439},
timestamp = {Fri, 27 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/ArguelloCDLT15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belkin15,
author = {Nicholas J. Belkin},
title = {People, Interacting with Information},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {13--27},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888424},
doi = {10.1145/2888422.2888424},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Belkin15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BogersK15,
author = {Toine Bogers and
Marijn Koolen},
title = {Report on RecSys 2015 Workshop on New Trends in Content-Based Recommender
Systems},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {141--146},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888445},
doi = {10.1145/2888422.2888445},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BogersK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BogersKC15,
author = {Toine Bogers and
Marijn Koolen and
Iv{\'{a}}n Cantador},
title = {Report on RecSys 2014: Workshop on New Trends in Content-Based Recommender
Systems},
journal = {{SIGIR} Forum},
volume = {49},
number = {1},
pages = {20--26},
year = {2015},
url = {https://doi.org/10.1145/2795403.2795411},
doi = {10.1145/2795403.2795411},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BogersKC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BraslavskiMPVKK15,
author = {Pavel Braslavski and
Ilya Markov and
Panos M. Pardalos and
Yana Volkovich and
Sergei Koltsov and
Olessia Koltsova and
Dmitry I. Ignatov},
title = {9th Russian Summer School in Information Retrieval (RuSSIR 2015)},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {72--79},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888432},
doi = {10.1145/2888422.2888432},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BraslavskiMPVKK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CappellatoFJKMP15,
author = {Linda Cappellato and
Nicola Ferro and
Gareth J. F. Jones and
Jaap Kamps and
Josiane Mothe and
Karen Pinel{-}Sauvagnat and
Eric SanJuan and
Jacques Savoy},
title = {Report on {CLEF} 2015: Experimental {IR} Meets Multilinguality, Multimodality,
and Interaction},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {47--56},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888428},
doi = {10.1145/2888422.2888428},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CappellatoFJKMP15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Dalvi15,
author = {Bhavana Bharat Dalvi},
title = {Constrained Semi-supervised Learning in the Presence of Unanticipated
Classes},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {147},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888447},
doi = {10.1145/2888422.2888447},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Dalvi15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Diaz015,
author = {Fernando Diaz and
Diane Kelly},
title = {{SIGIR} 2015 Workshop Program Overview},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {80--82},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888434},
doi = {10.1145/2888422.2888434},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Diaz015.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DumaisCCJSR15,
author = {Susan T. Dumais and
Edward Cutrell and
Jonathan J. Cadiz and
Gavin Jancke and
Raman Sarin and
Daniel C. Robbins},
title = {Stuff I've Seen: {A} System for Personal Information Retrieval and
Re-Use},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {28--35},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888425},
doi = {10.1145/2888422.2888425},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DumaisCCJSR15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Freire15,
author = {Ana Freire},
title = {Query Scheduling Techniques and Power-Latency Trade-off Model for
Large-Scale Search Engines},
journal = {{SIGIR} Forum},
volume = {49},
number = {1},
pages = {66},
year = {2015},
url = {https://doi.org/10.1145/2795403.2795418},
doi = {10.1145/2795403.2795418},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Freire15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GadeHHKKSTW15,
author = {Maria G{\"{a}}de and
Mark M. Hall and
Hugo C. Huurdeman and
Jaap Kamps and
Marijn Koolen and
Mette Skov and
Elaine Toms and
David Walsh},
title = {Report on the First Workshop on Supporting Complex Search Tasks},
journal = {{SIGIR} Forum},
volume = {49},
number = {1},
pages = {50--56},
year = {2015},
url = {https://doi.org/10.1145/2795403.2795415},
doi = {10.1145/2795403.2795415},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/GadeHHKKSTW15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GwizdkaM15,
author = {Jacek Gwizdka and
Javed Mostafa},
title = {NeuroIR 2015: {SIGIR} 2015 Workshop on Neuro-Physiological Methods
in {IR} Research},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {83--88},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888435},
doi = {10.1145/2888422.2888435},
timestamp = {Fri, 09 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/GwizdkaM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HalveyMJRRMK15,
author = {Martin Halvey and
Philip J. McParlane and
Joemon M. Jose and
Keith van Rijsbergen and
Stefan M. R{\"{u}}ger and
R. Manmatha and
Mohan S. Kankanhalli},
title = {{ICMR} 2014: 4th {ACM} International Conference on Multimedia Retrieval},
journal = {{SIGIR} Forum},
volume = {49},
number = {1},
pages = {10--15},
year = {2015},
url = {https://doi.org/10.1145/2795403.2795407},
doi = {10.1145/2795403.2795407},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/HalveyMJRRMK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HalveyVC15,
author = {Martin Halvey and
Robert Villa and
Paul D. Clough},
title = {{SIGIR} 2014: Workshop on Gathering Efficient Assessments of Relevance
{(GEAR)}},
journal = {{SIGIR} Forum},
volume = {49},
number = {1},
pages = {16--19},
year = {2015},
url = {https://doi.org/10.1145/2795403.2795409},
doi = {10.1145/2795403.2795409},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/HalveyVC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HanburyKRF15,
author = {Allan Hanbury and
Gabriella Kazai and
Andreas Rauber and
Norbert Fuhr},
title = {{ECIR} 2015: 37th European Conference on Information Retrieval},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {36--46},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888427},
doi = {10.1145/2888422.2888427},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/HanburyKRF15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HopfgartnerBSKL15,
author = {Frank Hopfgartner and
Torben Brodt and
Jonas Seiler and
Benjamin Kille and
Andreas Lommatzsch and
Martha A. Larson and
Roberto Turrin and
Andr{\'{a}}s Ser{\'{e}}ny},
title = {Benchmarking News Recommendations: The {CLEF} NewsREEL Use Case},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {129--136},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888443},
doi = {10.1145/2888422.2888443},
timestamp = {Fri, 06 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/HopfgartnerBSKL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HopfgartnerHMKM15,
author = {Frank Hopfgartner and
Allan Hanbury and
Henning M{\"{u}}ller and
Noriko Kando and
Simon Mercer and
Jayashree Kalpathy{-}Cramer and
Martin Potthast and
Tim Gollub and
Anastasia Krithara and
Jimmy Lin and
Krisztian Balog and
Ivan Eggel},
title = {Report on the Evaluation-as-a-Service (EaaS) Expert Workshop},
journal = {{SIGIR} Forum},
volume = {49},
number = {1},
pages = {57--65},
year = {2015},
url = {https://doi.org/10.1145/2795403.2795416},
doi = {10.1145/2795403.2795416},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/HopfgartnerHMKM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KazaiLHKM15,
author = {Gabriella Kazai and
Lumi and
Frank Hopfgartner and
Udo Kruschwitz and
Michael Meder},
title = {{ECIR} 2015 Workshop on Gamification for Information Retrieval (GamifIR'15)},
journal = {{SIGIR} Forum},
volume = {49},
number = {1},
pages = {41--49},
year = {2015},
url = {https://doi.org/10.1145/2795403.2795414},
doi = {10.1145/2795403.2795414},
timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/KazaiLHKM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KeJ15,
author = {Hao{-}Ren Ke and
Hideo Joho},
title = {2nd Asian Summer School in Information Access {(ASSIA} 2015)},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {67--71},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888431},
doi = {10.1145/2888422.2888431},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KeJ15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Limsopatham15,
author = {Nut Limsopatham},
title = {A Framework for Enhancing the Query and Medical Record Representations
for Patient Search},
journal = {{SIGIR} Forum},
volume = {49},
number = {1},
pages = {68--69},
year = {2015},
url = {https://doi.org/10.1145/2795403.2795420},
doi = {10.1145/2795403.2795420},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Limsopatham15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Marujo15,
author = {Lu{\'{\i}}s Carlos dos Santos Marujo},
title = {Event-based Multi-document Summarization},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {148--149},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888448},
doi = {10.1145/2888422.2888448},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Marujo15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Moreno15,
author = {Jos{\'{e}} G. Moreno},
title = {Text-Based Ephemeral Clustering for Web Image Retrieval on Mobile
Devices},
journal = {{SIGIR} Forum},
volume = {49},
number = {1},
pages = {67},
year = {2015},
url = {https://doi.org/10.1145/2795403.2795419},
doi = {10.1145/2795403.2795419},
timestamp = {Tue, 06 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Moreno15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Qureshi15,
author = {Muhammad Atif Qureshi},
title = {Utilising Wikipedia for Text Mining Applications},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {150--151},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888449},
doi = {10.1145/2888422.2888449},
timestamp = {Sat, 30 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Qureshi15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ShahCH15,
author = {Chirag Shah and
Robert G. Capra and
Preben Hansen},
title = {Workshop on Social and Collaborative Information Seeking {(SCIS)}},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {117--122},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888441},
doi = {10.1145/2888422.2888441},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ShahCH15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SteichenFLC15,
author = {Ben Steichen and
Nicola Ferro and
David Lewis and
Ed H. Chi},
title = {1st International Workshop on Multilingual Web Access {(MWA} 2015)},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {137--140},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888444},
doi = {10.1145/2888422.2888444},
timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/SteichenFLC15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TrattnerPBM15,
author = {Christoph Trattner and
Denis Parra and
Peter Brusilovsky and
Leandro Balby Marinho},
title = {Report on the {SIGIR} 2015 Workshop on Social Personalization and
Search},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {102--106},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888438},
doi = {10.1145/2888422.2888438},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/TrattnerPBM15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Trevisiol15,
author = {Michele Trevisiol},
title = {Exploiting Implicit User Activity for Media Recommendation},
journal = {{SIGIR} Forum},
volume = {49},
number = {1},
pages = {70},
year = {2015},
url = {https://doi.org/10.1145/2795403.2795421},
doi = {10.1145/2795403.2795421},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Trevisiol15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TsikrikaPVK15,
author = {Theodora Tsikrika and
Symeon Papadopoulos and
Stefanos Vrochidis and
Yiannis Kompatsiaris},
title = {10th European Summer School in Information Retrieval {(ESSIR} 2015)},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {57--66},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888430},
doi = {10.1145/2888422.2888430},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/TsikrikaPVK15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/YangS15,
author = {Grace Hui Yang and
Ian Soboroff},
title = {Privacy Preserving {IR} 2015: {A} {SIGIR} 2015 Workshop},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {98--101},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888437},
doi = {10.1145/2888422.2888437},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/YangS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Yeniterzi15,
author = {Reyyan Yeniterzi},
title = {Effective and Efficient Approaches to Retrieving and Using Expertise
in Social Media},
journal = {{SIGIR} Forum},
volume = {49},
number = {2},
pages = {152--153},
year = {2015},
url = {https://doi.org/10.1145/2888422.2888450},
doi = {10.1145/2888422.2888450},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Yeniterzi15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZhaiCL15,
author = {ChengXiang Zhai and
William W. Cohen and
John D. Lafferty},
title = {Beyond Independent Relevance: Methods and Evaluation Metrics for Subtopic
Retrieval},
journal = {{SIGIR} Forum},
volume = {49},
number = {1},
pages = {2--9},
year = {2015},
url = {https://doi.org/10.1145/2795403.2795405},
doi = {10.1145/2795403.2795405},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ZhaiCL15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgostiFTV14,
author = {Maristella Agosti and
Norbert Fuhr and
Elaine G. Toms and
Pertti Vakkari},
title = {Evaluation methodologies in information retrieval dagstuhl seminar
13441},
journal = {{SIGIR} Forum},
volume = {48},
number = {1},
pages = {36--41},
year = {2014},
url = {https://doi.org/10.1145/2641383.2641390},
doi = {10.1145/2641383.2641390},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AgostiFTV14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlbakourMOCB14,
author = {M{-}Dyaa Albakour and
Craig Macdonald and
Iadh Ounis and
Charles L. A. Clarke and
Veli Bicer},
title = {Report on the 1st International Workshop on Information Access in
Smart Cities (i-ASC 2014)},
journal = {{SIGIR} Forum},
volume = {48},
number = {2},
pages = {96--104},
year = {2014},
url = {https://doi.org/10.1145/2701583.2701597},
doi = {10.1145/2701583.2701597},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AlbakourMOCB14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Alonso14,
author = {Omar Alonso},
title = {Visualization for Relevance Assessments},
journal = {{SIGIR} Forum},
volume = {48},
number = {2},
pages = {14--21},
year = {2014},
url = {https://doi.org/10.1145/2701583.2701585},
doi = {10.1145/2701583.2701585},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Alonso14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BalogEKKS14,
author = {Krisztian Balog and
David Elsweiler and
Evangelos Kanoulas and
Liadh Kelly and
Mark D. Smucker},
title = {Report on the {CIKM} workshop on living labs for information retrieval
evaluation},
journal = {{SIGIR} Forum},
volume = {48},
number = {1},
pages = {21--28},
year = {2014},
url = {https://doi.org/10.1145/2641383.2641388},
doi = {10.1145/2641383.2641388},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BalogEKKS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BelloginCST14,
author = {Alejandro Bellog{\'{\i}}n and
Pablo Castells and
Alan Said and
Domonkos Tikk},
title = {Report on the workshop on reproducibility and replication in recommender
systems evaluation (RepSys)},
journal = {{SIGIR} Forum},
volume = {48},
number = {1},
pages = {29--35},
year = {2014},
url = {https://doi.org/10.1145/2641383.2641389},
doi = {10.1145/2641383.2641389},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BelloginCST14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BennettGKK14,
author = {Paul N. Bennett and
Evgeniy Gabrilovich and
Jaap Kamps and
Jussi Karlgren},
title = {Report on the sixth workshop on exploiting semantic annotations in
information retrieval (ESAIR'13)},
journal = {{SIGIR} Forum},
volume = {48},
number = {1},
pages = {13--20},
year = {2014},
url = {https://doi.org/10.1145/2641383.2641387},
doi = {10.1145/2641383.2641387},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/BennettGKK14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Berardi14,
author = {Giacomo Berardi},
title = {Semi-automated text classification},
journal = {{SIGIR} Forum},
volume = {48},
number = {1},
pages = {42},
year = {2014},
url = {https://doi.org/10.1145/2641383.2641392},
doi = {10.1145/2641383.2641392},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Berardi14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Brandao14,
author = {Wladmir Cardoso Brand{\~{a}}o},
title = {Exploiting entities for query expansion},
journal = {{SIGIR} Forum},
volume = {48},
number = {1},
pages = {43},
year = {2014},
url = {https://doi.org/10.1145/2641383.2641393},
doi = {10.1145/2641383.2641393},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Brandao14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BraslavskiKWVI14,
author = {Pavel Braslavski and
Nikolay Karpov and
Marcel Worring and
Yana Volkovich and
Dmitry I. Ignatov},
title = {8th Russian Summer School in Information Retrieval (RuSSIR 2014)},
journal = {{SIGIR} Forum},
volume = {48},
number = {2},
pages = {105--110},
year = {2014},
url = {https://doi.org/10.1145/2701583.2701598},
doi = {10.1145/2701583.2701598},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BraslavskiKWVI14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CappellatoCFHHHKKLSTV14,
author = {Linda Cappellato and
Paul D. Clough and
Nicola Ferro and
Mark M. Hall and
Martin Halvey and
Allan Hanbury and
Evangelos Kanoulas and
Wessel Kraaij and
Mihai Lupu and
Mark Sanderson and
Elaine Toms and
Robert Villa},
title = {{CLEF} 2014: Information Access Evaluation meets Multilinguality,
Multimodality, and Interaction},
journal = {{SIGIR} Forum},
volume = {48},
number = {2},
pages = {56--62},
year = {2014},
url = {https://doi.org/10.1145/2701583.2701589},
doi = {10.1145/2701583.2701589},
timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/CappellatoCFHHHKKLSTV14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CarmelCGHW14,
author = {David Carmel and
Ming{-}Wei Chang and
Evgeniy Gabrilovich and
Bo{-}June Paul Hsu and
Kuansan Wang},
title = {ERD'14: Entity Recognition and Disambiguation Challenge},
journal = {{SIGIR} Forum},
volume = {48},
number = {2},
pages = {63--77},
year = {2014},
url = {https://doi.org/10.1145/2701583.2701591},
doi = {10.1145/2701583.2701591},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CarmelCGHW14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Diaz14,
author = {Fernando Diaz},
title = {Experimentation Standards for Crisis Informatics},
journal = {{SIGIR} Forum},
volume = {48},
number = {2},
pages = {22--30},
year = {2014},
url = {https://doi.org/10.1145/2701583.2701586},
doi = {10.1145/2701583.2701586},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Diaz14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Ferro14,
author = {Nicola Ferro},
title = {{CLEF} 15th Birthday: Past, Present, and Future},
journal = {{SIGIR} Forum},
volume = {48},
number = {2},
pages = {31--55},
year = {2014},
url = {https://doi.org/10.1145/2701583.2701587},
doi = {10.1145/2701583.2701587},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Ferro14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GoeuriotKJMZ14,
author = {Lorraine Goeuriot and
Liadh Kelly and
Gareth J. F. Jones and
Henning M{\"{u}}ller and
Justin Zobel},
title = {Report on the {SIGIR} 2014 Workshop on Medical Information Retrieval
(MedIR)},
journal = {{SIGIR} Forum},
volume = {48},
number = {2},
pages = {78--82},
year = {2014},
url = {https://doi.org/10.1145/2701583.2701592},
doi = {10.1145/2701583.2701592},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/GoeuriotKJMZ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JatowtCCT14,
author = {Adam Jatowt and
Carlos Castillo and
James Caverlee and
Katsumi Tanaka},
title = {Report on the WebQuality 2014 Workshop},
journal = {{SIGIR} Forum},
volume = {48},
number = {2},
pages = {93--95},
year = {2014},
url = {https://doi.org/10.1145/2701583.2701596},
doi = {10.1145/2701583.2701596},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/JatowtCCT14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Koopman14,
author = {Bevan Koopman},
title = {Semantic Search as Inference: Applications in Health Informatics},
journal = {{SIGIR} Forum},
volume = {48},
number = {2},
pages = {116--117},
year = {2014},
url = {https://doi.org/10.1145/2701583.2701601},
doi = {10.1145/2701583.2701601},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Koopman14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Marcheggiani14,
author = {Diego Marcheggiani},
title = {Beyond linear chain: a journey through conditional random fields for
information extraction from text},
journal = {{SIGIR} Forum},
volume = {48},
number = {1},
pages = {44},
year = {2014},
url = {https://doi.org/10.1145/2641383.2641394},
doi = {10.1145/2641383.2641394},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Marcheggiani14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Papadakos14,
author = {Panagiotis Papadakos},
title = {Interactive Exploration of Multi-Dimensional Information Spaces with
Preference Support},
journal = {{SIGIR} Forum},
volume = {48},
number = {2},
pages = {118},
year = {2014},
url = {https://doi.org/10.1145/2701583.2701602},
doi = {10.1145/2701583.2701602},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Papadakos14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Ruocco14,
author = {Massimiliano Ruocco},
title = {Geo-Temporal Mining and Searching of Events from Web-based Image Collections},
journal = {{SIGIR} Forum},
volume = {48},
number = {2},
pages = {119--120},
year = {2014},
url = {https://doi.org/10.1145/2701583.2701603},
doi = {10.1145/2701583.2701603},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Ruocco14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SaidLQ14,
author = {Alan Said and
Ernesto William De Luca and
Daniele Quercia},
title = {Report on the 4th Workshop on Context-awareness in Retrieval and Recommendation
(CaRR 2014)},
journal = {{SIGIR} Forum},
volume = {48},
number = {2},
pages = {89--92},
year = {2014},
url = {https://doi.org/10.1145/2701583.2701595},
doi = {10.1145/2701583.2701595},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/SaidLQ14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sakai14,
author = {Tetsuya Sakai},
title = {Statistical reform in information retrieval?},
journal = {{SIGIR} Forum},
volume = {48},
number = {1},
pages = {3--12},
year = {2014},
url = {https://doi.org/10.1145/2641383.2641385},
doi = {10.1145/2641383.2641385},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Sakai14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SalampasisT14,
author = {Michail Salampasis and
Yannis Tzitzikas},
title = {Report on the 3rd {MUMIA} Training School on Information Retrieval
and Interactive Information Access, July 21-25, 2014, FORTH, Heraklion,
Crete, Greece},
journal = {{SIGIR} Forum},
volume = {48},
number = {2},
pages = {111--115},
year = {2014},
url = {https://doi.org/10.1145/2701583.2701599},
doi = {10.1145/2701583.2701599},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SalampasisT14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SiY14,
author = {Luo Si and
Hui Yang},
title = {{PIR} 2014 The First International Workshop on Privacy-Preserving
{IR:} When Information Retrieval Meets Privacy and Security},
journal = {{SIGIR} Forum},
volume = {48},
number = {2},
pages = {83--88},
year = {2014},
url = {https://doi.org/10.1145/2701583.2701593},
doi = {10.1145/2701583.2701593},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SiY14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgostiFS13,
author = {Maristella Agosti and
Nicola Ferro and
Gianmaria Silvello},
title = {{PROMISE} winter school 2013 bridging between information retrieval
and databases},
journal = {{SIGIR} Forum},
volume = {47},
number = {1},
pages = {46--52},
year = {2013},
url = {https://doi.org/10.1145/2492189.2492197},
doi = {10.1145/2492189.2492197},
timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AgostiFS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Albakour13,
author = {M{-}Dyaa Albakour},
title = {Adaptive domain modelling for information retrieval},
journal = {{SIGIR} Forum},
volume = {47},
number = {1},
pages = {59},
year = {2013},
url = {https://doi.org/10.1145/2492189.2492200},
doi = {10.1145/2492189.2492200},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Albakour13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BellotDGGKKKMMMPSSTTTTSSW13,
author = {Patrice Bellot and
Antoine Doucet and
Shlomo Geva and
Sairam Gurajada and
Jaap Kamps and
Gabriella Kazai and
Marijn Koolen and
Arunav Mishra and
V{\'{e}}ronique Moriceau and
Josiane Mothe and
Michael Preminger and
Eric SanJuan and
Ralf Schenkel and
Xavier Tannier and
Martin Theobald and
Matthew Trappett and
Andrew Trotman and
Mark Sanderson and
Falk Scholer and
Qiuyue Wang},
title = {Report on {INEX} 2013},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {21--32},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568393},
doi = {10.1145/2568388.2568393},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BellotDGGKKKMMMPSSTTTTSSW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Bodoff13,
author = {David Bodoff},
title = {Fuhr's challenge: conceptual research, or bust},
journal = {{SIGIR} Forum},
volume = {47},
number = {1},
pages = {3--16},
year = {2013},
url = {https://doi.org/10.1145/2492189.2492191},
doi = {10.1145/2492189.2492191},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Bodoff13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BorlundMW13,
author = {Pia Borlund and
Thomas Mandl and
Christa Womser{-}Hacker},
title = {The second workshop of the european network for work information {(ENWI)}},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {74--77},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568401},
doi = {10.1145/2568388.2568401},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BorlundMW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BraslavskiZRV13,
author = {Pavel Braslavski and
Nikita Zhiltsov and
Stefan M. R{\"{u}}ger and
Yana Volkovich},
title = {7th Russian summer school in information retrieval (RuSSIR 2013)},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {96--100},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568404},
doi = {10.1145/2568388.2568404},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BraslavskiZRV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Campos13,
author = {Ricardo Campos},
title = {Disambiguating implicit temporal queries for temporal information
retrieval applications},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {137--138},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568411},
doi = {10.1145/2568388.2568411},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Campos13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CapraFSSW13,
author = {Robert Capra and
Luanne Freund and
Catherine L. Smith and
Mark D. Smucker and
Ryen W. White},
title = {{HCIR} 2013: the seventh international symposium on human-computer
interaction and information retrieval},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {33--40},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568394},
doi = {10.1145/2568388.2568394},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CapraFSSW13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CastellsHSL13,
author = {Pablo Castells and
Frank Hopfgartner and
Alan Said and
Mounia Lalmas},
title = {Report on the {SIGIR} 2013 workshop on benchmarking adaptive retrieval
and recommender systems},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {64--67},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568398},
doi = {10.1145/2568388.2568398},
timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/CastellsHSL13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ClarkeFSY13,
author = {Charles L. A. Clarke and
Luanne Freund and
Mark D. Smucker and
Emine Yilmaz},
title = {Report on the {SIGIR} 2013 workshop on modeling user behavior for
information retrieval evaluation {(MUBE} 2013)},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {84--95},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568403},
doi = {10.1145/2568388.2568403},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ClarkeFSY13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Diaz-Aviles13,
author = {Ernesto Diaz{-}Aviles},
title = {Living analytics methods for the social web},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {139},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568412},
doi = {10.1145/2568388.2568412},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Diaz-Aviles13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FerroFMNPRST13,
author = {Nicola Ferro and
Pamela Forner and
Henning M{\"{u}}ller and
Roberto Navigli and
Roberto Paredes and
Paolo Rosso and
Benno Stein and
Dan Tufis},
title = {{CLEF} 2013: information access evaluation meets multilinguality,
multimodality, and visualization},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {15--20},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568392},
doi = {10.1145/2568388.2568392},
timestamp = {Wed, 30 Oct 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/FerroFMNPRST13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FornerBBCFHKM13,
author = {Pamela Forner and
Luisa Bentivogli and
Martin Braschler and
Khalid Choukri and
Nicola Ferro and
Allan Hanbury and
Jussi Karlgren and
Henning M{\"{u}}ller},
title = {{PROMISE} technology transfer day: spreading the word on information
access evaluation at an industrial event},
journal = {{SIGIR} Forum},
volume = {47},
number = {1},
pages = {53--58},
year = {2013},
url = {https://doi.org/10.1145/2492189.2492198},
doi = {10.1145/2492189.2492198},
timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/FornerBBCFHKM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FoxF13,
author = {Edward A. Fox and
Mohamed M. Farag},
title = {Report on the workshop on web archiving and digital libraries {(WADL}
2013)},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {128--133},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568408},
doi = {10.1145/2568388.2568408},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/FoxF13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FuhrKKV13,
author = {Norbert Fuhr and
Jaap Kamps and
Wessel Kraaij and
Suzan Verberne},
title = {Report on IIiX'12: the fourth information interaction in context symposium},
journal = {{SIGIR} Forum},
volume = {47},
number = {1},
pages = {22--30},
year = {2013},
url = {https://doi.org/10.1145/2492189.2492194},
doi = {10.1145/2492189.2492194},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/FuhrKKV13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HalveyA13,
author = {Martin Halvey and
Leif Azzopardi},
title = {Report on the Scottish informatics and computing science alliance's
information retrieval workshop (IRFest)},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {109--115},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568406},
doi = {10.1145/2568388.2568406},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/HalveyA13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HansenWLNR13,
author = {Preben Hansen and
Max L. Wilson and
Birger Larsen and
Kristian Norling and
Tony Russell{-}Rose},
title = {Report on EuroHCIR 2013: the 3rd european workshop on human-computer
interaction and information retrieval},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {78--83},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568402},
doi = {10.1145/2568388.2568402},
timestamp = {Tue, 17 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/HansenWLNR13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hofmann13,
author = {Katja Hofmann},
title = {Fast and reliable online learning to rank for information retrieval},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {140},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568413},
doi = {10.1145/2568388.2568413},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Hofmann13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JatowtCGT13,
author = {Adam Jatowt and
Carlos Castillo and
Zolt{\'{a}}n Gy{\"{o}}ngyi and
Katsumi Tanaka},
title = {Report on the WebQuality 2013 workshop},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {134--136},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568409},
doi = {10.1145/2568388.2568409},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/JatowtCGT13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JohoKSSS13,
author = {Hideo Joho and
Noriko Kando and
Tetsuya Sakai and
Yohei Seki and
Shigeo Sugimoto},
title = {Asian summer school in information access {(ASSIA} 2013)},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {58--63},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568397},
doi = {10.1145/2568388.2568397},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/JohoKSSS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jonassen13,
author = {Simon Jonassen},
title = {Efficient query processing in distributed search engines},
journal = {{SIGIR} Forum},
volume = {47},
number = {1},
pages = {60--61},
year = {2013},
url = {https://doi.org/10.1145/2492189.2492201},
doi = {10.1145/2492189.2492201},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Jonassen13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KampsKMM13,
author = {Jaap Kamps and
Jussi Karlgren and
Peter Mika and
Vanessa Murdock},
title = {Report on the fifth workshop on exploiting semantic annotations in
information retrieval (ESAIR'12)},
journal = {{SIGIR} Forum},
volume = {47},
number = {1},
pages = {38--45},
year = {2013},
url = {https://doi.org/10.1145/2492189.2492196},
doi = {10.1145/2492189.2492196},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/KampsKMM13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KellyAC13,
author = {Diane Kelly and
Jaime Arguello and
Robert Capra},
title = {{NSF} workshop on task-based information search systems},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {116--127},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568407},
doi = {10.1145/2568388.2568407},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KellyAC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LawlessACC13,
author = {S{\'{e}}amus Lawless and
Maristella Agosti and
Owen Conlan and
Paul D. Clough},
title = {{ENRICH} 2013: the first workshop on the exploration, navigation and
retrieval of information in cultural heritage},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {68--73},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568400},
doi = {10.1145/2568388.2568400},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/LawlessACC13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LinE13,
author = {Jimmy Lin and
Miles Efron},
title = {Evaluation as a service for information retrieval},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {8--14},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568390},
doi = {10.1145/2568388.2568390},
timestamp = {Fri, 27 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/LinE13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lopes13,
author = {Carla Teixeira Lopes},
title = {Context-based health information retrieval},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {141--142},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568414},
doi = {10.1145/2568388.2568414},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Lopes13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/McCreadie13,
author = {Richard McCreadie},
title = {News vertical search using user-generated content},
journal = {{SIGIR} Forum},
volume = {47},
number = {1},
pages = {62--63},
year = {2013},
url = {https://doi.org/10.1145/2492189.2492202},
doi = {10.1145/2492189.2492202},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/McCreadie13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MurdockCKK13,
author = {Vanessa Murdock and
Charles L. A. Clarke and
Jaap Kamps and
Jussi Karlgren},
title = {Report on the workshop on search and exploration of x-rated information
{(SEXI} 2013)},
journal = {{SIGIR} Forum},
volume = {47},
number = {1},
pages = {31--37},
year = {2013},
url = {https://doi.org/10.1145/2492189.2492195},
doi = {10.1145/2492189.2492195},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/MurdockCKK13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Neumayer13,
author = {Robert Neumayer},
title = {Semantic and distributed entity search in the web of data},
journal = {{SIGIR} Forum},
volume = {47},
number = {1},
pages = {64},
year = {2013},
url = {https://doi.org/10.1145/2492189.2492203},
doi = {10.1145/2492189.2492203},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Neumayer13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Pal13,
author = {Sukomal Pal},
title = {Sub-document level information retrieval: retrieval and evaluation},
journal = {{SIGIR} Forum},
volume = {47},
number = {1},
pages = {65--66},
year = {2013},
url = {https://doi.org/10.1145/2492189.2492204},
doi = {10.1145/2492189.2492204},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Pal13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Santos13,
author = {Rodrygo L. T. Santos},
title = {Explicit web search result diversification},
journal = {{SIGIR} Forum},
volume = {47},
number = {1},
pages = {67--68},
year = {2013},
url = {https://doi.org/10.1145/2492189.2492205},
doi = {10.1145/2492189.2492205},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Santos13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SerdyukovBK13,
author = {Pavel Serdyukov and
Pavel Braslavski and
Jaap Kamps},
title = {{ECIR} 2013: 35th european conference on information retrieval},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {41--57},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568395},
doi = {10.1145/2568388.2568395},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SerdyukovBK13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TrotmanCS13,
author = {Andrew Trotman and
Sally Jo Cunningham and
Laurianne Sitbon},
title = {The seventeenth australasian document computing symposium},
journal = {{SIGIR} Forum},
volume = {47},
number = {1},
pages = {17--21},
year = {2013},
url = {https://doi.org/10.1145/2492189.2492193},
doi = {10.1145/2492189.2492193},
timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/TrotmanCS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WhiteYHAH13,
author = {Ryen W. White and
Elad Yom{-}Tov and
Eric Horvitz and
Eugene Agichtein and
William R. Hersh},
title = {Report on the {SIGIR} 2013 workshop on health search and discovery},
journal = {{SIGIR} Forum},
volume = {47},
number = {2},
pages = {101--108},
year = {2013},
url = {https://doi.org/10.1145/2568388.2568405},
doi = {10.1145/2568388.2568405},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/WhiteYHAH13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zuccon13,
author = {Guido Zuccon},
title = {Document ranking with quantum probabilities},
journal = {{SIGIR} Forum},
volume = {47},
number = {1},
pages = {69--70},
year = {2013},
url = {https://doi.org/10.1145/2492189.2492206},
doi = {10.1145/2492189.2492206},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Zuccon13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgostiCFMS12,
author = {Maristella Agosti and
Tiziana Catarci and
Nicola Ferro and
Henning M{\"{u}}ller and
Giuseppe Santucci},
title = {{PROMISE} winter school 2012 information retrieval meets information
visualization},
journal = {{SIGIR} Forum},
volume = {46},
number = {1},
pages = {65--70},
year = {2012},
url = {https://doi.org/10.1145/2215676.2215683},
doi = {10.1145/2215676.2215683},
timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AgostiCFMS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgostiFT12,
author = {Maristella Agosti and
Nicola Ferro and
Costantino Thanos},
title = {{DESIRE} 2011: workshop on data infrastructurEs for supporting information
retrieval evaluation},
journal = {{SIGIR} Forum},
volume = {46},
number = {1},
pages = {51--55},
year = {2012},
url = {https://doi.org/10.1145/2215676.2215681},
doi = {10.1145/2215676.2215681},
timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AgostiFT12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanCMS12,
author = {James Allan and
W. Bruce Croft and
Alistair Moffat and
Mark Sanderson},
title = {Frontiers, challenges, and opportunities for information retrieval:
Report from {SWIRL} 2012 the second strategic workshop on information
retrieval in Lorne},
journal = {{SIGIR} Forum},
volume = {46},
number = {1},
pages = {2--32},
year = {2012},
url = {https://doi.org/10.1145/2215676.2215678},
doi = {10.1145/2215676.2215678},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AllanCMS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlonsoKK12,
author = {Omar Alonso and
Jaap Kamps and
Jussi Karlgren},
title = {Report on the fourth workshop on exploiting semantic annotations in
information retrieval (ESAIR'11)},
journal = {{SIGIR} Forum},
volume = {46},
number = {1},
pages = {56--64},
year = {2012},
url = {https://doi.org/10.1145/2215676.2215682},
doi = {10.1145/2215676.2215682},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AlonsoKK12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Arguello12,
author = {Jaime Arguello},
title = {Federated search in heterogeneous environments},
journal = {{SIGIR} Forum},
volume = {46},
number = {1},
pages = {78--79},
year = {2012},
url = {https://doi.org/10.1145/2215676.2215686},
doi = {10.1145/2215676.2215686},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Arguello12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Athenikos12,
author = {Sofia J. Athenikos},
title = {Enabling entity retrieval by exploiting wikipedia as a semantic knowledge
source},
journal = {{SIGIR} Forum},
volume = {46},
number = {1},
pages = {80},
year = {2012},
url = {https://doi.org/10.1145/2215676.2215687},
doi = {10.1145/2215676.2215687},
timestamp = {Tue, 16 Aug 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Athenikos12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Baeza-YatesMVZCMBLLSL12,
author = {Ricardo Baeza{-}Yates and
Mari{-}Carmen Marcos and
Arjen P. de Vries and
Hugo Zaragoza and
Berkant Barla Cambazoglu and
Vanessa Murdock and
Alvaro Barreiro and
David E. Losada and
Ronny Lempel and
Fabrizio Silvestri and
Mounia Lalmas},
title = {{ECIR} 2012: 34th european conference on information retrieval research},
journal = {{SIGIR} Forum},
volume = {46},
number = {2},
pages = {34--41},
year = {2012},
url = {https://doi.org/10.1145/2422256.2422262},
doi = {10.1145/2422256.2422262},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Baeza-YatesMVZCMBLLSL12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BalogCVHMRSST12,
author = {Krisztian Balog and
David Carmel and
Arjen P. de Vries and
Daniel M. Herzig and
Peter Mika and
Haggai Roitman and
Ralf Schenkel and
Pavel Serdyukov and
Duc Thanh Tran},
title = {The first joint international workshop on entity-oriented and semantic
search {(JIWES)}},
journal = {{SIGIR} Forum},
volume = {46},
number = {2},
pages = {87--94},
year = {2012},
url = {https://doi.org/10.1145/2422256.2422268},
doi = {10.1145/2422256.2422268},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BalogCVHMRSST12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Bashir12,
author = {Shariq Bashir},
title = {Evaluating retrieval models using retrievability measurement},
journal = {{SIGIR} Forum},
volume = {46},
number = {1},
pages = {81},
year = {2012},
url = {https://doi.org/10.1145/2215676.2215688},
doi = {10.1145/2215676.2215688},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Bashir12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BellotCDGGKKKLMMMMPRSSSSTTTTW12,
author = {Patrice Bellot and
Timothy Chappell and
Antoine Doucet and
Shlomo Geva and
Sairam Gurajada and
Jaap Kamps and
Gabriella Kazai and
Marijn Koolen and
Monica Landoni and
Maarten Marx and
Arunav Mishra and
V{\'{e}}ronique Moriceau and
Josiane Mothe and
Michael Preminger and
Georgina Ram{\'{\i}}rez and
Mark Sanderson and
Eric SanJuan and
Falk Scholer and
A. Schuh and
Xavier Tannier and
Martin Theobald and
Matthew Trappett and
Andrew Trotman and
Qiuyue Wang},
title = {Report on {INEX} 2012},
journal = {{SIGIR} Forum},
volume = {46},
number = {2},
pages = {50--59},
year = {2012},
url = {https://doi.org/10.1145/2422256.2422264},
doi = {10.1145/2422256.2422264},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BellotCDGGKKKLMMMMPRSSSSTTTTW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BellotCDGKKKLMMMRSSSTTTTW12,
author = {Patrice Bellot and
Timothy Chappell and
Antoine Doucet and
Shlomo Geva and
Jaap Kamps and
Gabriella Kazai and
Marijn Koolen and
Monica Landoni and
Maarten Marx and
V{\'{e}}ronique Moriceau and
Josiane Mothe and
Georgina Ram{\'{\i}}rez and
Mark Sanderson and
Eric SanJuan and
Falk Scholer and
Xavier Tannier and
Martin Theobald and
Matthew Trappett and
Andrew Trotman and
Qiuyue Wang},
title = {Report on {INEX} 2011},
journal = {{SIGIR} Forum},
volume = {46},
number = {1},
pages = {33--42},
year = {2012},
url = {https://doi.org/10.1145/2215676.2215679},
doi = {10.1145/2215676.2215679},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BellotCDGKKKLMMMRSSSTTTTW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Bendersky12,
author = {Michael Bendersky},
title = {Information retrieval with query hypergraphs},
journal = {{SIGIR} Forum},
volume = {46},
number = {2},
pages = {111},
year = {2012},
url = {https://doi.org/10.1145/2422256.2422273},
doi = {10.1145/2422256.2422273},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Bendersky12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Blanke12,
author = {Tobias Blanke},
title = {Theoretical evaluation of {XML} retrieval},
journal = {{SIGIR} Forum},
volume = {46},
number = {1},
pages = {82--83},
year = {2012},
url = {https://doi.org/10.1145/2215676.2215689},
doi = {10.1145/2215676.2215689},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Blanke12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CallanM12,
author = {Jamie Callan and
Alistair Moffat},
title = {Panel on use of proprietary data},
journal = {{SIGIR} Forum},
volume = {46},
number = {2},
pages = {10--18},
year = {2012},
url = {https://doi.org/10.1145/2422256.2422258},
doi = {10.1145/2422256.2422258},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CallanM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CapraGKTW12,
author = {Robert Capra and
Gene Golovchinsky and
Bill Kules and
Daniel Tunkelang and
Ryen W. White},
title = {{HCIR} 2012: the sixth international symposium on human-computer interaction
and information retrieval},
journal = {{SIGIR} Forum},
volume = {46},
number = {2},
pages = {42--49},
year = {2012},
url = {https://doi.org/10.1145/2422256.2422263},
doi = {10.1145/2422256.2422263},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CapraGKTW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CastilloGJT12,
author = {Carlos Castillo and
Zolt{\'{a}}n Gy{\"{o}}ngyi and
Adam Jatowt and
Katsumi Tanaka},
title = {Report on the WebQuality 2012 workshop},
journal = {{SIGIR} Forum},
volume = {46},
number = {2},
pages = {107--110},
year = {2012},
url = {https://doi.org/10.1145/2422256.2422271},
doi = {10.1145/2422256.2422271},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/CastilloGJT12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CatarciFFHKPSW12,
author = {Tiziana Catarci and
Nicola Ferro and
Pamela Forner and
Djoerd Hiemstra and
Jussi Karlgren and
Anselmo Pe{\~{n}}as and
Giuseppe Santucci and
Christa Womser{-}Hacker},
title = {{CLEF} 2012: information access evaluation meets multilinguality,
multimodality, and visual analytics},
journal = {{SIGIR} Forum},
volume = {46},
number = {2},
pages = {29--33},
year = {2012},
url = {https://doi.org/10.1145/2422256.2422261},
doi = {10.1145/2422256.2422261},
timestamp = {Fri, 07 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/CatarciFFHKPSW12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DiazDRRS12,
author = {Fernando Diaz and
Susan T. Dumais and
Kira Radinsky and
Maarten de Rijke and
Milad Shokouhi},
title = {{\#}TAIA2012},
journal = {{SIGIR} Forum},
volume = {46},
number = {2},
pages = {102--106},
year = {2012},
url = {https://doi.org/10.1145/2422256.2422270},
doi = {10.1145/2422256.2422270},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/DiazDRRS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FerroBHLPRSABBBBCNFFHHHJLLMMPPPRSST12,
author = {Maristella Agosti and
Richard Berendsen and
Toine Bogers and
Martin Braschler and
Paul Buitelaar and
Khalid Choukri and
Giorgio Maria Di Nunzio and
Nicola Ferro and
Pamela Forner and
Allan Hanbury and
Karin Friberg Heppin and
Preben Hansen and
Anni J{\"{a}}rvelin and
Birger Larsen and
Mihai Lupu and
Ivano Masiero and
Henning M{\"{u}}ller and
Simone Peruzzo and
Vivien Petras and
Florina Piroi and
Maarten de Rijke and
Giuseppe Santucci and
Gianmaria Silvello and
Elaine G. Toms},
title = {{PROMISE} retreat report prospects and opportunities for information
access evaluation},
journal = {{SIGIR} Forum},
volume = {46},
number = {2},
pages = {60--84},
year = {2012},
url = {https://doi.org/10.1145/2422256.2422265},
doi = {10.1145/2422256.2422265},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/FerroBHLPRSABBBBCNFFHHHJLLMMPPPRSST12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fuhr12,
author = {Norbert Fuhr},
title = {Salton award lecture information retrieval as engineering science},
journal = {{SIGIR} Forum},
volume = {46},
number = {2},
pages = {19--28},
year = {2012},
url = {https://doi.org/10.1145/2422256.2422259},
doi = {10.1145/2422256.2422259},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Fuhr12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/He12,
author = {Jiyin He},
title = {Exploring topic structure: coherence, diversity and relatedness},
journal = {{SIGIR} Forum},
volume = {46},
number = {1},
pages = {84},
year = {2012},
url = {https://doi.org/10.1145/2215676.2215690},
doi = {10.1145/2215676.2215690},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/He12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kanhabua12,
author = {Nattiya Kanhabua},
title = {Time-aware approaches to information retrieval},
journal = {{SIGIR} Forum},
volume = {46},
number = {1},
pages = {85},
year = {2012},
url = {https://doi.org/10.1145/2215676.2215691},
doi = {10.1145/2215676.2215691},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Kanhabua12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KazaiEB12,
author = {Gabriella Kazai and
Carsten Eickhoff and
Peter Brusilovsky},
title = {Report on BooksOnline'11: 4th workshop on online books, complementary
social media, and crowdsourcing},
journal = {{SIGIR} Forum},
volume = {46},
number = {1},
pages = {43--50},
year = {2012},
url = {https://doi.org/10.1145/2215676.2215680},
doi = {10.1145/2215676.2215680},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KazaiEB12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LarsenLV12,
author = {Birger Larsen and
Christina Lioma and
Arjen P. de Vries},
title = {Report on {TBAS} 2012: workshop on task-based and aggregated search},
journal = {{SIGIR} Forum},
volume = {46},
number = {1},
pages = {71--77},
year = {2012},
url = {https://doi.org/10.1145/2215676.2215684},
doi = {10.1145/2215676.2215684},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/LarsenLV12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lv12,
author = {Yuanhua Lv},
title = {Improving the effectiveness of language modeling approaches to information
retrieval: bridging the theory-effectiveness gap},
journal = {{SIGIR} Forum},
volume = {46},
number = {2},
pages = {112--113},
year = {2012},
url = {https://doi.org/10.1145/2422256.2422274},
doi = {10.1145/2422256.2422274},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Lv12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Radinsky12,
author = {Kira Radinsky},
title = {Learning to Predict the Future using Web Knowledge and Dynamics},
journal = {{SIGIR} Forum},
volume = {46},
number = {2},
pages = {114--115},
year = {2012},
url = {https://doi.org/10.1145/2422256.2422275},
doi = {10.1145/2422256.2422275},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Radinsky12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sushmita12,
author = {Shanu Sushmita},
title = {Study of result presentation and interaction for aggregated search},
journal = {{SIGIR} Forum},
volume = {46},
number = {1},
pages = {86--87},
year = {2012},
url = {https://doi.org/10.1145/2215676.2215692},
doi = {10.1145/2215676.2215692},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Sushmita12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Tigelaar12,
author = {Almer S. Tigelaar},
title = {Peer-to-peer information retrieval},
journal = {{SIGIR} Forum},
volume = {46},
number = {2},
pages = {116},
year = {2012},
url = {https://doi.org/10.1145/2422256.2422276},
doi = {10.1145/2422256.2422276},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Tigelaar12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TrotmanCOCCG12,
author = {Andrew Trotman and
Charles L. A. Clarke and
Iadh Ounis and
J. Shane Culpepper and
Marc{-}Allen Cartright and
Shlomo Geva},
title = {Open source information petrieval: a report on the {SIGIR} 2012 workshop},
journal = {{SIGIR} Forum},
volume = {46},
number = {2},
pages = {95--101},
year = {2012},
url = {https://doi.org/10.1145/2422256.2422269},
doi = {10.1145/2422256.2422269},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/TrotmanCOCCG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Weerkamp12,
author = {Wouter Weerkamp},
title = {Finding people and their utterances in social media},
journal = {{SIGIR} Forum},
volume = {46},
number = {1},
pages = {88--89},
year = {2012},
url = {https://doi.org/10.1145/2215676.2215693},
doi = {10.1145/2215676.2215693},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Weerkamp12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Whiting12,
author = {Stewart Whiting},
title = {The {ACM} {A.M.} turing centenary celebration},
journal = {{SIGIR} Forum},
volume = {46},
number = {2},
pages = {85--86},
year = {2012},
url = {https://doi.org/10.1145/2422256.2422266},
doi = {10.1145/2422256.2422266},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Whiting12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Yang12,
author = {Hui Yang},
title = {Personal concept hierarahy construction},
journal = {{SIGIR} Forum},
volume = {46},
number = {1},
pages = {90--91},
year = {2012},
url = {https://doi.org/10.1145/2215676.2215694},
doi = {10.1145/2215676.2215694},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Yang12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zhao12,
author = {Le Zhao},
title = {Modeling and solving term mismatch for full-text retrieval},
journal = {{SIGIR} Forum},
volume = {46},
number = {2},
pages = {117--118},
year = {2012},
url = {https://doi.org/10.1145/2422256.2422277},
doi = {10.1145/2422256.2422277},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Zhao12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgostiLLL11,
author = {Maristella Agosti and
Ernesto William De Luca and
S{\'{e}}amus Lawless and
Johannes Leveling},
title = {{PMHR} 2011: the first workshop on personalised multilingual hypertext
retrieval},
journal = {{SIGIR} Forum},
volume = {45},
number = {2},
pages = {94--98},
year = {2011},
url = {https://doi.org/10.1145/2093346.2093362},
doi = {10.1145/2093346.2093362},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AgostiLLL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlexanderABBCDDFGKKKKLMNNPSSTTTTVWW11,
author = {David Alexander and
Paavo Arvola and
Thomas Beckers and
Patrice Bellot and
Timothy Chappell and
Christopher M. De Vries and
Antoine Doucet and
Norbert Fuhr and
Shlomo Geva and
Jaap Kamps and
Gabriella Kazai and
Marijn Koolen and
Sangeetha Kutty and
Monica Landoni and
V{\'{e}}ronique Moriceau and
Richi Nayak and
Ragnar Nordlie and
Nils Pharo and
Eric SanJuan and
Ralf Schenkel and
Andrea Tagarelli and
Xavier Tannier and
James A. Thom and
Andrew Trotman and
Johanna Vainio and
Qiuyue Wang and
Chen Wu},
title = {Report on {INEX} 2010},
journal = {{SIGIR} Forum},
volume = {45},
number = {1},
pages = {2--17},
year = {2011},
url = {https://doi.org/10.1145/1988852.1988854},
doi = {10.1145/1988852.1988854},
timestamp = {Sun, 26 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AlexanderABBCDDFGKKKKLMNNPSSTTTTVWW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BalogVSW11,
author = {Krisztian Balog and
Arjen P. de Vries and
Pavel Serdyukov and
Ji{-}Rong Wen},
title = {The first international workshop on entity-oriented search {(EOS)}},
journal = {{SIGIR} Forum},
volume = {45},
number = {2},
pages = {43--50},
year = {2011},
url = {https://doi.org/10.1145/2093346.2093353},
doi = {10.1145/2093346.2093353},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BalogVSW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BelkinCGKK11,
author = {Nicholas J. Belkin and
Charles L. A. Clarke and
Ning Gao and
Jaap Kamps and
Jussi Karlgren},
title = {Report on the {SIGIR} workshop on "entertain me": supporting complex
search tasks},
journal = {{SIGIR} Forum},
volume = {45},
number = {2},
pages = {51--59},
year = {2011},
url = {https://doi.org/10.1145/2093346.2093354},
doi = {10.1145/2093346.2093354},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BelkinCGKK11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BennettEJS11,
author = {Paul N. Bennett and
Khalid El{-}Arini and
Thorsten Joachims and
Krysta M. Svore},
title = {Enriching information retrieval},
journal = {{SIGIR} Forum},
volume = {45},
number = {2},
pages = {60--65},
year = {2011},
url = {https://doi.org/10.1145/2093346.2093355},
doi = {10.1145/2093346.2093355},
timestamp = {Thu, 17 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/BennettEJS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BerendtHHLMV11,
author = {Bettina Berendt and
Laura Hollink and
Vera Hollink and
Markus Luczak{-}R{\"{o}}sch and
Knud M{\"{o}}ller and
David Vallet},
title = {Usage analysis and the web of data},
journal = {{SIGIR} Forum},
volume = {45},
number = {1},
pages = {63--69},
year = {2011},
url = {https://doi.org/10.1145/1988852.1988864},
doi = {10.1145/1988852.1988864},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BerendtHHLMV11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BoscarinoHJMRW11,
author = {Corrado Boscarino and
Katja Hofmann and
Valentin Jijkoun and
Edgar Meij and
Maarten de Rijke and
Wouter Weerkamp},
title = {{DIR} 2011: the eleventh Dutch-Belgian information retrieval workshop},
journal = {{SIGIR} Forum},
volume = {45},
number = {1},
pages = {42--44},
year = {2011},
url = {https://doi.org/10.1145/1988852.1988859},
doi = {10.1145/1988852.1988859},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/BoscarinoHJMRW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CapraGKRSTW11,
author = {Robert Capra and
Gene Golovchinsky and
Bill Kules and
Daniel M. Russell and
Catherine L. Smith and
Daniel Tunkelang and
Ryen W. White},
title = {{HCIR} 2011: the fifth international workshop on human-computer interaction
and information retrieval},
journal = {{SIGIR} Forum},
volume = {45},
number = {2},
pages = {102--107},
year = {2011},
url = {https://doi.org/10.1145/2093346.2093364},
doi = {10.1145/2093346.2093364},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CapraGKRSTW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CarteretteCKS11,
author = {Ben Carterette and
Paul D. Clough and
Evangelos Kanoulas and
Mark Sanderson},
title = {Report on the {ECIR} 2011 workshop on information retrieval over query
sessions},
journal = {{SIGIR} Forum},
volume = {45},
number = {2},
pages = {76--80},
year = {2011},
url = {https://doi.org/10.1145/2093346.2093358},
doi = {10.1145/2093346.2093358},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CarteretteCKS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CastilloGJT11,
author = {Carlos Castillo and
Zolt{\'{a}}n Gy{\"{o}}ngyi and
Adam Jatowt and
Katsumi Tanaka},
title = {Report on the joint WICOW/AIRWeb workshop on web quality (WebQuality
2011)},
journal = {{SIGIR} Forum},
volume = {45},
number = {2},
pages = {99--101},
year = {2011},
url = {https://doi.org/10.1145/2093346.2093363},
doi = {10.1145/2093346.2093363},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/CastilloGJT11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ChurchNSSWX11,
author = {Ken Ward Church and
Jian{-}Yun Nie and
Le Sun and
Maosong Sun and
Haifeng Wang and
Endong Xun},
title = {Report on the first summer school on {NLP} and {IR} in Beijing},
journal = {{SIGIR} Forum},
volume = {45},
number = {2},
pages = {41--42},
year = {2011},
url = {https://doi.org/10.1145/2093346.2093351},
doi = {10.1145/2093346.2093351},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/ChurchNSSWX11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CloughFFGHKLPR11,
author = {Paul D. Clough and
Nicola Ferro and
Pamela Forner and
Julio Gonzalo and
Bouke Huurnink and
Jaana Kek{\"{a}}l{\"{a}}inen and
Mounia Lalmas and
Vivien Petras and
Maarten de Rijke},
title = {{CLEF} 2011: conference on multilingual and multimodal information
access evaluation},
journal = {{SIGIR} Forum},
volume = {45},
number = {2},
pages = {32--37},
year = {2011},
url = {https://doi.org/10.1145/2093346.2093349},
doi = {10.1145/2093346.2093349},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/CloughFFGHKLPR11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Demartini11,
author = {Gianluca Demartini},
title = {From people to entities: typed search in the enterprise and the web},
journal = {{SIGIR} Forum},
volume = {45},
number = {1},
pages = {73},
year = {2011},
url = {https://doi.org/10.1145/1988852.1988868},
doi = {10.1145/1988852.1988868},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Demartini11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Du11,
author = {Jia Tina Du},
title = {Multitasking, cognitive coordination and cognitive shifts during web
searching},
journal = {{SIGIR} Forum},
volume = {45},
number = {1},
pages = {74},
year = {2011},
url = {https://doi.org/10.1145/1988852.1988869},
doi = {10.1145/1988852.1988869},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Du11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fernandez11,
author = {Ronald T. Fern{\'{a}}ndez},
title = {Improving search effectiveness in sentence retrieval and novelty detection},
journal = {{SIGIR} Forum},
volume = {45},
number = {1},
pages = {75--76},
year = {2011},
url = {https://doi.org/10.1145/1988852.1988870},
doi = {10.1145/1988852.1988870},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Fernandez11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Huurnink11,
author = {Bouke Huurnink},
title = {Search in audiovisual broadcast archives},
journal = {{SIGIR} Forum},
volume = {45},
number = {1},
pages = {77},
year = {2011},
url = {https://doi.org/10.1145/1988852.1988871},
doi = {10.1145/1988852.1988871},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Huurnink11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JaimesLV11,
author = {Alejandro Jaimes and
Mounia Lalmas and
Yana Volkovich},
title = {First international workshop on social media engagement (SoME 2011)},
journal = {{SIGIR} Forum},
volume = {45},
number = {1},
pages = {56--62},
year = {2011},
url = {https://doi.org/10.1145/1988852.1988863},
doi = {10.1145/1988852.1988863},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/JaimesLV11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jarvelin11,
author = {Kalervo J{\"{a}}rvelin},
title = {{IR} research: systems, interaction, evaluation and theories},
journal = {{SIGIR} Forum},
volume = {45},
number = {2},
pages = {17--31},
year = {2011},
url = {https://doi.org/10.1145/2093346.2093348},
doi = {10.1145/2093346.2093348},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Jarvelin11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KampsKS11,
author = {Jaap Kamps and
Jussi Karlgren and
Ralf Schenkel},
title = {Report on the third workshop on exploiting semantic annotations in
information retrieval {(ESAIR)}},
journal = {{SIGIR} Forum},
volume = {45},
number = {1},
pages = {33--41},
year = {2011},
url = {https://doi.org/10.1145/1988852.1988858},
doi = {10.1145/1988852.1988858},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KampsKS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kaptein11,
author = {Rianne Kaptein},
title = {Effective focused retrieval by exploiting query context and document
structure},
journal = {{SIGIR} Forum},
volume = {45},
number = {2},
pages = {108},
year = {2011},
url = {https://doi.org/10.1145/2093346.2093366},
doi = {10.1145/2093346.2093366},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Kaptein11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KazaiB11,
author = {Gabriella Kazai and
Peter Brusilovsky},
title = {Report on the BooksOnline'10: third workshop on research advances
in large digital book repositories and complementary media},
journal = {{SIGIR} Forum},
volume = {45},
number = {1},
pages = {25--32},
year = {2011},
url = {https://doi.org/10.1145/1988852.1988857},
doi = {10.1145/1988852.1988857},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KazaiB11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KellyKE11,
author = {Liadh Kelly and
Jin Young Kim and
David Elsweiler},
title = {Workshop on evaluating personal search},
journal = {{SIGIR} Forum},
volume = {45},
number = {2},
pages = {81--86},
year = {2011},
url = {https://doi.org/10.1145/2093346.2093359},
doi = {10.1145/2093346.2093359},
timestamp = {Fri, 03 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KellyKE11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KingL11,
author = {Irwin King and
Hang Li},
title = {The fourth {ACM} international conference on web search and data mining
{(WSDM} 2011)},
journal = {{SIGIR} Forum},
volume = {45},
number = {2},
pages = {38--40},
year = {2011},
url = {https://doi.org/10.1145/2093346.2093350},
doi = {10.1145/2093346.2093350},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KingL11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Koolen11,
author = {Marijn Koolen},
title = {The meaning of structure: the value of link evidence for information
retrieval},
journal = {{SIGIR} Forum},
volume = {45},
number = {1},
pages = {78--79},
year = {2011},
url = {https://doi.org/10.1145/1988852.1988872},
doi = {10.1145/1988852.1988872},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Koolen11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LeaseCY11,
author = {Matthew Lease and
Vitor R. Carvalho and
Emine Yilmaz},
title = {Crowdsourcing for search and data mining},
journal = {{SIGIR} Forum},
volume = {45},
number = {1},
pages = {18--24},
year = {2011},
url = {https://doi.org/10.1145/1988852.1988856},
doi = {10.1145/1988852.1988856},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LeaseCY11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LeaseY11,
author = {Matthew Lease and
Emine Yilmaz},
title = {Crowdsourcing for information retrieval},
journal = {{SIGIR} Forum},
volume = {45},
number = {2},
pages = {66--75},
year = {2011},
url = {https://doi.org/10.1145/2093346.2093356},
doi = {10.1145/2093346.2093356},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/LeaseY11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MacdonaldCW11,
author = {Craig Macdonald and
Charles L. A. Clarke and
Jun Wang},
title = {The 1st international workshop on diversity in document retrieval},
journal = {{SIGIR} Forum},
volume = {45},
number = {2},
pages = {87--93},
year = {2011},
url = {https://doi.org/10.1145/2093346.2093360},
doi = {10.1145/2093346.2093360},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/MacdonaldCW11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Meij11,
author = {Edgar Meij},
title = {Combining concepts and language models for information access},
journal = {{SIGIR} Forum},
volume = {45},
number = {1},
pages = {80},
year = {2011},
url = {https://doi.org/10.1145/1988852.1988873},
doi = {10.1145/1988852.1988873},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Meij11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/NambiarS11,
author = {Ullas B. Nambiar and
L. Venkata Subramaniam},
title = {Eighth workshop on information integration on the web (IIWeb 2011)},
journal = {{SIGIR} Forum},
volume = {45},
number = {1},
pages = {54--55},
year = {2011},
url = {https://doi.org/10.1145/1988852.1988862},
doi = {10.1145/1988852.1988862},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/NambiarS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/OardSFM11,
author = {Douglas W. Oard and
Fabrizio Sebastiani and
Jonathan Furner and
Gary Marchionini},
title = {Publishing survey articles on information retrieval topics},
journal = {{SIGIR} Forum},
volume = {45},
number = {1},
pages = {70--72},
year = {2011},
url = {https://doi.org/10.1145/1988852.1988866},
doi = {10.1145/1988852.1988866},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/OardSFM11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SimperlMVA11,
author = {Elena Simperl and
Devika P. Madalli and
Denny Vrandecic and
Enrique Alfonseca},
title = {DiversiWeb 2011},
journal = {{SIGIR} Forum},
volume = {45},
number = {1},
pages = {49--53},
year = {2011},
url = {https://doi.org/10.1145/1988852.1988861},
doi = {10.1145/1988852.1988861},
timestamp = {Fri, 23 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/SimperlMVA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SteinPRBSK11,
author = {Benno Stein and
Martin Potthast and
Paolo Rosso and
Alberto Barr{\'{o}}n{-}Cede{\~{n}}o and
Efstathios Stamatatos and
Moshe Koppel},
title = {Fourth international workshop on uncovering plagiarism, authorship,
and social software misuse},
journal = {{SIGIR} Forum},
volume = {45},
number = {1},
pages = {45--48},
year = {2011},
url = {https://doi.org/10.1145/1988852.1988860},
doi = {10.1145/1988852.1988860},
timestamp = {Mon, 03 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SteinPRBSK11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zhang11,
author = {Junte Zhang},
title = {System evaluation of archival description and access},
journal = {{SIGIR} Forum},
volume = {45},
number = {2},
pages = {109--110},
year = {2011},
url = {https://doi.org/10.1145/2093346.2093367},
doi = {10.1145/2093346.2093367},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Zhang11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgostiBCFHPPRS10,
author = {Maristella Agosti and
Martin Braschler and
Khalid Choukri and
Nicola Ferro and
Donna Harman and
Carol Peters and
Emanuele Pianta and
Maarten de Rijke and
Alan F. Smeaton},
title = {{CLEF} 2010 conference on multilingual and multimodal information
access evaluation},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {8--12},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924477},
doi = {10.1145/1924475.1924477},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AgostiBCFHPPRS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlonsoA10,
author = {Omar Alonso and
Giambattista Amati},
title = {{SIGIR} 2010 workshop program overview},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {15--16},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924480},
doi = {10.1145/1924475.1924480},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AlonsoA10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Aly10,
author = {Robin Aly},
title = {Modeling representation uncertainty in concept-based multimedia retrieval},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {82},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924494},
doi = {10.1145/1924475.1924494},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Aly10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AzzopardiJKS10,
author = {Leif Azzopardi and
Kalervo J{\"{a}}rvelin and
Jaap Kamps and
Mark D. Smucker},
title = {Report on the {SIGIR} 2010 workshop on the simulation of interaction},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {35--47},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924484},
doi = {10.1145/1924475.1924484},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AzzopardiJKS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BeckersBDDVDFFGGHIKKKKLLMNNPSSTTTTV10,
author = {Thomas Beckers and
Patrice Bellot and
Gianluca Demartini and
Ludovic Denoyer and
Christopher M. De Vries and
Antoine Doucet and
Khairun Nisa Fachry and
Norbert Fuhr and
Patrick Gallinari and
Shlomo Geva and
Wei Chi Huang and
Tereza Iofciu and
Jaap Kamps and
Gabriella Kazai and
Marijn Koolen and
Sangeetha Kutty and
Monica Landoni and
Miro Lehtonen and
V{\'{e}}ronique Moriceau and
Richi Nayak and
Ragnar Nordlie and
Nils Pharo and
Eric SanJuan and
Ralf Schenkel and
Xavier Tannier and
Martin Theobald and
James A. Thom and
Andrew Trotman and
Arjen P. de Vries},
title = {Report on {INEX} 2009},
journal = {{SIGIR} Forum},
volume = {44},
number = {1},
pages = {38--57},
year = {2010},
url = {https://doi.org/10.1145/1842890.1842897},
doi = {10.1145/1842890.1842897},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BeckersBDDVDFFGGHIKKKKLLMNNPSSTTTTV10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Bierig10,
author = {Ralf Bierig},
title = {Event and map content personalisation in a mobile and context-aware-environment},
journal = {{SIGIR} Forum},
volume = {44},
number = {1},
pages = {87},
year = {2010},
url = {https://doi.org/10.1145/1842890.1842905},
doi = {10.1145/1842890.1842905},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Bierig10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Bilotti10,
author = {Matthew W. Bilotti},
title = {Linguistic and semantic passage retrieval strategies for question
answering},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {83},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924495},
doi = {10.1145/1924475.1924495},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Bilotti10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BlancoCL10,
author = {Roi Blanco and
Berkant Barla Cambazoglu and
Claudio Lucchese},
title = {The 8th workshop on large-scale distributed systems for information
retrieval (LSDS-IR'10)},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {54--58},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924486},
doi = {10.1145/1924475.1924486},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BlancoCL10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CapraKSTW10,
author = {Robert G. Capra and
Bill Kules and
Catherine L. Smith and
Daniel Tunkelang and
Ryen W. White},
title = {{HCIR} 2010: the fourth international workshop on human-computer interaction
and information retrieval},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {73--77},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924491},
doi = {10.1145/1924475.1924491},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CapraKSTW10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CarvalhoLY10,
author = {Vitor R. Carvalho and
Matthew Lease and
Emine Yilmaz},
title = {Crowdsourcing for search evaluation},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {17--22},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924481},
doi = {10.1145/1924475.1924481},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CarvalhoLY10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CroftBLX10,
author = {W. Bruce Croft and
Michael Bendersky and
Hang Li and
Gu Xu},
title = {Query representation and understanding workshop},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {48--53},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924485},
doi = {10.1145/1924475.1924485},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CroftBLX10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DohertyGJS10,
author = {Aiden R. Doherty and
Cathal Gurrin and
Gareth J. F. Jones and
Alan F. Smeaton},
title = {Information access for personal media archives},
journal = {{SIGIR} Forum},
volume = {44},
number = {1},
pages = {33--37},
year = {2010},
url = {https://doi.org/10.1145/1842890.1842895},
doi = {10.1145/1842890.1842895},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DohertyGJS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ElsweilerJKT10,
author = {David Elsweiler and
Gareth J. F. Jones and
Liadh Kelly and
Jaime Teevan},
title = {Workshop on desktop search},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {28--34},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924483},
doi = {10.1145/1924475.1924483},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ElsweilerJKT10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GurrinHKLR10,
author = {Cathal Gurrin and
Yulan He and
Udo Kruschwitz and
Suzanne Little and
Stefan M. R{\"{u}}ger},
title = {{ECIR} 2010: 32nd european conference on information retrieval research},
journal = {{SIGIR} Forum},
volume = {44},
number = {1},
pages = {2--18},
year = {2010},
url = {https://doi.org/10.1145/1842890.1842892},
doi = {10.1145/1842890.1842892},
timestamp = {Wed, 23 Mar 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/GurrinHKLR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HanburyZB10,
author = {Allan Hanbury and
Veronika Zenz and
Helmut Berger},
title = {1st international workshop on advances in patent information retrieval
(AsPIRe'10)},
journal = {{SIGIR} Forum},
volume = {44},
number = {1},
pages = {19--22},
year = {2010},
url = {https://doi.org/10.1145/1842890.1842893},
doi = {10.1145/1842890.1842893},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/HanburyZB10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hauff10,
author = {Claudia Hauff},
title = {Predicting the effectiveness of queries and retrieval systems},
journal = {{SIGIR} Forum},
volume = {44},
number = {1},
pages = {88},
year = {2010},
url = {https://doi.org/10.1145/1842890.1842906},
doi = {10.1145/1842890.1842906},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Hauff10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hopfgartner10,
author = {Frank Hopfgartner},
title = {Personalised video retrieval: application of implicit feedback and
semantic user profiles},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {84--85},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924496},
doi = {10.1145/1924475.1924496},
timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Hopfgartner10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JatowtT10,
author = {Adam Jatowt and
Katsumi Tanaka},
title = {Report of the 4th workshop on information credibility on the web {(WICOW}
2010)},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {78--81},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924492},
doi = {10.1145/1924475.1924492},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/JatowtT10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Ke10,
author = {Weimao Ke},
title = {Scalability of findability: decentralized search and retrieval in
large information networks},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {86},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924497},
doi = {10.1145/1924475.1924497},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Ke10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KellyB10,
author = {Diane Kelly and
Nicholas J. Belkin},
title = {The third information interaction in context symposium (IIiX'10)},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {13--14},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924478},
doi = {10.1145/1924475.1924478},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KellyB10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KosmopoulosGPA10,
author = {Aris Kosmopoulos and
{\'{E}}ric Gaussier and
Georgios Paliouras and
Sujeevan Aseervatham},
title = {The {ECIR} 2010 large scale hierarchical classification workshop},
journal = {{SIGIR} Forum},
volume = {44},
number = {1},
pages = {23--32},
year = {2010},
url = {https://doi.org/10.1145/1842890.1842894},
doi = {10.1145/1842890.1842894},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KosmopoulosGPA10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KraaijVHHW10,
author = {Wessel Kraaij and
Suzan Verberne and
Max Hinne and
Maarten van der Heijden and
Theo P. van der Weide},
title = {{DIR} 2010: the tenth Dutch-Belgian information retrieval workshop},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {64--66},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924489},
doi = {10.1145/1924475.1924489},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KraaijVHHW10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LarsonOJKK10,
author = {Martha A. Larson and
Roeland Ordelman and
Franciska de Jong and
Joachim K{\"{o}}hler and
Wessel Kraaij},
title = {Multimedia with a speech track: searching spontaneous conversational
speech},
journal = {{SIGIR} Forum},
volume = {44},
number = {1},
pages = {76--81},
year = {2010},
url = {https://doi.org/10.1145/1842890.1842901},
doi = {10.1145/1842890.1842901},
timestamp = {Fri, 06 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LarsonOJKK10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Liu10,
author = {Jingjing Liu},
title = {Personalizing information retrieval using task stage, topic knowledge,
and task products},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {87},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924498},
doi = {10.1145/1924475.1924498},
timestamp = {Wed, 04 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Liu10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MacdonaldSOS10,
author = {Craig Macdonald and
Rodrygo L. T. Santos and
Iadh Ounis and
Ian Soboroff},
title = {Blog track research at {TREC}},
journal = {{SIGIR} Forum},
volume = {44},
number = {1},
pages = {58--75},
year = {2010},
url = {https://doi.org/10.1145/1842890.1842899},
doi = {10.1145/1842890.1842899},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/MacdonaldSOS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Roda10,
author = {Giovanna Roda},
title = {Connecting the dots},
journal = {{SIGIR} Forum},
volume = {44},
number = {1},
pages = {82--86},
year = {2010},
url = {https://doi.org/10.1145/1842890.1842903},
doi = {10.1145/1842890.1842903},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Roda10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SerdyukovHR10,
author = {Pavel Serdyukov and
Djoerd Hiemstra and
Ian Ruthven},
title = {Towards accessible search systems},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {23--27},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924482},
doi = {10.1145/1924475.1924482},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SerdyukovHR10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Shah10,
author = {Chirag Shah},
title = {A framework for supporting user-centric collaborative information
seeking},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {88},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924499},
doi = {10.1145/1924475.1924499},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Shah10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Trieschnigg10,
author = {Dolf Trieschnigg},
title = {Proof of concept: concept-based biomedical information retrieval},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {89},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924500},
doi = {10.1145/1924475.1924500},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Trieschnigg10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Verberne10,
author = {Suzan Verberne},
title = {In search of the Why: developing a system for answering why-questions},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {90},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924501},
doi = {10.1145/1924475.1924501},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Verberne10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WebberSS10,
author = {William Webber and
Tetsuya Sakai and
Mark Sanderson},
title = {{EVIA} 2010: the third international workshop on evaluating information
access},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {67--72},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924490},
doi = {10.1145/1924475.1924490},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/WebberSS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZhaiWYVV10,
author = {Chengxiang Zhai and
Kuansan Wang and
David Yarowsky and
Stephan Vogel and
Evelyne Viegas},
title = {Web N-gram workshop 2010},
journal = {{SIGIR} Forum},
volume = {44},
number = {2},
pages = {59--63},
year = {2010},
url = {https://doi.org/10.1145/1924475.1924487},
doi = {10.1145/1924475.1924487},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ZhaiWYVV10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zhang10,
author = {Yan Zhang},
title = {The construction of mental models of information-rich web spaces:
the development process and the impact of task complexity},
journal = {{SIGIR} Forum},
volume = {44},
number = {1},
pages = {89},
year = {2010},
url = {https://doi.org/10.1145/1842890.1842907},
doi = {10.1145/1842890.1842907},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Zhang10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgichteinHS09,
author = {Eugene Agichtein and
Marti A. Hearst and
Ian Soboroff},
title = {The search and social media workshop at {SIGIR} 2009},
journal = {{SIGIR} Forum},
volume = {43},
number = {2},
pages = {53--56},
year = {2009},
url = {https://doi.org/10.1145/1670564.1670573},
doi = {10.1145/1670564.1670573},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AgichteinHS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Ashoori09,
author = {Elham Ashoori},
title = {Using topic shifts in content-oriented {XML} retrieval},
journal = {{SIGIR} Forum},
volume = {43},
number = {1},
pages = {70},
year = {2009},
url = {https://doi.org/10.1145/1670598.1670614},
doi = {10.1145/1670598.1670614},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Ashoori09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BilenkoGRZ09,
author = {Mikhail Bilenko and
Evgeniy Gabrilovich and
Matthew Richardson and
Yi Zhang},
title = {Information retrieval and advertising},
journal = {{SIGIR} Forum},
volume = {43},
number = {2},
pages = {29--33},
year = {2009},
url = {https://doi.org/10.1145/1670564.1670569},
doi = {10.1145/1670564.1670569},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/BilenkoGRZ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BuscherGTBBEJ09,
author = {Georg Buscher and
Jacek Gwizdka and
Jaime Teevan and
Nicholas J. Belkin and
Ralf Bierig and
Ludger van Elst and
Joemon M. Jose},
title = {{SIGIR} 2009 workshop on understanding the user: logging and interpreting
user interactions in information search and retrieval},
journal = {{SIGIR} Forum},
volume = {43},
number = {2},
pages = {57--62},
year = {2009},
url = {https://doi.org/10.1145/1670564.1670574},
doi = {10.1145/1670564.1670574},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BuscherGTBBEJ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ChanP09,
author = {Chee{-}Yong Chan and
Neoklis Polyzotis},
title = {Report on the 10th international workshop on web information and data
management {(WIDM)}},
journal = {{SIGIR} Forum},
volume = {43},
number = {1},
pages = {49--55},
year = {2009},
url = {https://doi.org/10.1145/1670598.1670607},
doi = {10.1145/1670598.1670607},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ChanP09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CloughB09,
author = {Paul D. Clough and
Bettina Berendt},
title = {Report on the TrebleCLEF query log analysis workshop 2009},
journal = {{SIGIR} Forum},
volume = {43},
number = {2},
pages = {71--77},
year = {2009},
url = {https://doi.org/10.1145/1670564.1670578},
doi = {10.1145/1670564.1670578},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CloughB09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DemartiniDDFGGHIKKKLNPSTTVWZ09,
author = {Gianluca Demartini and
Ludovic Denoyer and
Antoine Doucet and
Khairun Nisa Fachry and
Patrick Gallinari and
Shlomo Geva and
Darren Wei Che Huang and
Tereza Iofciu and
Jaap Kamps and
Gabriella Kazai and
Marijn Koolen and
Monica Landoni and
Ragnar Nordlie and
Nils Pharo and
Ralf Schenkel and
Martin Theobald and
Andrew Trotman and
Arjen P. de Vries and
Alan Woodley and
Jianhan Zhu},
title = {Report on {INEX} 2008},
journal = {{SIGIR} Forum},
volume = {43},
number = {1},
pages = {17--36},
year = {2009},
url = {https://doi.org/10.1145/1670598.1670603},
doi = {10.1145/1670598.1670603},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/DemartiniDDFGGHIKKKLNPSTTVWZ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Frommholz09,
author = {Ingo Frommholz},
title = {A probabilistic framework for information modelling and retrieval
based on user annotations on digital objects},
journal = {{SIGIR} Forum},
volume = {43},
number = {1},
pages = {71--72},
year = {2009},
url = {https://doi.org/10.1145/1670598.1670615},
doi = {10.1145/1670598.1670615},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Frommholz09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GeyKK09,
author = {Fredric C. Gey and
Jussi Karlgren and
Noriko Kando},
title = {Information access in a multilingual world: transitioning from research
to real-world applications},
journal = {{SIGIR} Forum},
volume = {43},
number = {2},
pages = {24--28},
year = {2009},
url = {https://doi.org/10.1145/1670564.1670568},
doi = {10.1145/1670564.1670568},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/GeyKK09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JatowtT09,
author = {Adam Jatowt and
Katsumi Tanaka},
title = {The 2nd workshop on information credibility on the web {(WICOW} 2008)},
journal = {{SIGIR} Forum},
volume = {43},
number = {1},
pages = {37--41},
year = {2009},
url = {https://doi.org/10.1145/1670598.1670605},
doi = {10.1145/1670598.1670605},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/JatowtT09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JatowtT09a,
author = {Adam Jatowt and
Katsumi Tanaka},
title = {The 3rd workshop on information credibility on the web {(WICOW} 2009)},
journal = {{SIGIR} Forum},
volume = {43},
number = {2},
pages = {78--82},
year = {2009},
url = {https://doi.org/10.1145/1670564.1670579},
doi = {10.1145/1670564.1670579},
timestamp = {Mon, 26 Jun 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/JatowtT09a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JohoHJR09,
author = {Hideo Joho and
Frank Hopfgartner and
Joemon M. Jose and
C. J. van Rijsbergen},
title = {{AIR} 2008: second international workshop on adaptive information
retrieval},
journal = {{SIGIR} Forum},
volume = {43},
number = {1},
pages = {63--65},
year = {2009},
url = {https://doi.org/10.1145/1670598.1670611},
doi = {10.1145/1670598.1670611},
timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/JohoHJR09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KampsGPSTV09,
author = {Jaap Kamps and
Shlomo Geva and
Carol Peters and
Tetsuya Sakai and
Andrew Trotman and
Ellen M. Voorhees},
title = {Report on the {SIGIR} 2009 workshop on the future of {IR} evaluation},
journal = {{SIGIR} Forum},
volume = {43},
number = {2},
pages = {13--23},
year = {2009},
url = {https://doi.org/10.1145/1670564.1670567},
doi = {10.1145/1670564.1670567},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KampsGPSTV09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kelly09,
author = {Diane Kelly},
title = {{SIGIR} 2009 workshop program overview},
journal = {{SIGIR} Forum},
volume = {43},
number = {2},
pages = {10--12},
year = {2009},
url = {https://doi.org/10.1145/1670564.1670566},
doi = {10.1145/1670564.1670566},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Kelly09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KulesTW09,
author = {Bill Kules and
Daniel Tunkelang and
Ryen W. White},
title = {{HCIR} 2009: the third international workshop on human-computer interaction
and information retrieval},
journal = {{SIGIR} Forum},
volume = {43},
number = {2},
pages = {83--87},
year = {2009},
url = {https://doi.org/10.1145/1670564.1670580},
doi = {10.1145/1670564.1670580},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KulesTW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LalmasTBS09,
author = {Mounia Lalmas and
Anastasios Tombros and
Pia Borlund and
Jesper W. Schneider},
title = {Second international symposium on information interaction in context},
journal = {{SIGIR} Forum},
volume = {43},
number = {1},
pages = {59--62},
year = {2009},
url = {https://doi.org/10.1145/1670598.1670610},
doi = {10.1145/1670598.1670610},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LalmasTBS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LiLZ09,
author = {Hang Li and
Tie{-}Yan Liu and
ChengXiang Zhai},
title = {Learning to rank for information retrieval {(LR4IR} 2009)},
journal = {{SIGIR} Forum},
volume = {43},
number = {2},
pages = {41--45},
year = {2009},
url = {https://doi.org/10.1145/1670564.1670571},
doi = {10.1145/1670564.1670571},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LiLZ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Liu09,
author = {Ying{-}Hsang Liu},
title = {The impact of MeSH (Medical Subject Headings) terms on information
seeking effectiveness},
journal = {{SIGIR} Forum},
volume = {43},
number = {2},
pages = {88},
year = {2009},
url = {https://doi.org/10.1145/1670564.1670582},
doi = {10.1145/1670564.1670582},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Liu09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LuccheseSY09,
author = {Claudio Lucchese and
Gleb Skobeltsyn and
Wai Gen Yee},
title = {7th workshop on large-scale distributed systems for information retrieval
(LSDS-IR'09)},
journal = {{SIGIR} Forum},
volume = {43},
number = {2},
pages = {34--40},
year = {2009},
url = {https://doi.org/10.1145/1670564.1670570},
doi = {10.1145/1670564.1670570},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LuccheseSY09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LupuHZT09,
author = {Mihai Lupu and
Jimmy X. Huang and
Jianhan Zhu and
John Tait},
title = {{TREC-CHEM:} large scale chemical information retrieval evaluation
at {TREC}},
journal = {{SIGIR} Forum},
volume = {43},
number = {2},
pages = {63--70},
year = {2009},
url = {https://doi.org/10.1145/1670564.1670576},
doi = {10.1145/1670564.1670576},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/LupuHZT09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Macdonald09,
author = {Craig Macdonald},
title = {The voting model for people search},
journal = {{SIGIR} Forum},
volume = {43},
number = {1},
pages = {73},
year = {2009},
url = {https://doi.org/10.1145/1670598.1670616},
doi = {10.1145/1670598.1670616},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Macdonald09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MichelSY09,
author = {Sebastian Michel and
Gleb Skobeltsyn and
Wai Gen Yee},
title = {Workshop on large-scale distributed systems for information retrieval},
journal = {{SIGIR} Forum},
volume = {43},
number = {1},
pages = {42--48},
year = {2009},
url = {https://doi.org/10.1145/1670598.1670606},
doi = {10.1145/1670598.1670606},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/MichelSY09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/RadlinskiBCJ09,
author = {Filip Radlinski and
Paul N. Bennett and
Ben Carterette and
Thorsten Joachims},
title = {Redundancy, diversity and interdependent document relevance},
journal = {{SIGIR} Forum},
volume = {43},
number = {2},
pages = {46--52},
year = {2009},
url = {https://doi.org/10.1145/1670564.1670572},
doi = {10.1145/1670564.1670572},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/RadlinskiBCJ09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/RodaZLJSW09,
author = {Giovanna Roda and
Veronika Zenz and
Mihai Lupu and
Kalervo J{\"{a}}rvelin and
Mark Sanderson and
Christa Womser{-}Hacker},
title = {So many topics, so little time},
journal = {{SIGIR} Forum},
volume = {43},
number = {1},
pages = {9--16},
year = {2009},
url = {https://doi.org/10.1145/1670598.1670601},
doi = {10.1145/1670598.1670601},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/RodaZLJSW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SakaiSK09,
author = {Tetsuya Sakai and
Mark Sanderson and
Noriko Kando},
title = {{EVIA} 2008: the second international workshop on evaluating information
access},
journal = {{SIGIR} Forum},
volume = {43},
number = {1},
pages = {56--62},
year = {2009},
url = {https://doi.org/10.1145/1670598.1670609},
doi = {10.1145/1670598.1670609},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SakaiSK09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sanderson09,
author = {Mark Sanderson},
title = {Workshop on novel methodologies for evaluation in information retrieval:
held at {ECIR} 2008, Glasgow, UK, 30th March, 2008},
journal = {{SIGIR} Forum},
volume = {43},
number = {1},
pages = {66--69},
year = {2009},
url = {https://doi.org/10.1145/1670598.1670612},
doi = {10.1145/1670598.1670612},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Sanderson09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Szlavik09,
author = {Zolt{\'{a}}n Szl{\'{a}}vik},
title = {Content and structure summarisation for accessing {XML} documents},
journal = {{SIGIR} Forum},
volume = {43},
number = {1},
pages = {74},
year = {2009},
url = {https://doi.org/10.1145/1670598.1670617},
doi = {10.1145/1670598.1670617},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Szlavik09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZobelMP09,
author = {Justin Zobel and
Alistair Moffat and
Laurence Anthony F. Park},
title = {Against recall: is it persistence, cardinality, density, coverage,
or totality?},
journal = {{SIGIR} Forum},
volume = {43},
number = {1},
pages = {3--8},
year = {2009},
url = {https://doi.org/10.1145/1670598.1670600},
doi = {10.1145/1670598.1670600},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ZobelMP09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlonsoRS08,
author = {Omar Alonso and
Daniel E. Rose and
Benjamin Stewart},
title = {Crowdsourcing for relevance evaluation},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {9--15},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480508},
doi = {10.1145/1480506.1480508},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AlonsoRS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlonsoZ08,
author = {Omar Alonso and
Hugo Zaragoza},
title = {Exploiting semantic annotations in information retrieval: {ESAIR}
'08},
journal = {{SIGIR} Forum},
volume = {42},
number = {1},
pages = {55--58},
year = {2008},
url = {https://doi.org/10.1145/1394251.1394262},
doi = {10.1145/1394251.1394262},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AlonsoZ08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Amer-YahiaHRSW08,
author = {Sihem Amer{-}Yahia and
Djoerd Hiemstra and
Thomas Roelleke and
Divesh Srivastava and
Gerhard Weikum},
title = {DB{\&}IR integration: report on the dagstuhl seminar},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {84--89},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480522},
doi = {10.1145/1480506.1480522},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Amer-YahiaHRSW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AnickN08,
author = {Peter G. Anick and
Hwee Tou Ng},
title = {The {SIGIR} 2008 workshop program},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {45},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480514},
doi = {10.1145/1480506.1480514},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AnickN08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Balog08,
author = {Krisztian Balog},
title = {The {SIGIR} 2008 workshop on future challenges in expertise retrieval
(fCHER)},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {46--52},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480515},
doi = {10.1145/1480506.1480515},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Balog08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Balog08a,
author = {Krisztian Balog},
title = {People search in the enterprise},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {103},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480526},
doi = {10.1145/1480506.1480526},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Balog08a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belkin08,
author = {Nicholas J. Belkin},
title = {Some(what) grand challenges for information retrieval},
journal = {{SIGIR} Forum},
volume = {42},
number = {1},
pages = {47--54},
year = {2008},
url = {https://doi.org/10.1145/1394251.1394261},
doi = {10.1145/1394251.1394261},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Belkin08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BennettCCJ08,
author = {Paul N. Bennett and
Ben Carterette and
Olivier Chapelle and
Thorsten Joachims},
title = {Beyond binary relevance: preferences, diversity, and set-level judgments},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {53--58},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480516},
doi = {10.1145/1480506.1480516},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BennettCCJ08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BlancoS08,
author = {Roi Blanco and
Fabrizio Silvestri},
title = {{ECIR} 2008 Workshop on Efficiency Issues on Information Retrieval},
journal = {{SIGIR} Forum},
volume = {42},
number = {1},
pages = {59--62},
year = {2008},
url = {https://doi.org/10.1145/1394251.1394263},
doi = {10.1145/1394251.1394263},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BlancoS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BoldiSV08,
author = {Paolo Boldi and
Massimo Santini and
Sebastiano Vigna},
title = {A large time-aware web graph},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {33--38},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480511},
doi = {10.1145/1480506.1480511},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BoldiSV08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Carterette08,
author = {Benjamin A. Carterette},
title = {Low-cost and robust evaluation of information retrieval systems},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {104},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480527},
doi = {10.1145/1480506.1480527},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Carterette08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CastilloCD08,
author = {Carlos Castillo and
Kumar Chellapilla and
Brian D. Davison},
title = {Adversarial Information Retrieval on the Web (AIRWeb 2007)},
journal = {{SIGIR} Forum},
volume = {42},
number = {1},
pages = {68--72},
year = {2008},
url = {https://doi.org/10.1145/1394251.1394267},
doi = {10.1145/1394251.1394267},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CastilloCD08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DenoyerG08,
author = {Ludovic Denoyer and
Patrick Gallinari},
title = {Report on the {XML} mining track at {INEX} 2007 categorization and
clustering of {XML} documents},
journal = {{SIGIR} Forum},
volume = {42},
number = {1},
pages = {22--28},
year = {2008},
url = {https://doi.org/10.1145/1394251.1394255},
doi = {10.1145/1394251.1394255},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DenoyerG08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Elsweiler08,
author = {David Elsweiler},
title = {Supporting human memory in personal information management},
journal = {{SIGIR} Forum},
volume = {42},
number = {1},
pages = {75--76},
year = {2008},
url = {https://doi.org/10.1145/1394251.1394270},
doi = {10.1145/1394251.1394270},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Elsweiler08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Esuli08,
author = {Andrea Esuli},
title = {Automatic generation of lexical resources for opinion mining: models,
algorithms and applications},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {105--106},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480528},
doi = {10.1145/1480506.1480528},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Esuli08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Freund08,
author = {Luanne Freund},
title = {Exploiting task-document relations in support of information retrieval
in the workplace},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {107},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480529},
doi = {10.1145/1480506.1480529},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Freund08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FundulakiP08,
author = {Irini Fundulaki and
Neoklis Polyzotis},
title = {Report on the 9th International Workshop on Web Information and Data
Management {(WIDM} 2007)},
journal = {{SIGIR} Forum},
volume = {42},
number = {1},
pages = {36--43},
year = {2008},
url = {https://doi.org/10.1145/1394251.1394258},
doi = {10.1145/1394251.1394258},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/FundulakiP08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HarmanH08,
author = {Donna Harman and
Djoerd Hiemstra},
title = {Saving and accessing the old {IR} literature},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {16--21},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480509},
doi = {10.1145/1480506.1480509},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/HarmanH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JohoUVJR08,
author = {Hideo Joho and
Jana Urban and
Robert Villa and
Joemon M. Jose and
C. J. van Rijsbergen},
title = {{AIR} 2006: First International Workshop on Adaptive Information Retrieval},
journal = {{SIGIR} Forum},
volume = {42},
number = {1},
pages = {63--66},
year = {2008},
url = {https://doi.org/10.1145/1394251.1394265},
doi = {10.1145/1394251.1394265},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/JohoUVJR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KampsGT08,
author = {Jaap Kamps and
Shlomo Geva and
Andrew Trotman},
title = {Report on the {SIGIR} 2008 workshop on focused retrieval},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {59--65},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480517},
doi = {10.1145/1480506.1480517},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KampsGT08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KazaiD08,
author = {Gabriella Kazai and
Antoine Doucet},
title = {Overview of the {INEX} 2007 Book Search track: BookSearch '07},
journal = {{SIGIR} Forum},
volume = {42},
number = {1},
pages = {2--15},
year = {2008},
url = {https://doi.org/10.1145/1394251.1394253},
doi = {10.1145/1394251.1394253},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KazaiD08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KohlerLJKO08,
author = {Joachim K{\"{o}}hler and
Martha A. Larson and
Franciska de Jong and
Wessel Kraaij and
Roeland Ordelman},
title = {Spoken content retrieval: Searching spontaneous conversational speech},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {66--75},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480518},
doi = {10.1145/1480506.1480518},
timestamp = {Fri, 06 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KohlerLJKO08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LarsonFOR08,
author = {Martha A. Larson and
Kate Fernie and
Johan Oomen and
Juan Miguel Cigarr{\'{a}}n Recuero},
title = {Information access to cultural heritage},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {90--95},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480523},
doi = {10.1145/1480506.1480523},
timestamp = {Fri, 06 Dec 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LarsonFOR08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LiC08,
author = {Yaoyong Li and
Hamish Cunningham},
title = {Geometric and quantum methods for information retrieval},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {22--32},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480510},
doi = {10.1145/1480506.1480510},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LiC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LiLZ08,
author = {Hang Li and
Tie{-}Yan Liu and
ChengXiang Zhai},
title = {Learning to rank for information retrieval {(LR4IR} 2008)},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {76--79},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480519},
doi = {10.1145/1480506.1480519},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LiLZ08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LiMNW08,
author = {Hang Li and
Wei{-}Ying Ma and
Jian{-}Yun Nie and
Kam{-}Fai Wong},
title = {The Fourth Asian Information Retrieval Symposium {(AIRS} 08)},
journal = {{SIGIR} Forum},
volume = {42},
number = {1},
pages = {73--74},
year = {2008},
url = {https://doi.org/10.1145/1394251.1394268},
doi = {10.1145/1394251.1394268},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LiMNW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Metzler08,
author = {Donald Metzler},
title = {Beyond bags of words: effectively modeling dependence and features
in information retrieval},
journal = {{SIGIR} Forum},
volume = {42},
number = {1},
pages = {77},
year = {2008},
url = {https://doi.org/10.1145/1394251.1394271},
doi = {10.1145/1394251.1394271},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Metzler08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MurdockL08,
author = {Vanessa Murdock and
Mounia Lalmas},
title = {Workshop on aggregated search},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {80--83},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480520},
doi = {10.1145/1480506.1480520},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/MurdockL08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/OrlandiV08,
author = {Alessio Orlandi and
Sebastiano Vigna},
title = {Compressed collections for simulated crawling},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {39--44},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480512},
doi = {10.1145/1480506.1480512},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/OrlandiV08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/OunisRP08,
author = {Iadh Ounis and
Ian Ruthven and
Vassilis Plachouras},
title = {30\({}^{\mbox{th}}\) European Conference in Information Retrieval
{(ECIR} 2008)},
journal = {{SIGIR} Forum},
volume = {42},
number = {1},
pages = {44--46},
year = {2008},
url = {https://doi.org/10.1145/1394251.1394260},
doi = {10.1145/1394251.1394260},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/OunisRP08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Tait08,
author = {John Tait},
title = {Information retrieval facility symposium in Vienna},
journal = {{SIGIR} Forum},
volume = {42},
number = {1},
pages = {67},
year = {2008},
url = {https://doi.org/10.1145/1394251.1394266},
doi = {10.1145/1394251.1394266},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Tait08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TeevanJC08,
author = {Jaime Teevan and
William Jones and
Robert Capra},
title = {Personal information management {(PIM)} 2008},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {96--103},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480524},
doi = {10.1145/1480506.1480524},
timestamp = {Thu, 22 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/TeevanJC08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Thomas08,
author = {Paul Thomas},
title = {Server characterisation and selection for personal metasearch},
journal = {{SIGIR} Forum},
volume = {42},
number = {2},
pages = {108--109},
year = {2008},
url = {https://doi.org/10.1145/1480506.1480530},
doi = {10.1145/1480506.1480530},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Thomas08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TsikrikaW08,
author = {Theodora Tsikrika and
Thijs Westerveld},
title = {Multimedia retrieval at {INEX} 2007},
journal = {{SIGIR} Forum},
volume = {42},
number = {1},
pages = {16--21},
year = {2008},
url = {https://doi.org/10.1145/1394251.1394254},
doi = {10.1145/1394251.1394254},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/TsikrikaW08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/VardeP08,
author = {Aparna S. Varde and
Jian Pei},
title = {Advances in information and knowledge management},
journal = {{SIGIR} Forum},
volume = {42},
number = {1},
pages = {29--35},
year = {2008},
url = {https://doi.org/10.1145/1394251.1394257},
doi = {10.1145/1394251.1394257},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/VardeP08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AlonsoGB07,
author = {Omar Alonso and
Michael Gertz and
Ricardo A. Baeza{-}Yates},
title = {On the value of temporal information in information retrieval},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {35--41},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328968},
doi = {10.1145/1328964.1328968},
timestamp = {Mon, 07 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AlonsoGB07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BaileyCSV07,
author = {Peter Bailey and
Nick Craswell and
Ian Soboroff and
Arjen P. de Vries},
title = {The {CSIRO} enterprise search test collection},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {42--45},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328969},
doi = {10.1145/1328964.1328969},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BaileyCSV07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CallanACDESZ07,
author = {Jamie Callan and
James Allan and
Charles L. A. Clarke and
Susan T. Dumais and
David A. Evans and
Mark Sanderson and
ChengXiang Zhai},
title = {Meeting of the {MINDS:} an information retrieval research agenda},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {25--34},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328967},
doi = {10.1145/1328964.1328967},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CallanACDESZ07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DenoyerG07,
author = {Ludovic Denoyer and
Patrick Gallinari},
title = {Report on the {XML} mining track at {INEX} 2005 and {INEX} 2006: categorization
and clustering of {XML} documents},
journal = {{SIGIR} Forum},
volume = {41},
number = {1},
pages = {79--90},
year = {2007},
url = {https://doi.org/10.1145/1273221.1273230},
doi = {10.1145/1273221.1273230},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DenoyerG07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fernandez-LunaPH07,
author = {Juan M. Fern{\'{a}}ndez{-}Luna and
Benjamin Piwowarski and
Juan F. Huete},
title = {Information retrieval and applications of graphical models {(IRGM}
2007)},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {89--96},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328980},
doi = {10.1145/1328964.1328980},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Fernandez-LunaPH07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FrommholzL07,
author = {Ingo Frommholz and
Ray R. Larson},
title = {Report on the {INEX} 2006 heterogeneous collection track},
journal = {{SIGIR} Forum},
volume = {41},
number = {1},
pages = {75--78},
year = {2007},
url = {https://doi.org/10.1145/1273221.1273229},
doi = {10.1145/1273221.1273229},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/FrommholzL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Gabrilovich07,
author = {Evgeniy Gabrilovich},
title = {Feature generation for textual information retrieval using world knowledge},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {123},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328988},
doi = {10.1145/1328964.1328988},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Gabrilovich07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HiemstraHJK07,
author = {Djoerd Hiemstra and
Claudia Hauff and
Franciska de Jong and
Wessel Kraaij},
title = {SIGIR's 30th anniversary: an analysis of trends in {IR} research and
the topology of its community},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {18--24},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328966},
doi = {10.1145/1328964.1328966},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/HiemstraHJK07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JoachimsLLZ07,
author = {Thorsten Joachims and
Hang Li and
Tie{-}Yan Liu and
ChengXiang Zhai},
title = {Learning to rank for information retrieval {(LR4IR} 2007)},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {58--62},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328974},
doi = {10.1145/1328964.1328974},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/JoachimsLLZ07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JonesRS07,
author = {Karen Sparck Jones and
Stephen E. Robertson and
Mark Sanderson},
title = {Ambiguous requests: implications for retrieval tests, systems and
theories},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {8--17},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328965},
doi = {10.1145/1328964.1328965},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/JonesRS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JongOOR07,
author = {Franciska de Jong and
Douglas W. Oard and
Roeland Ordelman and
Stephan Raaijmakers},
title = {Searching spontaneous conversational speech},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {104--108},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328982},
doi = {10.1145/1328964.1328982},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/JongOOR07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JunqueiraPSP07,
author = {Flavio Junqueira and
Vassilis Plachouras and
Fabrizio Silvestri and
Ivana Podnar},
title = {Workshop on large-scale distributed systems for information retrieval},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {83--88},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328979},
doi = {10.1145/1328964.1328979},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/JunqueiraPSP07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KantorL07,
author = {Paul B. Kantor and
Jimmy Lin},
title = {Presentation schemes for component analysis in {IR} experiments},
journal = {{SIGIR} Forum},
volume = {41},
number = {1},
pages = {34--39},
year = {2007},
url = {https://doi.org/10.1145/1273221.1273224},
doi = {10.1145/1273221.1273224},
timestamp = {Fri, 27 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/KantorL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KellyL07,
author = {Diane Kelly and
Jimmy Lin},
title = {Overview of the {TREC} 2006 ciQA task},
journal = {{SIGIR} Forum},
volume = {41},
number = {1},
pages = {107--116},
year = {2007},
url = {https://doi.org/10.1145/1273221.1273231},
doi = {10.1145/1273221.1273231},
timestamp = {Fri, 27 Aug 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/KellyL07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LalmasT07,
author = {Mounia Lalmas and
Anastasios Tombros},
title = {Evaluating {XML} retrieval effectiveness at {INEX}},
journal = {{SIGIR} Forum},
volume = {41},
number = {1},
pages = {40--57},
year = {2007},
url = {https://doi.org/10.1145/1273221.1273225},
doi = {10.1145/1273221.1273225},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LalmasT07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LazarinisFT07,
author = {Fotis Lazarinis and
Jes{\'{u}}s Vilares Ferro and
John Tait},
title = {Improving non-English web searching (iNEWS07)},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {72--76},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328977},
doi = {10.1145/1328964.1328977},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LazarinisFT07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Leidner07,
author = {Jochen L. Leidner},
title = {Toponym resolution in text: annotation, evaluation and applications
of spatial grounding},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {124--126},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328989},
doi = {10.1145/1328964.1328989},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Leidner07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lu07,
author = {Jie Lu},
title = {Full-text federated search in peer-to-peer networks},
journal = {{SIGIR} Forum},
volume = {41},
number = {1},
pages = {121},
year = {2007},
url = {https://doi.org/10.1145/1273221.1273233},
doi = {10.1145/1273221.1273233},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Lu07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MalikLT07,
author = {Saadia Malik and
Birger Larsen and
Anastasios Tombros},
title = {Report on the {INEX} 2005 interactive track},
journal = {{SIGIR} Forum},
volume = {41},
number = {1},
pages = {67--74},
year = {2007},
url = {https://doi.org/10.1145/1273221.1273228},
doi = {10.1145/1273221.1273228},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/MalikLT07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Melucci07,
author = {Massimo Melucci},
title = {On rank correlation in information retrieval evaluation},
journal = {{SIGIR} Forum},
volume = {41},
number = {1},
pages = {18--33},
year = {2007},
url = {https://doi.org/10.1145/1273221.1273223},
doi = {10.1145/1273221.1273223},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Melucci07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MoensTV07,
author = {Marie{-}Francine Moens and
Tinne Tuytelaars and
Arjen P. de Vries},
title = {7\({}^{\mbox{th}}\) Dutch-Belgian Information Retrieval Workshop March
28--29, 2007 Katholieke Universiteit Leuven, Belgium},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {121--122},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328986},
doi = {10.1145/1328964.1328986},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/MoensTV07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Mothe07,
author = {Josiane Mothe},
title = {The {SIGIR} 2007 workshop program},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {55--57},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328973},
doi = {10.1145/1328964.1328973},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Mothe07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Murdock07,
author = {Vanessa Murdock},
title = {Aspects of sentence retrieval},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {127},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328990},
doi = {10.1145/1328964.1328990},
timestamp = {Mon, 26 Apr 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Murdock07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MurrayT07,
author = {G. Craig Murray and
Jaime Teevan},
title = {Query log analysis: social and technological challenges},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {112--120},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328985},
doi = {10.1145/1328964.1328985},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/MurrayT07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PharoT07,
author = {Nils Pharo and
Andrew Trotman},
title = {The use case track at {INEX} 2006},
journal = {{SIGIR} Forum},
volume = {41},
number = {1},
pages = {64--66},
year = {2007},
url = {https://doi.org/10.1145/1273221.1273227},
doi = {10.1145/1273221.1273227},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/PharoT07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Popescu07,
author = {Adrian Popescu},
title = {The {RIAO} 2007 conference: a personal view},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {46--54},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328971},
doi = {10.1145/1328964.1328971},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Popescu07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/RoddenRW07,
author = {Kerry Rodden and
Ian Ruthven and
Ryen W. White},
title = {Workshop on web information seeking and interaction},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {63--67},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328975},
doi = {10.1145/1328964.1328975},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/RoddenRW07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SandersonSK07,
author = {Mark Sanderson and
Tetsuya Sakai and
Noriko Kando},
title = {{EVIA} 2007: the First International Workshop on Evaluating Information
Access},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {109--111},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328984},
doi = {10.1145/1328964.1328984},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SandersonSK07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ShenTZ07,
author = {Xuehua Shen and
Bin Tan and
ChengXiang Zhai},
title = {Privacy protection in personalized search},
journal = {{SIGIR} Forum},
volume = {41},
number = {1},
pages = {4--17},
year = {2007},
url = {https://doi.org/10.1145/1273221.1273222},
doi = {10.1145/1273221.1273222},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ShenTZ07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Si07,
author = {Luo Si},
title = {Federated search of text search engines in uncooperative environments},
journal = {{SIGIR} Forum},
volume = {41},
number = {1},
pages = {120},
year = {2007},
url = {https://doi.org/10.1145/1273221.1273232},
doi = {10.1145/1273221.1273232},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Si07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SteinKS07,
author = {Benno Stein and
Moshe Koppel and
Efstathios Stamatatos},
title = {Plagiarism analysis, authorship identification, and near-duplicate
detection PAN'07},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {68--71},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328976},
doi = {10.1145/1328964.1328976},
timestamp = {Wed, 30 Oct 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SteinKS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TrotmanGK07,
author = {Andrew Trotman and
Shlomo Geva and
Jaap Kamps},
title = {Report on the {SIGIR} 2007 workshop on focused retrieval},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {97--103},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328981},
doi = {10.1145/1328964.1328981},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/TrotmanGK07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WesterveldZ07,
author = {Thijs Westerveld and
Roelof van Zwol},
title = {Multimedia retrieval at {INEX} 2006},
journal = {{SIGIR} Forum},
volume = {41},
number = {1},
pages = {58--63},
year = {2007},
url = {https://doi.org/10.1145/1273221.1273226},
doi = {10.1145/1273221.1273226},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/WesterveldZ07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZwolRSM07,
author = {Roelof van Zwol and
Stefan M. R{\"{u}}ger and
Mark Sanderson and
Yosi Mass},
title = {Multimedia information retrieval: "new challenges in audio visual
search"},
journal = {{SIGIR} Forum},
volume = {41},
number = {2},
pages = {77--82},
year = {2007},
url = {https://doi.org/10.1145/1328964.1328978},
doi = {10.1145/1328964.1328978},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ZwolRSM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AnickL06,
author = {Peter G. Anick and
Mounia Lalmas},
title = {The {SIGIR} 2006 workshop program},
journal = {{SIGIR} Forum},
volume = {40},
number = {2},
pages = {25--26},
year = {2006},
url = {https://doi.org/10.1145/1189702.1189705},
doi = {10.1145/1189702.1189705},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/AnickL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Azzopardi06,
author = {Leif Azzopardi},
title = {Incorporating context within the language modeling approach for \emph{ad
hoc} information retrieval},
journal = {{SIGIR} Forum},
volume = {40},
number = {1},
pages = {70},
year = {2006},
url = {https://doi.org/10.1145/1147197.1147211},
doi = {10.1145/1147197.1147211},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Azzopardi06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BonifatiL06,
author = {Angela Bonifati and
Dongwon Lee},
title = {Report on the 7\({}^{\mbox{th}}\) {ACM} International Workshop on
Web Information and Data Management {(WIDM} 2005)},
journal = {{SIGIR} Forum},
volume = {40},
number = {1},
pages = {31--33},
year = {2006},
url = {https://doi.org/10.1145/1147197.1147201},
doi = {10.1145/1147197.1147201},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BonifatiL06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CastilloDBBLSV06,
author = {Carlos Castillo and
Debora Donato and
Luca Becchetti and
Paolo Boldi and
Stefano Leonardi and
Massimo Santini and
Sebastiano Vigna},
title = {A reference collection for web spam},
journal = {{SIGIR} Forum},
volume = {40},
number = {2},
pages = {11--24},
year = {2006},
url = {https://doi.org/10.1145/1189702.1189703},
doi = {10.1145/1189702.1189703},
timestamp = {Tue, 27 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CastilloDBBLSV06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CloughSR06,
author = {Paul D. Clough and
Mark Sanderson and
Norman Reid},
title = {The Eurovision St Andrews collection of photographs},
journal = {{SIGIR} Forum},
volume = {40},
number = {1},
pages = {21--30},
year = {2006},
url = {https://doi.org/10.1145/1147197.1147199},
doi = {10.1145/1147197.1147199},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CloughSR06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CrestaniP06,
author = {Fabio Crestani and
Gabriella Pasi},
title = {Report on the first 5 years of the track on information access and
retrieval of the {ACM} Symposium on Applied Computing},
journal = {{SIGIR} Forum},
volume = {40},
number = {2},
pages = {66--69},
year = {2006},
url = {https://doi.org/10.1145/1189702.1189714},
doi = {10.1145/1189702.1189714},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CrestaniP06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Crouch06,
author = {Carolyn J. Crouch},
title = {Relevance feedback at {INEX} 2005},
journal = {{SIGIR} Forum},
volume = {40},
number = {1},
pages = {58--59},
year = {2006},
url = {https://doi.org/10.1145/1147197.1147208},
doi = {10.1145/1147197.1147208},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Crouch06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DavisonNC06,
author = {Brian D. Davison and
Marc Najork and
Tim Converse},
title = {Adversarial information retrieval on the web (AIRWeb 2006)},
journal = {{SIGIR} Forum},
volume = {40},
number = {2},
pages = {27--30},
year = {2006},
url = {https://doi.org/10.1145/1189702.1189706},
doi = {10.1145/1189702.1189706},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DavisonNC06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DenoyerG06,
author = {Ludovic Denoyer and
Patrick Gallinari},
title = {The Wikipedia {XML} corpus},
journal = {{SIGIR} Forum},
volume = {40},
number = {1},
pages = {64--69},
year = {2006},
url = {https://doi.org/10.1145/1147197.1147210},
doi = {10.1145/1147197.1147210},
timestamp = {Thu, 28 Nov 2019 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DenoyerG06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Doucet06,
author = {Antoine Doucet},
title = {Advanced document description, a sequential approach},
journal = {{SIGIR} Forum},
volume = {40},
number = {1},
pages = {71--72},
year = {2006},
url = {https://doi.org/10.1145/1147197.1147212},
doi = {10.1145/1147197.1147212},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Doucet06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GevaW06,
author = {Shlomo Geva and
Alan Woodley},
title = {The {NLP} task at {INEX} 2005},
journal = {{SIGIR} Forum},
volume = {40},
number = {1},
pages = {60--63},
year = {2006},
url = {https://doi.org/10.1145/1147197.1147209},
doi = {10.1145/1147197.1147209},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/GevaW06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GeyKLP06,
author = {Fredric C. Gey and
Noriko Kando and
Chin{-}Yew Lin and
Carol Peters},
title = {New directions in multilingual information access},
journal = {{SIGIR} Forum},
volume = {40},
number = {2},
pages = {31--39},
year = {2006},
url = {https://doi.org/10.1145/1189702.1189707},
doi = {10.1145/1189702.1189707},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/GeyKLP06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jones06,
author = {Karen Sparck Jones},
title = {What's the value of {TREC:} is there a gap to jump or a chasm to bridge?},
journal = {{SIGIR} Forum},
volume = {40},
number = {1},
pages = {10--20},
year = {2006},
url = {https://doi.org/10.1145/1147197.1147198},
doi = {10.1145/1147197.1147198},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Jones06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JonesP06,
author = {Christopher B. Jones and
Ross Purves},
title = {GIR'05 2005 {ACM} workshop on geographical information retrieval},
journal = {{SIGIR} Forum},
volume = {40},
number = {1},
pages = {34--37},
year = {2006},
url = {https://doi.org/10.1145/1147197.1147202},
doi = {10.1145/1147197.1147202},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/JonesP06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KraaijJ06,
author = {Wessel Kraaij and
Franciska de Jong},
title = {The sixth Dutch-Belgian Information Retrieval workshop: {(DIR} 2006)},
journal = {{SIGIR} Forum},
volume = {40},
number = {2},
pages = {70--72},
year = {2006},
url = {https://doi.org/10.1145/1189702.1189715},
doi = {10.1145/1189702.1189715},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KraaijJ06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LalmasK06,
author = {Mounia Lalmas and
Gabriella Kazai},
title = {Report on the ad-hoc track of the {INEX} 2005 workshop},
journal = {{SIGIR} Forum},
volume = {40},
number = {1},
pages = {49--57},
year = {2006},
url = {https://doi.org/10.1145/1147197.1147207},
doi = {10.1145/1147197.1147207},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LalmasK06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/NottelmannACN06,
author = {Henrik Nottelmann and
Karl Aberer and
Jamie Callan and
Wolfgang Nejdl},
title = {The {CIKM} 2005 workshop on information retrieval in peer-to-peer
networks},
journal = {{SIGIR} Forum},
volume = {40},
number = {1},
pages = {38--40},
year = {2006},
url = {https://doi.org/10.1145/1147197.1147203},
doi = {10.1145/1147197.1147203},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/NottelmannACN06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PurvesJ06,
author = {Ross Purves and
Christopher B. Jones},
title = {Workshop on geographic information retrieval held at SIGIR'06},
journal = {{SIGIR} Forum},
volume = {40},
number = {2},
pages = {40--41},
year = {2006},
url = {https://doi.org/10.1145/1189702.1189708},
doi = {10.1145/1189702.1189708},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/PurvesJ06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Siddiqui06,
author = {Tanveer J. Siddiqui},
title = {Intelligent techniques for effective information retrieval: (a conceptual
graph based approach)},
journal = {{SIGIR} Forum},
volume = {40},
number = {2},
pages = {73--74},
year = {2006},
url = {https://doi.org/10.1145/1189702.1189717},
doi = {10.1145/1189702.1189717},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Siddiqui06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TrotmanG06,
author = {Andrew Trotman and
Shlomo Geva},
title = {Report on the {SIGIR} 2006 workshop on {XML} element retrieval methodology},
journal = {{SIGIR} Forum},
volume = {40},
number = {2},
pages = {42--48},
year = {2006},
url = {https://doi.org/10.1145/1189702.1189709},
doi = {10.1145/1189702.1189709},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/TrotmanG06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/UzunerAK06,
author = {{\"{O}}zlem Uzuner and
Shlomo Argamon and
Jussi Karlgren},
title = {Stylistics for text retrieval in practice: {SIGIR} 2006 workshop,
Seattle, August 10, 2006},
journal = {{SIGIR} Forum},
volume = {40},
number = {2},
pages = {49--51},
year = {2006},
url = {https://doi.org/10.1145/1189702.1189710},
doi = {10.1145/1189702.1189710},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/UzunerAK06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Voorhees06,
author = {Ellen M. Voorhees},
title = {The {TREC} 2005 robust track},
journal = {{SIGIR} Forum},
volume = {40},
number = {1},
pages = {41--48},
year = {2006},
url = {https://doi.org/10.1145/1147197.1147205},
doi = {10.1145/1147197.1147205},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Voorhees06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WhiteMM06,
author = {Ryen W. White and
Gheorghe Muresan and
Gary Marchionini},
title = {Report on {ACM} {SIGIR} 2006 workshop on evaluating exploratory search
systems},
journal = {{SIGIR} Forum},
volume = {40},
number = {2},
pages = {52--60},
year = {2006},
url = {https://doi.org/10.1145/1189702.1189711},
doi = {10.1145/1189702.1189711},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/WhiteMM06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/YeeBB06,
author = {Wai Gen Yee and
Michel Beigbeder and
Wray L. Buntine},
title = {{SIGIR06} workshop report: Open Source Information Retrieval systems
{(OSIR06)}},
journal = {{SIGIR} Forum},
volume = {40},
number = {2},
pages = {61--65},
year = {2006},
url = {https://doi.org/10.1145/1189702.1189712},
doi = {10.1145/1189702.1189712},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/YeeBB06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ArgamonKS05,
author = {Shlomo Argamon and
Jussi Karlgren and
James G. Shanahan},
title = {Future short term goals of research in computational analysis of stylistics
in text},
journal = {{SIGIR} Forum},
volume = {39},
number = {2},
pages = {17--18},
year = {2005},
url = {https://doi.org/10.1145/1113343.1113347},
doi = {10.1145/1113343.1113347},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ArgamonKS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BaragliaLS05,
author = {Ranieri Baraglia and
Domenico Laforenza and
Fabrizio Silvestri},
title = {{SIGIR} workshop report: the {SIGIR} heterogeneous and distributed
information retrieval workshop},
journal = {{SIGIR} Forum},
volume = {39},
number = {2},
pages = {19--24},
year = {2005},
url = {https://doi.org/10.1145/1113343.1113348},
doi = {10.1145/1113343.1113348},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BaragliaLS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Browne05,
author = {Paul Browne},
title = {Video information retrieval using objects and ostensive relevance
feedback},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {54},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067286},
doi = {10.1145/1067268.1067286},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Browne05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Buntine05,
author = {Wray L. Buntine},
title = {Open source search: a data mining platform},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {4--10},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067270},
doi = {10.1145/1067268.1067270},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Buntine05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CarmelYS05,
author = {David Carmel and
Elad Yom{-}Tov and
Ian Soboroff},
title = {{SIGIR} workshop report: predicting query difficulty - methods and
applications},
journal = {{SIGIR} Forum},
volume = {39},
number = {2},
pages = {25--28},
year = {2005},
url = {https://doi.org/10.1145/1113343.1113349},
doi = {10.1145/1113343.1113349},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CarmelYS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Castillo05,
author = {Carlos Castillo},
title = {Effective web crawling},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {55--56},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067287},
doi = {10.1145/1067268.1067287},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Castillo05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Chau05,
author = {Michael Chau},
title = {Searching and mining the web for personalized and specialized information},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {57},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067288},
doi = {10.1145/1067268.1067288},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Chau05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ChenS05,
author = {Shu{-}Ching Chen and
Mei{-}Ling Shyu},
title = {The second {ACM} international workshop on multimedia databases {(MMDB}
2004) held at {ACM} {CIKM} 2004},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {26--30},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067276},
doi = {10.1145/1067268.1067276},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ChenS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ClarkeCS05,
author = {Charles L. A. Clarke and
Nick Craswell and
Ian Soboroff},
title = {The {TREC} terabyte retrieval track},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {25},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067274},
doi = {10.1145/1067268.1067274},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ClarkeCS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Crouch05,
author = {Carolyn J. Crouch},
title = {Relevance feedback at the {INEX} 2004 workshop},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {41--42},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067282},
doi = {10.1145/1067268.1067282},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Crouch05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DominichON05,
author = {S{\'{a}}ndor Dominich and
Iadh Ounis and
Jian{-}Yun Nie},
title = {{ACM} {SIGIR} workshop on mathematical/formal methods in information
retrieval {MF/IR} 2005},
journal = {{SIGIR} Forum},
volume = {39},
number = {2},
pages = {29--30},
year = {2005},
url = {https://doi.org/10.1145/1113343.1113350},
doi = {10.1145/1113343.1113350},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DominichON05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Doraisamy05,
author = {Shyamala Doraisamy},
title = {Polyphonic music retrieval: the n-gram approach},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {58},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067289},
doi = {10.1145/1067268.1067289},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Doraisamy05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GevaS05,
author = {Shlomo Geva and
Tony Sahama},
title = {The {NLP} task at {INEX} 2004},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {50--53},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067284},
doi = {10.1145/1067268.1067284},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/GevaS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Halttunen05,
author = {Kai Halttunen},
title = {Two information retrieval learning environments: their design and
evaluation},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {59--60},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067290},
doi = {10.1145/1067268.1067290},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Halttunen05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hersh05,
author = {William R. Hersh},
title = {Report on the {TREC} 2004 genomics track},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {21--24},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067273},
doi = {10.1145/1067268.1067273},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Hersh05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/IngwersenJ05,
author = {Peter Ingwersen and
Kalervo J{\"{a}}rvelin},
title = {Information retrieval in context: IRiX},
journal = {{SIGIR} Forum},
volume = {39},
number = {2},
pages = {31--39},
year = {2005},
url = {https://doi.org/10.1145/1113343.1113351},
doi = {10.1145/1113343.1113351},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/IngwersenJ05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kraaij05,
author = {Wessel Kraaij},
title = {Variations on language modeling for information retrieval},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {61},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067291},
doi = {10.1145/1067268.1067291},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Kraaij05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LaenderL05,
author = {Alberto H. F. Laender and
Dongwon Lee},
title = {Report on the 6th {ACM} international workshop on web information
and data management {(WIDM} 2004) held at {CIKM} 2004},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {31--33},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067277},
doi = {10.1145/1067268.1067277},
timestamp = {Tue, 29 Dec 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LaenderL05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LosadaF05,
author = {David E. Losada and
Juan M. Fern{\'{a}}ndez{-}Luna},
title = {Report on the 27th European conference on information retrieval research
{(ECIR} 2005)},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {37--40},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067280},
doi = {10.1145/1067268.1067280},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LosadaF05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ManmathaRH05,
author = {Raghavan Manmatha and
Stefan M. R{\"{u}}ger and
Alexander G. Hauptmann},
title = {Multimedia information retrieval: workshop report},
journal = {{SIGIR} Forum},
volume = {39},
number = {2},
pages = {40--41},
year = {2005},
url = {https://doi.org/10.1145/1113343.1113352},
doi = {10.1145/1113343.1113352},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ManmathaRH05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Martinet05,
author = {Jean Martinet},
title = {A relational vector-space model of information retrieval adapted to
images},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {62},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067292},
doi = {10.1145/1067268.1067292},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Martinet05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MoffatZ05,
author = {Alistair Moffat and
Justin Zobel},
title = {Recommended reading for {IR} research students},
journal = {{SIGIR} Forum},
volume = {39},
number = {2},
pages = {3--14},
year = {2005},
url = {https://doi.org/10.1145/1113343.1113344},
doi = {10.1145/1113343.1113344},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/MoffatZ05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Oard05,
author = {Douglas W. Oard},
title = {The {SIGIR} 2005 workshop program},
journal = {{SIGIR} Forum},
volume = {39},
number = {2},
pages = {15--16},
year = {2005},
url = {https://doi.org/10.1145/1113343.1113346},
doi = {10.1145/1113343.1113346},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Oard05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Petratos05,
author = {Panagiotis Petratos},
title = {A heuristic information retrieval study: an investigation of methods
for enhanced searching of distributed data objects exploiting bidirectional
relevance feedback},
journal = {{SIGIR} Forum},
volume = {39},
number = {2},
pages = {58},
year = {2005},
url = {https://doi.org/10.1145/1113343.1113359},
doi = {10.1145/1113343.1113359},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Petratos05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Schneider05,
author = {Jesper W. Schneider},
title = {Verification of bibliometric methods' applicability for thesaurus
construction},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {63--64},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067293},
doi = {10.1145/1067268.1067293},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Schneider05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Seki05,
author = {Yohei Seki},
title = {Automatic summarization focusing on document genre and text structure},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {65--67},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067294},
doi = {10.1145/1067268.1067294},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Seki05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Stokoe05,
author = {Christopher Stokoe},
title = {Automated word sense disambiguation for web information retrieval},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {68},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067295},
doi = {10.1145/1067268.1067295},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Stokoe05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TombrosML05,
author = {Anastasios Tombros and
Saadia Malik and
Birger Larsen},
title = {Report on the {INEX} 2004 interactive track},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {43--49},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067283},
doi = {10.1145/1067268.1067283},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/TombrosML05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TrotmanL05,
author = {Andrew Trotman and
Mounia Lalmas},
title = {Report on the {INEX} 2005 workshop on element retrieval methodology},
journal = {{SIGIR} Forum},
volume = {39},
number = {2},
pages = {46--51},
year = {2005},
url = {https://doi.org/10.1145/1113343.1113355},
doi = {10.1145/1113343.1113355},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/TrotmanL05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/VechtomovaJD05,
author = {Olga Vechtomova and
Rosie Jones and
Ga{\"{e}}l Dias},
title = {Report on the {ACM} International Workshop on Methodologies and Evaluation
of Lexical Cohesion Techniques in Real-World Applications {(ELECTRA}
2005) held at {SIGIR} 2005},
journal = {{SIGIR} Forum},
volume = {39},
number = {2},
pages = {42--45},
year = {2005},
url = {https://doi.org/10.1145/1113343.1113353},
doi = {10.1145/1113343.1113353},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/VechtomovaJD05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Voorhees05,
author = {Ellen M. Voorhees},
title = {The {TREC} robust retrieval track},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {11--20},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067272},
doi = {10.1145/1067268.1067272},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Voorhees05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Westerveld05,
author = {Thijs Westerveld},
title = {Using generative probabilistic models for multimedia retrieval},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {69},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067296},
doi = {10.1145/1067268.1067296},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Westerveld05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WesterveldVJ05,
author = {Thijs Westerveld and
Arjen P. de Vries and
Franciska M. G. de Jong},
title = {Workshop on the evaluation of multimedia retrieval},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {34--36},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067279},
doi = {10.1145/1067268.1067279},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/WesterveldVJ05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/White05,
author = {Ryen W. White},
title = {Implicit feedback for interactive information retrieval},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {70},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067297},
doi = {10.1145/1067268.1067297},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/White05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WhiteKB05,
author = {Ryen W. White and
Bill Kules and
Benjamin B. Bederson},
title = {Exploratory search interfaces: categorization, clustering and beyond:
report on the {XSI} 2005 workshop at the Human-Computer Interaction
Laboratory, University of Maryland},
journal = {{SIGIR} Forum},
volume = {39},
number = {2},
pages = {52--56},
year = {2005},
url = {https://doi.org/10.1145/1113343.1113356},
doi = {10.1145/1113343.1113356},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/WhiteKB05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Ye05,
author = {Jiamin Ye},
title = {Aggregated feature video retrieval for {MPEG-7} via clustering},
journal = {{SIGIR} Forum},
volume = {39},
number = {1},
pages = {71},
year = {2005},
url = {https://doi.org/10.1145/1067268.1067298},
doi = {10.1145/1067268.1067298},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Ye05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zhang05,
author = {Yi Zhang},
title = {Bayesian graphical models for adaptive filtering},
journal = {{SIGIR} Forum},
volume = {39},
number = {2},
pages = {57},
year = {2005},
url = {https://doi.org/10.1145/1113343.1113358},
doi = {10.1145/1113343.1113358},
timestamp = {Sun, 02 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Zhang05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Baeza-YatesMRV04,
author = {Ricardo A. Baeza{-}Yates and
Yo{\"{e}}lle S. Maarek and
Thomas R{\"{o}}lleke and
Arjen P. de Vries},
title = {Third edition of the "XML and information retrieval" workshop first
workshop on integration of {IR} and {DB} {(WIRD)} jointly held at
SIGIR'2004, Sheffield, UK, July 29\({}^{\mbox{th}}\), 2004},
journal = {{SIGIR} Forum},
volume = {38},
number = {2},
pages = {24--30},
year = {2004},
url = {https://doi.org/10.1145/1041394.1041400},
doi = {10.1145/1041394.1041400},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Baeza-YatesMRV04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BrownHV04,
author = {Eric W. Brown and
William R. Hersh and
Alfonso Valencia},
title = {{SIGIR} 2003 workshop on text analysis and search for bioinformatics},
journal = {{SIGIR} Forum},
volume = {38},
number = {2},
pages = {31--36},
year = {2004},
url = {https://doi.org/10.1145/1041394.1041401},
doi = {10.1145/1041394.1041401},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BrownHV04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CallanF04,
author = {Jamie Callan and
Norbert Fuhr},
title = {The {SIGIR} peer-to-peer information retrieval workshop},
journal = {{SIGIR} Forum},
volume = {38},
number = {2},
pages = {37--40},
year = {2004},
url = {https://doi.org/10.1145/1041394.1041402},
doi = {10.1145/1041394.1041402},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CallanF04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Can04,
author = {Fazli Can},
title = {Review of "Mining the Web: discovering knowledge from hypertext data"
by Soumen Chakrabati. Morgan Kaufman 2003},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {73--74},
year = {2004},
url = {https://doi.org/10.1145/986278.986294},
doi = {10.1145/986278.986294},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Can04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ChenS04,
author = {Shu{-}Ching Chen and
Mei{-}Ling Shyu},
title = {Workshop report: the first {ACM} international workshop on multimedia
databases {(MMDB} 2003) at {ACM} {CIKM} 2003},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {55--60},
year = {2004},
url = {https://doi.org/10.1145/986278.986289},
doi = {10.1145/986278.986289},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ChenS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ChiangLL04,
author = {Roger H. L. Chiang and
Alberto H. F. Laender and
Ee{-}Peng Lim},
title = {Report on the fifth {ACM} international workshop on Web information
and data management {(WIDM} 2003)},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {65--68},
year = {2004},
url = {https://doi.org/10.1145/986278.986291},
doi = {10.1145/986278.986291},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ChiangLL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Diekema04,
author = {Anne Diekema},
title = {Translation events in cross-language information retrieval},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {75},
year = {2004},
url = {https://doi.org/10.1145/986278.986296},
doi = {10.1145/986278.986296},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Diekema04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/EguchiOIKK04,
author = {Koji Eguchi and
Keizo Oyama and
Emi Ishida and
Noriko Kando and
Kazuko Kuriyama},
title = {An evaluation of the Web retrieval task at the third {NTCIR} workshop},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {39--45},
year = {2004},
url = {https://doi.org/10.1145/986278.986285},
doi = {10.1145/986278.986285},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/EguchiOIKK04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FuhrL04,
author = {Norbert Fuhr and
Mounia Lalmas},
title = {Report on the {INEX} 2003 workshop},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {46--51},
year = {2004},
url = {https://doi.org/10.1145/986278.986287},
doi = {10.1145/986278.986287},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/FuhrL04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FukumotoKM04,
author = {Jun{-}ichi Fukumoto and
Tsuneaki Kato and
Fumito Masui},
title = {An evaluation of question answering challenge {(QAC-1)} at the {NTCIR}
workshop 3},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {25--28},
year = {2004},
url = {https://doi.org/10.1145/986278.986283},
doi = {10.1145/986278.986283},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/FukumotoKM04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GaizauskasHG04,
author = {Robert J. Gaizauskas and
Mark Hepple and
Mark A. Greenwood},
title = {Information retrieval for question answering a {SIGIR} 2004 workshop},
journal = {{SIGIR} Forum},
volume = {38},
number = {2},
pages = {41--44},
year = {2004},
url = {https://doi.org/10.1145/1041394.1041403},
doi = {10.1145/1041394.1041403},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/GaizauskasHG04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HarmanB04,
author = {Donna Harman and
Chris Buckley},
title = {{SIGIR} 2004 workshop: {RIA} and "where can {IR} go from here?"},
journal = {{SIGIR} Forum},
volume = {38},
number = {2},
pages = {45--49},
year = {2004},
url = {https://doi.org/10.1145/1041394.1041404},
doi = {10.1145/1041394.1041404},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/HarmanB04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hedlund04,
author = {Turid Hedlund},
title = {Dictionary-based cross-language information retrieval: principles,
system design and evaluation},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {76},
year = {2004},
url = {https://doi.org/10.1145/986278.986297},
doi = {10.1145/986278.986297},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Hedlund04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hersh04,
author = {William R. Hersh},
title = {Report on {TREC} 2003 genomics track first-year results and future
plans},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {69--72},
year = {2004},
url = {https://doi.org/10.1145/986278.986292},
doi = {10.1145/986278.986292},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Hersh04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/IngwersenB04,
author = {Peter Ingwersen and
Nicholas J. Belkin},
title = {Information retrieval in context - IRiX: workshop at {SIGIR} 2004
- Sheffield},
journal = {{SIGIR} Forum},
volume = {38},
number = {2},
pages = {50--52},
year = {2004},
url = {https://doi.org/10.1145/1041394.1041405},
doi = {10.1145/1041394.1041405},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/IngwersenB04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/IwayamaFKT04,
author = {Makoto Iwayama and
Atsushi Fujii and
Noriko Kando and
Akihiko Takano},
title = {Report on the patent retrieval task at {NTCIR} workshop 3},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {22--24},
year = {2004},
url = {https://doi.org/10.1145/986278.986282},
doi = {10.1145/986278.986282},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/IwayamaFKT04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JohoS04,
author = {Hideo Joho and
Mark Sanderson},
title = {The {SPIRIT} collection: an overview of a large web collection},
journal = {{SIGIR} Forum},
volume = {38},
number = {2},
pages = {57--61},
year = {2004},
url = {https://doi.org/10.1145/1041394.1041395},
doi = {10.1145/1041394.1041395},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/JohoS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jones04,
author = {Karen Sparck Jones},
title = {What's new about the Semantic Web?: some questions},
journal = {{SIGIR} Forum},
volume = {38},
number = {2},
pages = {18--23},
year = {2004},
url = {https://doi.org/10.1145/1041394.1041398},
doi = {10.1145/1041394.1041398},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Jones04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KandoA04,
author = {Noriko Kando and
Jun Adachi},
title = {Report from the {NTCIR} workshop 3},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {10--16},
year = {2004},
url = {https://doi.org/10.1145/986278.986280},
doi = {10.1145/986278.986280},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KandoA04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kelly04,
author = {Diane Kelly},
title = {Understanding implicit feedback and document preference: a naturalistic
user study},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {77},
year = {2004},
url = {https://doi.org/10.1145/986278.986298},
doi = {10.1145/986278.986298},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Kelly04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KishidaCLCKKME04,
author = {Kazuaki Kishida and
Kuang{-}hua Chen and
Sukhoon Lee and
Hsin{-}Hsi Chen and
Noriko Kando and
Kazuko Kuriyama and
Sung{-}Hyon Myaeng and
Koji Eguchi},
title = {Cross-lingual information retrieval {(CLIR)} task at the {NTCIR} workshop
3},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {17--20},
year = {2004},
url = {https://doi.org/10.1145/986278.986281},
doi = {10.1145/986278.986281},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KishidaCLCKKME04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kruschwitz04,
author = {Udo Kruschwitz},
title = {Exploiting markup structure for intelligent search},
journal = {{SIGIR} Forum},
volume = {38},
number = {2},
pages = {62},
year = {2004},
url = {https://doi.org/10.1145/1041394.1041408},
doi = {10.1145/1041394.1041408},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Kruschwitz04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Nanas04,
author = {Nikolaos Nanas},
title = {Towards Nootropia: a non-linear approach to adaptive document filtering},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {78},
year = {2004},
url = {https://doi.org/10.1145/986278.986299},
doi = {10.1145/986278.986299},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Nanas04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/OHara04,
author = {Kieron O'Hara},
title = {Ontologies and technologies: knowledge representation or misrepresentation},
journal = {{SIGIR} Forum},
volume = {38},
number = {2},
pages = {11--17},
year = {2004},
url = {https://doi.org/10.1145/1041394.1041397},
doi = {10.1145/1041394.1041397},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/OHara04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/OkumuraFNH04,
author = {Manabu Okumura and
Takahiro Fukusima and
Hidetsugu Nanba and
Tsutomu Hirao},
title = {Text Summarization Challenge 2 text summarization evaluation at {NTCIR}
workshop 3},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {29--38},
year = {2004},
url = {https://doi.org/10.1145/986278.986284},
doi = {10.1145/986278.986284},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/OkumuraFNH04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Pomerantz04,
author = {Jeffrey Pomerantz},
title = {Question taxonomies for digital reference},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {79},
year = {2004},
url = {https://doi.org/10.1145/986278.986300},
doi = {10.1145/986278.986300},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Pomerantz04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PurvesJ04,
author = {Ross Purves and
Christopher B. Jones},
title = {Workshop on geographic information retrieval, {SIGIR} 2004},
journal = {{SIGIR} Forum},
volume = {38},
number = {2},
pages = {53--56},
year = {2004},
url = {https://doi.org/10.1145/1041394.1041406},
doi = {10.1145/1041394.1041406},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/PurvesJ04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/RizziS04,
author = {Stefano Rizzi and
Il{-}Yeol Song},
title = {Report on the {ACM} sixth international workshop on data warehousing
and {OLAP} {(DOLAP} 2003)},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {61--64},
year = {2004},
url = {https://doi.org/10.1145/986278.986290},
doi = {10.1145/986278.986290},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/RizziS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Shiri04,
author = {Ali Asghar Shiri},
title = {End-user interaction with thesaurus-enhanced search interfaces: an
evaluation of search term selection for query expansion},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {80},
year = {2004},
url = {https://doi.org/10.1145/986278.986301},
doi = {10.1145/986278.986301},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Shiri04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Vries04,
author = {Arjen P. de Vries},
title = {The 4th Dutch-Belgium information retrieval workshop},
journal = {{SIGIR} Forum},
volume = {38},
number = {1},
pages = {52--54},
year = {2004},
url = {https://doi.org/10.1145/986278.986288},
doi = {10.1145/986278.986288},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Vries04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
author = {James Allan and
Jay Aslam and
Nicholas J. Belkin and
Chris Buckley and
James P. Callan and
W. Bruce Croft and
Susan T. Dumais and
Norbert Fuhr and
Donna Harman and
David J. Harper and
Djoerd Hiemstra and
Thomas Hofmann and
Eduard H. Hovy and
Wessel Kraaij and
John D. Lafferty and
Victor Lavrenko and
David D. Lewis and
Liz Liddy and
R. Manmatha and
Andrew McCallum and
Jay M. Ponte and
John M. Prager and
Dragomir R. Radev and
Philip Resnik and
Stephen E. Robertson and
Ronald Rosenfeld and
Salim Roukos and
Mark Sanderson and
Richard M. Schwartz and
Amit Singhal and
Alan F. Smeaton and
Howard R. Turtle and
Ellen M. Voorhees and
Ralph M. Weischedel and
Jinxi Xu and
ChengXiang Zhai},
title = {Challenges in information retrieval and language modeling: report
of a workshop held at the center for intelligent information retrieval,
University of Massachusetts Amherst, September 2002},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {31--47},
year = {2003},
url = {https://doi.org/10.1145/945546.945549},
doi = {10.1145/945546.945549},
timestamp = {Sun, 22 Oct 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BauerL03,
author = {Travis Bauer and
David B. Leake},
title = {Detecting context-differentiating terms using competitive learning},
journal = {{SIGIR} Forum},
volume = {37},
number = {2},
pages = {4--17},
year = {2003},
url = {https://doi.org/10.1145/959258.959259},
doi = {10.1145/959258.959259},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BauerL03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CaidiK03,
author = {Nadia Caidi and
Anita Komlodi},
title = {Digital libraries across cultures: design and usability issues outcomes
of the "cross-cultural usability for digital libraries" workshop at
{JCDL} '03},
journal = {{SIGIR} Forum},
volume = {37},
number = {2},
pages = {62--64},
year = {2003},
url = {https://doi.org/10.1145/959258.959270},
doi = {10.1145/959258.959270},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CaidiK03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CallanCS03,
author = {Jamie Callan and
Fabio Crestani and
Mark Sanderson},
title = {{SIGIR} 2003 workshop on distributed information retrieval},
journal = {{SIGIR} Forum},
volume = {37},
number = {2},
pages = {33--37},
year = {2003},
url = {https://doi.org/10.1145/959258.959263},
doi = {10.1145/959258.959263},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CallanCS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DingROJ03,
author = {Ying Ding and
Cornelis Joost van Rijsbergen and
Iadh Ounis and
Joemon M. Jose},
title = {Report on {ACM} {SIGIR} workshop on "semantic web" {SWIR} 2003},
journal = {{SIGIR} Forum},
volume = {37},
number = {2},
pages = {45--49},
year = {2003},
url = {https://doi.org/10.1145/959258.959265},
doi = {10.1145/959258.959265},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DingROJ03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Downie03,
author = {J. Stephen Downie},
title = {Report on the panels and workshops of the music information retrieval
{(MIR)} and music digital library {(MDL)} evaluation frameworks project},
journal = {{SIGIR} Forum},
volume = {37},
number = {2},
pages = {38--44},
year = {2003},
url = {https://doi.org/10.1145/959258.959264},
doi = {10.1145/959258.959264},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Downie03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DumaisJBW03,
author = {Susan T. Dumais and
Thorsten Joachims and
Krishna Bharat and
Andreas S. Weigend},
title = {{SIGIR} 2003 workshop report: implicit measures of user interests
and preferences},
journal = {{SIGIR} Forum},
volume = {37},
number = {2},
pages = {50--54},
year = {2003},
url = {https://doi.org/10.1145/959258.959266},
doi = {10.1145/959258.959266},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DumaisJBW03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FallTBK03,
author = {Caspar J. Fall and
A. T{\"{o}}rcsv{\'{a}}ri and
K. Benzineb and
G. Karetka},
title = {Automated categorization in the international patent classification},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {10--25},
year = {2003},
url = {https://doi.org/10.1145/945546.945547},
doi = {10.1145/945546.945547},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/FallTBK03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FrakesF03,
author = {William B. Frakes and
Christopher J. Fox},
title = {Strength and similarity of affix removal stemming algorithms},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {26--30},
year = {2003},
url = {https://doi.org/10.1145/945546.945548},
doi = {10.1145/945546.945548},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/FrakesF03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jin03,
author = {Rong Jin},
title = {Statistical approaches toward automatic title generation},
journal = {{SIGIR} Forum},
volume = {37},
number = {2},
pages = {79},
year = {2003},
url = {https://doi.org/10.1145/959258.959274},
doi = {10.1145/959258.959274},
timestamp = {Tue, 04 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Jin03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KellyT03,
author = {Diane Kelly and
Jaime Teevan},
title = {Implicit feedback for inferring user preference: a bibliography},
journal = {{SIGIR} Forum},
volume = {37},
number = {2},
pages = {18--28},
year = {2003},
url = {https://doi.org/10.1145/959258.959260},
doi = {10.1145/959258.959260},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KellyT03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MostafaB03,
author = {Javed Mostafa and
Katy B{\"{o}}rner},
title = {Information visualization interfaces for retrieval and analysis {(IVIRA)}
workshop summary},
journal = {{SIGIR} Forum},
volume = {37},
number = {2},
pages = {59--61},
year = {2003},
url = {https://doi.org/10.1145/959258.959269},
doi = {10.1145/959258.959269},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/MostafaB03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Sebastiani03,
author = {Fabrizio Sebastiani},
title = {Report on the 25th European conference on information retrieval research
{(ECIR-03)}},
journal = {{SIGIR} Forum},
volume = {37},
number = {2},
pages = {29--32},
year = {2003},
url = {https://doi.org/10.1145/959258.959261},
doi = {10.1145/959258.959261},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Sebastiani03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SmeatonKGMS03,
author = {Alan F. Smeaton and
Gary Keogh and
Cathal Gurrin and
Kieran McDonald and
Tom S{\o}dring},
title = {Analysis of papers from twenty-five years of {SIGIR} conferences:
what have we been doing for the last quarter of a century?},
journal = {{SIGIR} Forum},
volume = {37},
number = {1},
pages = {49--53},
year = {2003},
url = {https://doi.org/10.1145/945546.945550},
doi = {10.1145/945546.945550},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SmeatonKGMS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SoboroffVC03,
author = {Ian Soboroff and
Ellen M. Voorhees and
Nick Craswell},
title = {Summary of the {SIGIR} 2003 workshop on defining evaluation methodologies
for terabyte-scale test collections},
journal = {{SIGIR} Forum},
volume = {37},
number = {2},
pages = {55--58},
year = {2003},
url = {https://doi.org/10.1145/959258.959267},
doi = {10.1145/959258.959267},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SoboroffVC03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Soergel03,
author = {Dagobert Soergel},
title = {Building a more meaningful Web: from traditional knowledge organization
systems to new semantic tools},
journal = {{SIGIR} Forum},
volume = {37},
number = {2},
pages = {65--72},
year = {2003},
url = {https://doi.org/10.1145/959258.959271},
doi = {10.1145/959258.959271},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Soergel03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WarnerN03,
author = {Simeon Warner and
Michael L. Nelson},
title = {Report on the metadata harvesting workshop at {JCDL} 2003},
journal = {{SIGIR} Forum},
volume = {37},
number = {2},
pages = {73--78},
year = {2003},
url = {https://doi.org/10.1145/959258.959272},
doi = {10.1145/959258.959272},
timestamp = {Mon, 16 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/WarnerN03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Baeza-YatesFM02,
author = {Ricardo A. Baeza{-}Yates and
Norbert Fuhr and
Yo{\"{e}}lle S. Maarek},
title = {Second edition of the "XML and information retrieval" workshop held
at SIGIR'2002, Tampere, Finland, Aug 15\({}^{\mbox{th}}\), 2002},
journal = {{SIGIR} Forum},
volume = {36},
number = {2},
pages = {53--57},
year = {2002},
url = {https://doi.org/10.1145/792550.792560},
doi = {10.1145/792550.792560},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Baeza-YatesFM02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BlandfordB02,
author = {Ann Blandford and
George Buchanan},
title = {Workshop report: usability of digital libraries @ JCDL'02},
journal = {{SIGIR} Forum},
volume = {36},
number = {2},
pages = {83--89},
year = {2002},
url = {https://doi.org/10.1145/792550.792566},
doi = {10.1145/792550.792566},
timestamp = {Mon, 05 Sep 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/BlandfordB02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BornerC02,
author = {Katy B{\"{o}}rner and
Chaomei Chen},
title = {Workshop report: visual interfaces to digital libraries at {JCDL}
'02},
journal = {{SIGIR} Forum},
volume = {36},
number = {2},
pages = {90--92},
year = {2002},
url = {https://doi.org/10.1145/792550.792567},
doi = {10.1145/792550.792567},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BornerC02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Broder02,
author = {Andrei Z. Broder},
title = {A taxonomy of web search},
journal = {{SIGIR} Forum},
volume = {36},
number = {2},
pages = {3--10},
year = {2002},
url = {https://doi.org/10.1145/792550.792552},
doi = {10.1145/792550.792552},
timestamp = {Wed, 28 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Broder02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CallanKG02,
author = {Jamie Callan and
Paul B. Kantor and
David A. Grossman},
title = {Information retrieval and {OCR:} from converting content to grasping
meaning},
journal = {{SIGIR} Forum},
volume = {36},
number = {2},
pages = {58--61},
year = {2002},
url = {https://doi.org/10.1145/792550.792561},
doi = {10.1145/792550.792561},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CallanKG02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CodenBS02,
author = {Anni Coden and
Eric W. Brown and
Savitha Srinivasan},
title = {{ACM} {SIGIR} 2001 workshop "Information Retrieval Techniques for
Speech Applications"},
journal = {{SIGIR} Forum},
volume = {36},
number = {1},
pages = {10--13},
year = {2002},
url = {https://doi.org/10.1145/584449.584454},
doi = {10.1145/584449.584454},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CodenBS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CrestaniGR02,
author = {Fabio Crestani and
Mark A. Girolami and
C. J. van Rijsbergen},
title = {Report on the 24th European colloquium on information retrieval research
{(ECIR} 2002)},
journal = {{SIGIR} Forum},
volume = {36},
number = {1},
pages = {6--9},
year = {2002},
url = {https://doi.org/10.1145/584449.584453},
doi = {10.1145/584449.584453},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CrestaniGR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DominichLR02,
author = {S{\'{a}}ndor Dominich and
Mounia Lalmas and
C. J. van Rijsbergen},
title = {Report on {ACM} sigir workshop on mathematical/formal methods in information
retrieval},
journal = {{SIGIR} Forum},
volume = {36},
number = {1},
pages = {18--19},
year = {2002},
url = {https://doi.org/10.1145/584449.584456},
doi = {10.1145/584449.584456},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DominichLR02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DominichLR02a,
author = {S{\'{a}}ndor Dominich and
Mounia Lalmas and
Keith van Rijsbergen},
title = {Report on {ACM} {SIGIR} workshop on mathematical/formal methods in
information retrieval},
journal = {{SIGIR} Forum},
volume = {36},
number = {2},
pages = {62--67},
year = {2002},
url = {https://doi.org/10.1145/792550.792562},
doi = {10.1145/792550.792562},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DominichLR02a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Dumais02,
author = {Susan T. Dumais},
title = {Annual report for SIGIR, July 2001 - June 2002},
journal = {{SIGIR} Forum},
volume = {36},
number = {1},
pages = {2--4},
year = {2002},
url = {https://doi.org/10.1145/584449.584451},
doi = {10.1145/584449.584451},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Dumais02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DumaisLS02,
author = {Susan T. Dumais and
David D. Lewis and
Fabrizio Sebastiani},
title = {Report on the workshop on Operational Text Classification Systems
{(OTC-02)}},
journal = {{SIGIR} Forum},
volume = {36},
number = {2},
pages = {68--71},
year = {2002},
url = {https://doi.org/10.1145/792550.792563},
doi = {10.1145/792550.792563},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DumaisLS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GeyKP02,
author = {Fredric C. Gey and
Noriko Kando and
Carol Peters},
title = {Cross language information retrieval: a research roadmap},
journal = {{SIGIR} Forum},
volume = {36},
number = {2},
pages = {72--80},
year = {2002},
url = {https://doi.org/10.1145/792550.792564},
doi = {10.1145/792550.792564},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/GeyKP02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hammer02,
author = {Joachim Hammer},
title = {Report on the {ACM} fourth international workshop on data warehousing
and {OLAP} {(DOLAP} 2001)},
journal = {{SIGIR} Forum},
volume = {36},
number = {1},
pages = {14--17},
year = {2002},
url = {https://doi.org/10.1145/584449.584455},
doi = {10.1145/584449.584455},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Hammer02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HenzingerMS02,
author = {Monika Rauch Henzinger and
Rajeev Motwani and
Craig Silverstein},
title = {Challenges in web search engines},
journal = {{SIGIR} Forum},
volume = {36},
number = {2},
pages = {11--22},
year = {2002},
url = {https://doi.org/10.1145/792550.792553},
doi = {10.1145/792550.792553},
timestamp = {Thu, 02 Jan 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/HenzingerMS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hersh02,
author = {William R. Hersh},
title = {{TREC} genomics pre-track workshop report},
journal = {{SIGIR} Forum},
volume = {36},
number = {2},
pages = {81--82},
year = {2002},
url = {https://doi.org/10.1145/792550.792565},
doi = {10.1145/792550.792565},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Hersh02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hill02,
author = {Linda L. Hill},
title = {Workshop report: Digital gazetteers: integration into distributed
digital library services},
journal = {{SIGIR} Forum},
volume = {36},
number = {2},
pages = {93--97},
year = {2002},
url = {https://doi.org/10.1145/792550.792568},
doi = {10.1145/792550.792568},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Hill02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Litman02,
author = {Jessica Litman},
title = {Digital copyright and the progress of science},
journal = {{SIGIR} Forum},
volume = {36},
number = {2},
pages = {44--52},
year = {2002},
url = {https://doi.org/10.1145/792550.792558},
doi = {10.1145/792550.792558},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Litman02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Mostafa02,
author = {Javed Mostafa},
title = {Summary of workshop on document search interface design at the JCDL'02},
journal = {{SIGIR} Forum},
volume = {36},
number = {2},
pages = {98--99},
year = {2002},
url = {https://doi.org/10.1145/792550.792569},
doi = {10.1145/792550.792569},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Mostafa02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Munson02,
author = {Ethan V. Munson},
title = {Symposium on document engineering},
journal = {{SIGIR} Forum},
volume = {36},
number = {1},
pages = {20--22},
year = {2002},
url = {https://doi.org/10.1145/584449.584457},
doi = {10.1145/584449.584457},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Munson02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SmeatonKGMS02,
author = {Alan F. Smeaton and
Gary Keogh and
Cathal Gurrin and
Kieran McDonald and
Tom S{\o}dring},
title = {Analysis of papers from twenty-five years of {SIGIR} conferences:
what have we been doing for the last quarter of a century?},
journal = {{SIGIR} Forum},
volume = {36},
number = {2},
pages = {39--43},
year = {2002},
url = {https://doi.org/10.1145/792550.792556},
doi = {10.1145/792550.792556},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SmeatonKGMS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Soboroff02,
author = {Ian Soboroff},
title = {Do {TREC} web collections look like the web?},
journal = {{SIGIR} Forum},
volume = {36},
number = {2},
pages = {23--31},
year = {2002},
url = {https://doi.org/10.1145/792550.792554},
doi = {10.1145/792550.792554},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Soboroff02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SpinkOOJ02,
author = {Amanda Spink and
Seda {\"{O}}zmutlu and
Huseyin Cenk {\"{O}}zmutlu and
Bernard J. Jansen},
title = {{U.S.} versus European web searching trends},
journal = {{SIGIR} Forum},
volume = {36},
number = {2},
pages = {32--38},
year = {2002},
url = {https://doi.org/10.1145/792550.792555},
doi = {10.1145/792550.792555},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SpinkOOJ02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Zhai02,
author = {ChengXiang Zhai},
title = {Risk minimization and language modeling in text retrieval dissertation
abstract},
journal = {{SIGIR} Forum},
volume = {36},
number = {2},
pages = {100--101},
year = {2002},
url = {https://doi.org/10.1145/792550.792571},
doi = {10.1145/792550.792571},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Zhai02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BergmarkPZ01,
author = {Donna Bergmark and
Paradee Phempoonpanich and
Shumin Zhao},
title = {Scraping the {ACM} Digital Library},
journal = {{SIGIR} Forum},
volume = {35},
number = {2},
pages = {1--7},
year = {2001},
url = {https://doi.org/10.1145/511144.511146},
doi = {10.1145/511144.511146},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BergmarkPZ01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BornerC01,
author = {Katy B{\"{o}}rner and
Chaomei Chen},
title = {Visual interfaces to digital libraries: the first international workshop
at the first {ACM+IEEE} joint conference on digital libraries},
journal = {{SIGIR} Forum},
volume = {35},
number = {1},
pages = {12--15},
year = {2001},
url = {https://doi.org/10.1145/948716.948722},
doi = {10.1145/948716.948722},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BornerC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ChenC01,
author = {Kuang{-}hua Chen and
Hsin{-}Hsi Chen},
title = {Cross-Language Chinese Text Retrieval in {NTCIR} Workshop: towards
Cross-Language multilingual Text Retrieval},
journal = {{SIGIR} Forum},
volume = {35},
number = {2},
pages = {12--19},
year = {2001},
url = {https://doi.org/10.1145/511144.511149},
doi = {10.1145/511144.511149},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ChenC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CroftCL01,
author = {W. Bruce Croft and
James P. Callan and
John D. Lafferty},
title = {Workshop on language modeling and information retrieval},
journal = {{SIGIR} Forum},
volume = {35},
number = {1},
pages = {4--6},
year = {2001},
url = {https://doi.org/10.1145/948716.948719},
doi = {10.1145/948716.948719},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CroftCL01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kluev01,
author = {Vitaliy Kluev},
title = {Compiling Document Collections from the Internet},
journal = {{SIGIR} Forum},
volume = {34},
number = {2},
pages = {9--14},
year = {2001},
url = {https://doi.org/10.1145/381258.381264},
doi = {10.1145/381258.381264},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Kluev01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LewisS01,
author = {David D. Lewis and
Fabrizio Sebastiani},
title = {Report on the Workshop on Operational Text Classification systems
{(OTC-01)}},
journal = {{SIGIR} Forum},
volume = {35},
number = {2},
pages = {8--11},
year = {2001},
url = {https://doi.org/10.1145/511144.511148},
doi = {10.1145/511144.511148},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LewisS01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LimH01,
author = {Ee{-}Peng Lim and
Roger Chiang Hsiang{-}Li},
title = {Report on the third International Workshop on Web Information and
Data Management (WIDM'2001)},
journal = {{SIGIR} Forum},
volume = {35},
number = {2},
pages = {20--21},
year = {2001},
url = {https://doi.org/10.1145/511144.511150},
doi = {10.1145/511144.511150},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LimH01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Oard01,
author = {Douglas W. Oard},
title = {Interactive cross-language information retrieval},
journal = {{SIGIR} Forum},
volume = {35},
number = {1},
pages = {1--3},
year = {2001},
url = {https://doi.org/10.1145/948716.948718},
doi = {10.1145/948716.948718},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Oard01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SmeatonC01,
author = {Alan F. Smeaton and
James P. Callan},
title = {Joint {DELOS-NSF} workshop on personalisation and recommender systems
in digital libraries},
journal = {{SIGIR} Forum},
volume = {35},
number = {1},
pages = {7--11},
year = {2001},
url = {https://doi.org/10.1145/948716.948720},
doi = {10.1145/948716.948720},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SmeatonC01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Voorhees01,
author = {Ellen M. Voorhees},
title = {Report on {TREC-9}},
journal = {{SIGIR} Forum},
volume = {34},
number = {2},
pages = {1--8},
year = {2001},
url = {https://doi.org/10.1145/381258.381260},
doi = {10.1145/381258.381260},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Voorhees01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Wacholder01,
author = {Nina Wacholder},
title = {The technology of phrase browsing applications: workshop held in conjunction
with the first {ACM-IEEE} joint conference on digital libraries},
journal = {{SIGIR} Forum},
volume = {35},
number = {1},
pages = {16--20},
year = {2001},
url = {https://doi.org/10.1145/948716.948723},
doi = {10.1145/948716.948723},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Wacholder01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Callan00,
author = {James P. Callan},
title = {{SIGIR} Announces Member Plus Program},
journal = {{SIGIR} Forum},
volume = {34},
number = {1},
pages = {15},
year = {2000},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Callan00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/CarmelMS00,
author = {David Carmel and
Yo{\"{e}}lle S. Maarek and
Aya Soffer},
title = {{XML} and Information Retrieval: a {SIGIR} 2000 Workshop},
journal = {{SIGIR} Forum},
volume = {34},
number = {1},
pages = {31--36},
year = {2000},
url = {https://doi.org/10.1145/373593.373624},
doi = {10.1145/373593.373624},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/CarmelMS00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DominichLR00,
author = {S{\'{a}}ndor Dominich and
Mounia Lalmas and
C. J. van Rijsbergen},
title = {{ACM} {SIGIR} 2000 Workshop on Mathematical/Formal Methods in Information
Retrieval},
journal = {{SIGIR} Forum},
volume = {34},
number = {1},
pages = {18--23},
year = {2000},
url = {https://doi.org/10.1145/373593.373617},
doi = {10.1145/373593.373617},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DominichLR00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Dumais00,
author = {Susan T. Dumais},
title = {Annual Report for SIGIR, July 1999 - June 2000},
journal = {{SIGIR} Forum},
volume = {34},
number = {1},
pages = {11--14},
year = {2000},
url = {https://doi.org/10.1145/373593.373613},
doi = {10.1145/373593.373613},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Dumais00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HershO00,
author = {William R. Hersh and
Paul Over},
title = {{SIGIR} Workshop on Interactive Retrieval at {TREC} and Beyond},
journal = {{SIGIR} Forum},
volume = {34},
number = {1},
pages = {24--27},
year = {2000},
url = {https://doi.org/10.1145/373593.373619},
doi = {10.1145/373593.373619},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/HershO00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KandoL00,
author = {Noriko Kando and
Mun{-}Kew Leong},
title = {Workshop on Patent Retrieval {(SIGIR} 2000 Workshop Report)},
journal = {{SIGIR} Forum},
volume = {34},
number = {1},
pages = {28--30},
year = {2000},
url = {https://doi.org/10.1145/373593.373621},
doi = {10.1145/373593.373621},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KandoL00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PorterB00,
author = {Martin Porter and
Richard J. Boulton},
title = {Object Muscat, an Open search engine},
journal = {{SIGIR} Forum},
volume = {34},
number = {1},
pages = {16--17},
year = {2000},
url = {https://doi.org/10.1145/373593.373615},
doi = {10.1145/373593.373615},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/PorterB00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Robertson00,
author = {Stephen E. Robertson},
title = {Salton Award Lecture: On theoretical argument in information retrieval},
journal = {{SIGIR} Forum},
volume = {34},
number = {1},
pages = {1--10},
year = {2000},
url = {https://doi.org/10.1145/373593.373597},
doi = {10.1145/373593.373597},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Robertson00.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AgostiM99,
author = {Maristella Agosti and
Massimo Melucci},
title = {Evaluation of Web Document Retrieval: {A} SIGIR'99 Workshop},
journal = {{SIGIR} Forum},
volume = {33},
number = {1},
pages = {23--27},
year = {1999},
url = {https://doi.org/10.1145/331403.331409},
doi = {10.1145/331403.331409},
timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/AgostiM99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BelkinD99,
author = {Nicholas J. Belkin and
Susan T. Dumais},
title = {Annual Report for SIGIR, July 1998 - June 1999},
journal = {{SIGIR} Forum},
volume = {33},
number = {2},
pages = {1--3},
year = {1999},
url = {https://doi.org/10.1145/344250.606664},
doi = {10.1145/344250.606664},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BelkinD99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Golovchinsky99,
author = {Gene Golovchinsky},
title = {Reaction to {SIGIR} 99 Panel on User Interface Issues},
journal = {{SIGIR} Forum},
volume = {33},
number = {1},
pages = {18--19},
year = {1999},
url = {https://doi.org/10.1145/331403.331407},
doi = {10.1145/331403.331407},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Golovchinsky99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harper99,
author = {David J. Harper},
title = {Report on CIR99, the 2nd {UK} Conference on "The Challenge of Image
Retrieval"},
journal = {{SIGIR} Forum},
volume = {33},
number = {1},
pages = {20--22},
year = {1999},
url = {https://doi.org/10.1145/331403.331408},
doi = {10.1145/331403.331408},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Harper99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hawking99,
author = {David Hawking},
title = {Plans for the {TREC-9} Web Track},
journal = {{SIGIR} Forum},
volume = {33},
number = {2},
pages = {17--18},
year = {1999},
url = {https://doi.org/10.1145/344250.344254},
doi = {10.1145/344250.344254},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Hawking99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HershO99,
author = {William R. Hersh and
Paul Over},
title = {{TREC-8} Interactive Track},
journal = {{SIGIR} Forum},
volume = {33},
number = {2},
pages = {8--11},
year = {1999},
url = {https://doi.org/10.1145/344250.344251},
doi = {10.1145/344250.344251},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/HershO99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hill99,
author = {Linda L. Hill},
title = {Networked Knowledge Orginzation Systems {(NKOS)} Workshop},
journal = {{SIGIR} Forum},
volume = {33},
number = {1},
pages = {32--33},
year = {1999},
url = {https://doi.org/10.1145/331403.331411},
doi = {10.1145/331403.331411},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Hill99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HullR99,
author = {David A. Hull and
Stephen E. Robertson},
title = {The {TREC-9} Filtering Track},
journal = {{SIGIR} Forum},
volume = {33},
number = {2},
pages = {16},
year = {1999},
url = {https://doi.org/10.1145/344250.344253},
doi = {10.1145/344250.344253},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/HullR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/MilosavljevicPPW99,
author = {Maria Milosavljevic and
Fran{\c{c}}ois Paradis and
C{\'{e}}cile Paris and
Ross Wilkinson},
title = {Customised Information Delivery: {A} {SIGIR} 99 Workshop},
journal = {{SIGIR} Forum},
volume = {33},
number = {1},
pages = {28--31},
year = {1999},
url = {https://doi.org/10.1145/331403.331410},
doi = {10.1145/331403.331410},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/MilosavljevicPPW99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SakaiKOIKKTFMUSTTNAK99,
author = {Tetsuya Sakai and
Tsuyoshi Kitani and
Yasushi Ogawa and
Tetsuya Ishikawa and
Haruo Kimoto and
Ikuo Keshi and
Jun Toyoura and
Toshikazu Fukushima and
Kunio Matsui and
Yoshihiro Ueda and
Takenobu Tokunaga and
Hiroshi Tsuruoka and
Hidekazu Nakawatase and
Teru Agata and
Noriko Kando},
title = {{BMIR-J2:} {A} Test Collection for Evaluation of Japanese Information
Retrieval Systems},
journal = {{SIGIR} Forum},
volume = {33},
number = {1},
pages = {13--17},
year = {1999},
url = {https://doi.org/10.1145/331403.331406},
doi = {10.1145/331403.331406},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/SakaiKOIKKTFMUSTTNAK99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SilversteinHMM99,
author = {Craig Silverstein and
Monika Henzinger and
Hannes Marais and
Michael Moricz},
title = {Analysis of a Very Large Web Search Engine Query Log},
journal = {{SIGIR} Forum},
volume = {33},
number = {1},
pages = {6--12},
year = {1999},
url = {https://doi.org/10.1145/331403.331405},
doi = {10.1145/331403.331405},
timestamp = {Thu, 04 Apr 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/SilversteinHMM99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SoboroffNP99,
author = {Ian Soboroff and
Charles K. Nicholas and
Michael J. Pazzani},
title = {Workshop on Recommender Systems: Algorithms and Evaluation},
journal = {{SIGIR} Forum},
volume = {33},
number = {1},
pages = {36--43},
year = {1999},
url = {https://doi.org/10.1145/331403.331413},
doi = {10.1145/331403.331413},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SoboroffNP99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SrihariZMR99,
author = {Rohini K. Srihari and
Zhongfei Zhang and
R. Manmatha and
Chandu Ravela},
title = {Indexing and Retrieval, SIGIR'99 Workshop Summary},
journal = {{SIGIR} Forum},
volume = {33},
number = {1},
pages = {34--35},
year = {1999},
url = {https://doi.org/10.1145/331403.331412},
doi = {10.1145/331403.331412},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SrihariZMR99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Varian99,
author = {Hal R. Varian},
title = {Economics and Search},
journal = {{SIGIR} Forum},
volume = {33},
number = {1},
pages = {1--5},
year = {1999},
url = {https://doi.org/10.1145/331403.331404},
doi = {10.1145/331403.331404},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Varian99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/VoorheesH99,
author = {Ellen M. Voorhees and
Donna Harman},
title = {The Text REtrieval Conference {(TREC):} History and Plans for {TREC-9}},
journal = {{SIGIR} Forum},
volume = {33},
number = {2},
pages = {12--15},
year = {1999},
url = {https://doi.org/10.1145/344250.344252},
doi = {10.1145/344250.344252},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/VoorheesH99.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X99a,
title = {Minutes of the 22nd {SIGIR} Business Meeting},
journal = {{SIGIR} Forum},
volume = {33},
number = {2},
pages = {4--7},
year = {1999},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X99a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X99b,
title = {{SIGIR} Membership Directory 1999},
journal = {{SIGIR} Forum},
volume = {33},
number = {2},
pages = {19--49},
year = {1999},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X99b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X99c,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {33},
number = {2},
pages = {50--53},
year = {1999},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X99c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X99e,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {33},
number = {1},
pages = {44--45},
year = {1999},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X99e.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belkin98,
author = {Nicholas J. Belkin},
title = {Chair's Message},
journal = {{SIGIR} Forum},
volume = {32},
number = {2},
pages = {1--2},
year = {1998},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Belkin98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BrownS98,
author = {Eric W. Brown and
Alan F. Smeaton},
title = {Hypertext Information Retrieval for the Web},
journal = {{SIGIR} Forum},
volume = {32},
number = {2},
pages = {8--13},
year = {1998},
url = {https://doi.org/10.1145/305110.305114},
doi = {10.1145/305110.305114},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/BrownS98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ClarkeCP98,
author = {Charles L. A. Clarke and
Gordon V. Cormack and
Christopher R. Palmer},
title = {An Overview of MultiText},
journal = {{SIGIR} Forum},
volume = {32},
number = {2},
pages = {14--15},
year = {1998},
url = {https://doi.org/10.1145/305110.305117},
doi = {10.1145/305110.305117},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ClarkeCP98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hawking98,
author = {David Hawking},
title = {Efficiency/Effectiveness Trade-Offs in Query Processing},
journal = {{SIGIR} Forum},
volume = {32},
number = {2},
pages = {16--22},
year = {1998},
url = {https://doi.org/10.1145/305110.305119},
doi = {10.1145/305110.305119},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Hawking98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JansenSBS98,
author = {Bernard J. Jansen and
Amanda Spink and
Judy Bateman and
Tefko Saracevic},
title = {Real Life Information Retrieval: {A} Study of User Queries on the
Web},
journal = {{SIGIR} Forum},
volume = {32},
number = {1},
pages = {5--17},
year = {1998},
url = {https://doi.org/10.1145/281250.281253},
doi = {10.1145/281250.281253},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/JansenSBS98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KandoKYO98,
author = {Noriko Kando and
Kyo Kageura and
Masaharu Yoshioka and
Keizo Oyama},
title = {Phrase Processing Methods for Japanese Text Retrieval},
journal = {{SIGIR} Forum},
volume = {32},
number = {2},
pages = {23--28},
year = {1998},
url = {https://doi.org/10.1145/305110.305120},
doi = {10.1145/305110.305120},
timestamp = {Thu, 14 Oct 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/KandoKYO98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kirsch98,
author = {Steve Kirsch},
title = {Infoseek's Experiences Searching the Internet},
journal = {{SIGIR} Forum},
volume = {32},
number = {2},
pages = {3--7},
year = {1998},
url = {https://doi.org/10.1145/305110.305112},
doi = {10.1145/305110.305112},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Kirsch98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lesk98,
author = {Michael Lesk},
title = {Real World Searching Panel at {SIGIR} 97},
journal = {{SIGIR} Forum},
volume = {32},
number = {1},
pages = {1--4},
year = {1998},
url = {https://doi.org/10.1145/281250.281252},
doi = {10.1145/281250.281252},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Lesk98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Schmidt-WescheG98,
author = {Birgit Schmidt{-}Wesche and
Gene Golovchinsky},
title = {Query Input and User Expectations, Summary Report},
journal = {{SIGIR} Forum},
volume = {32},
number = {2},
pages = {31--34},
year = {1998},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Schmidt-WescheG98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SrihariZMR98,
author = {Rohini K. Srihari and
Zhongfei Zhang and
R. Manmatha and
Chandu Ravela},
title = {Multimedia Indexing and Retrieval, Summary Report},
journal = {{SIGIR} Forum},
volume = {32},
number = {2},
pages = {29--30},
year = {1998},
url = {https://doi.org/10.1145/305110.305130},
doi = {10.1145/305110.305130},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SrihariZMR98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X98,
title = {Title},
journal = {{SIGIR} Forum},
volume = {32},
number = {1},
year = {1998},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X98a,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {32},
number = {1},
pages = {35--47},
year = {1998},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X98a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X98b,
title = {Title},
journal = {{SIGIR} Forum},
volume = {32},
number = {2},
year = {1998},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X98b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X98c,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {32},
number = {2},
pages = {35--37},
year = {1998},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X98c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZobelM98,
author = {Justin Zobel and
Alistair Moffat},
title = {Exploring the Similarity Space},
journal = {{SIGIR} Forum},
volume = {32},
number = {1},
pages = {18--34},
year = {1998},
url = {https://doi.org/10.1145/281250.281256},
doi = {10.1145/281250.281256},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ZobelM98.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belkin97,
author = {Nicholas J. Belkin},
title = {Remarks on the Presentation of the Gerard Salton Award for Excellence
in Research in Information Retrieval to Tefko Saracevic, July 1997},
journal = {{SIGIR} Forum},
volume = {31},
number = {2},
pages = {14--15},
year = {1997},
url = {https://doi.org/10.1145/270886.270888},
doi = {10.1145/270886.270888},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Belkin97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belkin97a,
author = {Nicholas J. Belkin},
title = {Chair's Message},
journal = {{SIGIR} Forum},
volume = {31},
number = {2},
pages = {1},
year = {1997},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Belkin97a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Buckley97,
author = {Chris Buckley},
title = {The {SMART} Lab Report: The Modern {SMART} Years {(1980-1996)}},
journal = {{SIGIR} Forum},
volume = {31},
number = {1},
pages = {17--22},
year = {1997},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Buckley97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FoxW97,
author = {Edward A. Fox and
Harry Wu},
title = {The {SMART} Lab Report: The Transition Years {(1975-1982)}},
journal = {{SIGIR} Forum},
volume = {31},
number = {1},
pages = {12--17},
year = {1997},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/FoxW97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Groman97,
author = {Robert C. Groman},
title = {Searching Multimedia Databases by Content (Book Review)},
journal = {{SIGIR} Forum},
volume = {31},
number = {2},
pages = {34},
year = {1997},
url = {https://doi.org/10.1145/270886.606663},
doi = {10.1145/270886.606663},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Groman97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harman97,
author = {Donna Harman},
title = {Dedication to Professor Gerard Salton},
journal = {{SIGIR} Forum},
volume = {31},
number = {1},
pages = {1},
year = {1997},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Harman97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harman97a,
author = {Donna Harman},
title = {The {SMART} Lab Report: The Early Cornell Years {(1965-1970)}},
journal = {{SIGIR} Forum},
volume = {31},
number = {1},
pages = {6--12},
year = {1997},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Harman97a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hetzler97,
author = {Elizabeth G. Hetzler},
title = {Beyond Word Relations - {SIGIR} '97 Workshop},
journal = {{SIGIR} Forum},
volume = {31},
number = {2},
pages = {28--33},
year = {1997},
url = {https://doi.org/10.1145/270886.270890},
doi = {10.1145/270886.270890},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Hetzler97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lesk97,
author = {Michael Lesk},
title = {The {SMART} Lab Report: The Harvard Years {(1961-1968)}},
journal = {{SIGIR} Forum},
volume = {31},
number = {1},
pages = {2--6},
year = {1997},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Lesk97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lewis97,
author = {David D. Lewis},
title = {Minutes of the 1997 {ACM} {SIGIR} Business Meeting},
journal = {{SIGIR} Forum},
volume = {31},
number = {2},
pages = {2--6},
year = {1997},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Lewis97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton97,
author = {Gerard Salton},
title = {A Blueprint for Automatic Indexing},
journal = {{SIGIR} Forum},
volume = {31},
number = {1},
pages = {23--36},
year = {1997},
url = {https://doi.org/10.1145/263868.263871},
doi = {10.1145/263868.263871},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Salton97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton97a,
author = {Gerard Salton},
title = {Letter to Members of {ACM/SIGIR}},
journal = {{SIGIR} Forum},
volume = {31},
number = {1},
pages = {37--38},
year = {1997},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Salton97a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton97b,
author = {Gerard Salton},
title = {Expert Systems and Information Retrieval},
journal = {{SIGIR} Forum},
volume = {31},
number = {1},
pages = {39--42},
year = {1997},
url = {https://doi.org/10.1145/263868.263873},
doi = {10.1145/263868.263873},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Salton97b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton97c,
author = {Gerard Salton},
title = {Publications},
journal = {{SIGIR} Forum},
volume = {31},
number = {1},
pages = {43--56},
year = {1997},
url = {https://doi.org/10.1145/263868.263874},
doi = {10.1145/263868.263874},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Salton97c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Saracevic97,
author = {Tefko Saracevic},
title = {{USERS} {LOST:} Reflections on the Past, Future, and Limits of Information
Science},
journal = {{SIGIR} Forum},
volume = {31},
number = {2},
pages = {16--27},
year = {1997},
url = {https://doi.org/10.1145/270886.270889},
doi = {10.1145/270886.270889},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Saracevic97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Willett97,
author = {Peter Willett},
title = {Lab Report Special Section: Information Retrieval Research in the
University of Sheffield},
journal = {{SIGIR} Forum},
volume = {31},
number = {2},
pages = {7--13},
year = {1997},
url = {https://doi.org/10.1145/270886.270887},
doi = {10.1145/270886.270887},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Willett97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X97,
title = {{SIGIR} Membership Directory 1997},
journal = {{SIGIR} Forum},
volume = {31},
number = {1},
pages = {57--88},
year = {1997},
url = {https://doi.org/10.1145/263868.263875},
doi = {10.1145/263868.263875},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/X97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X97a,
title = {Title},
journal = {{SIGIR} Forum},
volume = {31},
number = {2},
year = {1997},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X97a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X97b,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {31},
number = {2},
pages = {35--37},
year = {1997},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X97b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X97c,
title = {Title},
journal = {{SIGIR} Forum},
volume = {31},
number = {1},
year = {1997},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X97c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belkin96,
author = {Nicholas J. Belkin},
title = {Chair's Message},
journal = {{SIGIR} Forum},
volume = {30},
number = {1},
pages = {1--2},
year = {1996},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Belkin96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Davenport96,
author = {David Davenport},
title = {Information Retrieval: {A} Health Care Perspective (Book Review)},
journal = {{SIGIR} Forum},
volume = {30},
number = {2},
pages = {14--15},
year = {1996},
url = {https://doi.org/10.1145/254590.606643},
doi = {10.1145/254590.606643},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Davenport96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox96,
author = {Edward A. Fox},
title = {Lab Report Special Section: Virginia Tech Department of Computer Science
Information Access Laboratory},
journal = {{SIGIR} Forum},
volume = {30},
number = {1},
pages = {3--10},
year = {1996},
url = {https://doi.org/10.1145/381984.381985},
doi = {10.1145/381984.381985},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Fox96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Groman96,
author = {Robert C. Groman},
title = {Elsevier Science's Home Page: Sign of the Times},
journal = {{SIGIR} Forum},
volume = {30},
number = {1},
pages = {42--43},
year = {1996},
url = {https://doi.org/10.1145/381984.381988},
doi = {10.1145/381984.381988},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Groman96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harman96,
author = {Donna Harman},
title = {Report on Building and Using Test Collections Panel, {SIGIR} 1996},
journal = {{SIGIR} Forum},
volume = {30},
number = {2},
pages = {5--10},
year = {1996},
url = {https://doi.org/10.1145/254590.254592},
doi = {10.1145/254590.254592},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Harman96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HuibersLR96,
author = {Theo W. C. Huibers and
Mounia Lalmas and
C. J. van Rijsbergen},
title = {Information Retrieval and Situation Theory},
journal = {{SIGIR} Forum},
volume = {30},
number = {1},
pages = {11--25},
year = {1996},
url = {https://doi.org/10.1145/381984.381986},
doi = {10.1145/381984.381986},
timestamp = {Tue, 10 Sep 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/HuibersLR96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lewis96,
author = {David D. Lewis},
title = {Minutes of the 1996 {ACM} {SIGIR} Business Meeting},
journal = {{SIGIR} Forum},
volume = {30},
number = {2},
pages = {1--4},
year = {1996},
url = {https://doi.org/10.1145/254590.254591},
doi = {10.1145/254590.254591},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Lewis96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/SmeatonR96,
author = {Alan F. Smeaton and
Edie M. Rasmussen},
title = {The EuroIEMasters Project: {A} European Masters Degree in Information
Engineering},
journal = {{SIGIR} Forum},
volume = {30},
number = {2},
pages = {11--13},
year = {1996},
url = {https://doi.org/10.1145/254590.254593},
doi = {10.1145/254590.254593},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/SmeatonR96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WongKY96,
author = {Jacqueline W. T. Wong and
Wing{-}Kay Kan and
Gilbert H. Young},
title = {{ACTION:} Automatic Classification For Full-Text Documents},
journal = {{SIGIR} Forum},
volume = {30},
number = {1},
pages = {26--41},
year = {1996},
url = {https://doi.org/10.1145/381984.381987},
doi = {10.1145/381984.381987},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/WongKY96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X96,
title = {News: {TIPSTER} Phase {III} Begins},
journal = {{SIGIR} Forum},
volume = {30},
number = {1},
pages = {44--45},
year = {1996},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X96.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X96a,
title = {Title},
journal = {{SIGIR} Forum},
volume = {30},
number = {1},
year = {1996},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X96a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X96b,
title = {Calendar of Events, Announcements},
journal = {{SIGIR} Forum},
volume = {30},
number = {1},
pages = {46--49},
year = {1996},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X96b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X96c,
title = {Title},
journal = {{SIGIR} Forum},
volume = {30},
number = {2},
year = {1996},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X96c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X96d,
title = {Calendar of Events, Announcements},
journal = {{SIGIR} Forum},
volume = {30},
number = {2},
pages = {16--15},
year = {1996},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X96d.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belkin95,
author = {Nicholas J. Belkin},
title = {Chair's Message},
journal = {{SIGIR} Forum},
volume = {29},
number = {2},
pages = {1--2},
year = {1995},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Belkin95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Croft95,
author = {W. Bruce Croft},
title = {Lab Report Special Section: The University of Massachusetts Center
for Intelligent Information Retrival},
journal = {{SIGIR} Forum},
volume = {29},
number = {1},
pages = {1--7},
year = {1995},
url = {https://doi.org/10.1145/207556.207557},
doi = {10.1145/207556.207557},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Croft95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Grandi95,
author = {Fabio Grandi},
title = {On the Signature Weight in "Multiple" m Signature Files},
journal = {{SIGIR} Forum},
volume = {29},
number = {1},
pages = {20--25},
year = {1995},
url = {https://doi.org/10.1145/207556.207560},
doi = {10.1145/207556.207560},
timestamp = {Tue, 30 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Grandi95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harman95,
author = {Donna Harman},
title = {Lab Report Special Section: Natural Language Processing and Information
Retrieval Group Information Access and User Interfaces Division National
Institute of Standards and Technology},
journal = {{SIGIR} Forum},
volume = {29},
number = {2},
pages = {6--12},
year = {1995},
url = {https://doi.org/10.1145/219587.219590},
doi = {10.1145/219587.219590},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Harman95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Korfhage95,
author = {Robert R. Korfhage},
title = {Some Thoughts on Similarity Measures},
journal = {{SIGIR} Forum},
volume = {29},
number = {1},
pages = {8},
year = {1995},
url = {https://doi.org/10.1145/207556.207558},
doi = {10.1145/207556.207558},
timestamp = {Tue, 06 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Korfhage95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lewis95,
author = {David D. Lewis},
title = {Minutes - 1995 {ACM} {SIGIR} Annual Meeting},
journal = {{SIGIR} Forum},
volume = {29},
number = {2},
pages = {3--5},
year = {1995},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Lewis95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lewis95a,
author = {David D. Lewis},
title = {A Sequential Algorithm for Training Text Classifiers: Corrigendum
and Additional Data},
journal = {{SIGIR} Forum},
volume = {29},
number = {2},
pages = {13--19},
year = {1995},
url = {https://doi.org/10.1145/219587.219592},
doi = {10.1145/219587.219592},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Lewis95a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/PejtersenBGHSV95,
author = {Annelise Mark Pejtersen and
Jacob Buur and
T. Govindaraj and
Micheline Hancock{-}Beaulieu and
Diane H. Sonnenwald and
Kim J. Vicente},
title = {Supporting Semantic Information Retrieval in Communication Networks
by Multimedia Techniques},
journal = {{SIGIR} Forum},
volume = {29},
number = {1},
pages = {9--19},
year = {1995},
url = {https://doi.org/10.1145/207556.207559},
doi = {10.1145/207556.207559},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/PejtersenBGHSV95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X95,
title = {Title},
journal = {{SIGIR} Forum},
volume = {29},
number = {1},
year = {1995},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X95a,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {29},
number = {1},
pages = {26--33},
year = {1995},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X95a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X95b,
title = {Title},
journal = {{SIGIR} Forum},
volume = {29},
number = {2},
year = {1995},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X95b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X95c,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {29},
number = {2},
pages = {35--49},
year = {1995},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X95c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ZezulaCT95,
author = {Pavel Zezula and
Paolo Ciaccia and
Paolo Tiberio},
title = {Key-Based Partitioned Bit-Sliced Signature File},
journal = {{SIGIR} Forum},
volume = {29},
number = {2},
pages = {20--34},
year = {1995},
url = {https://doi.org/10.1145/219587.219593},
doi = {10.1145/219587.219593},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ZezulaCT95.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Donaldson94,
author = {Cameron M. Donaldson},
title = {InQuisiX\({}^{\mbox{TM}}\) An Electronic Catalog for Software Reuse},
journal = {{SIGIR} Forum},
volume = {28},
number = {1},
pages = {8--12},
year = {1994},
url = {https://doi.org/10.1145/181886.181887},
doi = {10.1145/181886.181887},
timestamp = {Tue, 29 Mar 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Donaldson94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox94,
author = {Edward A. Fox},
title = {Chairman's Message},
journal = {{SIGIR} Forum},
volume = {28},
number = {1},
pages = {1--2},
year = {1994},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Fox94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox94a,
author = {Christopher J. Fox},
title = {Editor's Message},
journal = {{SIGIR} Forum},
volume = {28},
number = {1},
pages = {3},
year = {1994},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Fox94a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox94b,
author = {Edward A. Fox},
title = {Chairman's Message},
journal = {{SIGIR} Forum},
volume = {28},
number = {2},
pages = {1--3},
year = {1994},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Fox94b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Gudivada94,
author = {Venkat N. Gudivada},
title = {{TESSA} - An Image Testbed for Evaluating 2-D Spatial Similarity Algorithms},
journal = {{SIGIR} Forum},
volume = {28},
number = {2},
pages = {17--36},
year = {1994},
url = {https://doi.org/10.1145/195498.195502},
doi = {10.1145/195498.195502},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Gudivada94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Marcus94,
author = {Richard S. Marcus},
title = {The {RIAO} 94 Conference and the Status of Information Retrieval:
{A} Personal View},
journal = {{SIGIR} Forum},
volume = {28},
number = {2},
pages = {7--16},
year = {1994},
url = {https://doi.org/10.1145/195498.195500},
doi = {10.1145/195498.195500},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Marcus94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ParkASA94,
author = {Ki{-}Hong Park and
Jun{-}ichi Aoe and
Masami Shishibori and
Hisatoshi Arita},
title = {An Automatic Selection Method of Key Search Algorithms Based on Expert
Knowledge Bases},
journal = {{SIGIR} Forum},
volume = {28},
number = {1},
pages = {13--26},
year = {1994},
url = {https://doi.org/10.1145/181886.181888},
doi = {10.1145/181886.181888},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ParkASA94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Stanfill94,
author = {Craig Stanfill},
title = {Minutes - 1993 {SIGIR} Annual Meeting},
journal = {{SIGIR} Forum},
volume = {28},
number = {1},
pages = {4--7},
year = {1994},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Stanfill94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Taghva94,
author = {Kazem Taghva},
title = {Information Retrieval Education Survey},
journal = {{SIGIR} Forum},
volume = {28},
number = {2},
pages = {4--6},
year = {1994},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Taghva94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X94,
title = {Title},
journal = {{SIGIR} Forum},
volume = {28},
number = {1},
year = {1994},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X94.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X94a,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {28},
number = {1},
pages = {27--45},
year = {1994},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X94a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X94b,
title = {Title},
journal = {{SIGIR} Forum},
volume = {28},
number = {2},
year = {1994},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X94b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X94c,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {28},
number = {2},
pages = {37--49},
year = {1994},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X94c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Can93,
author = {Fazli Can},
title = {Information Retrieval Data Structures {\&} Algorithms, by William
B. Frakes and Ricardo Baeza-Yates (Book Review)},
journal = {{SIGIR} Forum},
volume = {27},
number = {3},
pages = {24--25},
year = {1993},
url = {https://doi.org/10.1145/182119.1096164},
doi = {10.1145/182119.1096164},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Can93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox93,
author = {Edward A. Fox},
title = {Chairman's Message},
journal = {{SIGIR} Forum},
volume = {27},
number = {1},
pages = {1--2},
year = {1993},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Fox93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox93a,
author = {Edward A. Fox},
title = {Chairman's Message},
journal = {{SIGIR} Forum},
volume = {27},
number = {3},
pages = {1--3},
year = {1993},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Fox93a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harman93,
author = {Donna Harman},
title = {Report on {TREC-2} (Text REtrieval Conference) 30 August - 2 September,
Gaithersburg, {USA}},
journal = {{SIGIR} Forum},
volume = {27},
number = {3},
pages = {14--18},
year = {1993},
url = {https://doi.org/10.1145/182119.182121},
doi = {10.1145/182119.182121},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Harman93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harman93a,
author = {Donna Harman},
title = {The Third Text REtrieval Conference {(TREC-3)} January 1994 - November
1994},
journal = {{SIGIR} Forum},
volume = {27},
number = {3},
pages = {19--23},
year = {1993},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Harman93a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey93,
author = {Susanne M. Humphrey},
title = {Selected IR-Releated Dissertation Abstracts},
journal = {{SIGIR} Forum},
volume = {27},
number = {1},
pages = {22--47},
year = {1993},
url = {https://doi.org/10.1145/174263.1096175},
doi = {10.1145/174263.1096175},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Humphrey93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Koshman93,
author = {Sherry Koshman},
title = {{SIGIR} 1993 - Report},
journal = {{SIGIR} Forum},
volume = {27},
number = {3},
pages = {5--11},
year = {1993},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Koshman93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Mukhopadhyay93,
author = {Debajyoti Mukhopadhyay},
title = {A Generic Information Retrieval System to Support Interoperability},
journal = {{SIGIR} Forum},
volume = {27},
number = {1},
pages = {14--21},
year = {1993},
url = {https://doi.org/10.1145/174263.174265},
doi = {10.1145/174263.174265},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Mukhopadhyay93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Perlman93,
author = {Gary Perlman},
title = {The {HCI} Bibliography Project},
journal = {{SIGIR} Forum},
volume = {27},
number = {3},
pages = {29--31},
year = {1993},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Perlman93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/TianTY93,
author = {Zhiyu Tian and
Shibai Tong and
Shiyuan Yang},
title = {A New Hashing Function: Statistical Bahaviour and Algorithm},
journal = {{SIGIR} Forum},
volume = {27},
number = {1},
pages = {3--13},
year = {1993},
url = {https://doi.org/10.1145/174263.174264},
doi = {10.1145/174263.174264},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/TianTY93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X93,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {27},
number = {3},
pages = {32--55},
year = {1993},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X93.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X93a,
title = {Title},
journal = {{SIGIR} Forum},
volume = {27},
number = {1},
year = {1993},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X93a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X93b,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {27},
number = {1},
pages = {48--60},
year = {1993},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X93b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X93c,
title = {Title},
journal = {{SIGIR} Forum},
volume = {27},
number = {3},
year = {1993},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X93c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X93d,
title = {Member Survey},
journal = {{SIGIR} Forum},
volume = {27},
number = {3},
pages = {4},
year = {1993},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X93d.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X93e,
title = {{SIGIR} 1994 - Call for Papers},
journal = {{SIGIR} Forum},
volume = {27},
number = {3},
pages = {13},
year = {1993},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X93e.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X93f,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {27},
number = {3},
pages = {26--27},
year = {1993},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X93f.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Croft92,
author = {W. Bruce Croft},
title = {The University of Massachusetts {TIPSTER} Project},
journal = {{SIGIR} Forum},
volume = {26},
number = {2},
pages = {29--33},
year = {1992},
url = {https://doi.org/10.1145/146565.146568},
doi = {10.1145/146565.146568},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Croft92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/DuvalO92,
author = {Erik Duval and
Henk J. Olivi{\'{e}}},
title = {Towards the Integration of a Query Mechanism and Navigation for Retrieval
of Data on Multimedia Documents},
journal = {{SIGIR} Forum},
volume = {26},
number = {2},
pages = {8--25},
year = {1992},
url = {https://doi.org/10.1145/146565.146566},
doi = {10.1145/146565.146566},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/DuvalO92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox92,
author = {Edward A. Fox},
title = {Chairman's Message},
journal = {{SIGIR} Forum},
volume = {26},
number = {1},
pages = {1},
year = {1992},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Fox92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox92a,
author = {Edward A. Fox},
title = {Chairman's Message},
journal = {{SIGIR} Forum},
volume = {26},
number = {2},
pages = {2--3},
year = {1992},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Fox92a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Frakes92,
author = {William B. Frakes},
title = {From the Editor},
journal = {{SIGIR} Forum},
volume = {26},
number = {2},
pages = {1},
year = {1992},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Frakes92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GallantHCQCS92,
author = {Stephen I. Gallant and
Robert Hecht{-}Nielsen and
William R. Caid and
Kent Pu Qing and
Joel Carleton and
David Sudbeck},
title = {HNC's MatchPlus System},
journal = {{SIGIR} Forum},
volume = {26},
number = {2},
pages = {34--38},
year = {1992},
url = {https://doi.org/10.1145/146565.146569},
doi = {10.1145/146565.146569},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/GallantHCQCS92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harman92,
author = {Donna Harman},
title = {The {DARPA} {TIPSTER} Project},
journal = {{SIGIR} Forum},
volume = {26},
number = {2},
pages = {26--28},
year = {1992},
url = {https://doi.org/10.1145/146565.146567},
doi = {10.1145/146565.146567},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Harman92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey92,
author = {Susanne M. Humphrey},
title = {Selected IR-Related Dissertation Abstracts},
journal = {{SIGIR} Forum},
volume = {26},
number = {1},
pages = {17--46},
year = {1992},
url = {https://doi.org/10.1145/134374.1096744},
doi = {10.1145/134374.1096744},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Humphrey92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LiCG92,
author = {Tong Li and
Victoria Chiu and
Fredric C. Gey},
title = {X-Window Interface to SMART, an Advanced Text Retrieval System},
journal = {{SIGIR} Forum},
volume = {26},
number = {1},
pages = {5--16},
year = {1992},
url = {https://doi.org/10.1145/134374.134375},
doi = {10.1145/134374.134375},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LiCG92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/LiddyM92,
author = {Elizabeth D. Liddy and
Sung{-}Hyon Myaeng},
title = {{DR-LINK:} Document Retrieval Using Linguistic Knowledge},
journal = {{SIGIR} Forum},
volume = {26},
number = {2},
pages = {39--43},
year = {1992},
url = {https://doi.org/10.1145/146565.146570},
doi = {10.1145/146565.146570},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/LiddyM92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Stanfill92,
author = {Craig Stanfill},
title = {{SIGIR} Annual Business Meeting Copenhagen, Denmark 23 June 1992},
journal = {{SIGIR} Forum},
volume = {26},
number = {2},
pages = {4--7},
year = {1992},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Stanfill92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Weiner92,
author = {John Weiner},
title = {Letter to the Editor},
journal = {{SIGIR} Forum},
volume = {26},
number = {1},
pages = {2--4},
year = {1992},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Weiner92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X92,
title = {Title},
journal = {{SIGIR} Forum},
volume = {26},
number = {1},
year = {1992},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X92.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X92a,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {26},
number = {1},
pages = {47--56},
year = {1992},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X92a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X92b,
title = {Title},
journal = {{SIGIR} Forum},
volume = {26},
number = {2},
year = {1992},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X92b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X92c,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {26},
number = {2},
pages = {44--63},
year = {1992},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X92c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Aoki91,
author = {Paul M. Aoki},
title = {Implementation of Extended Indexes in {POSTGRES}},
journal = {{SIGIR} Forum},
volume = {25},
number = {1},
pages = {2--9},
year = {1991},
url = {https://doi.org/10.1145/122642.122643},
doi = {10.1145/122642.122643},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Aoki91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BruzaW91,
author = {Peter Bruza and
Theo P. van der Weide},
title = {The Modelling and Retrieval of Documents Using Index Expressions},
journal = {{SIGIR} Forum},
volume = {25},
number = {2},
pages = {91--103},
year = {1991},
url = {https://doi.org/10.1145/122665.122668},
doi = {10.1145/122665.122668},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/BruzaW91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Can91,
author = {Fazli Can},
title = {Hypertext and Hypermedia by Jakob Nielsen (Book Review)},
journal = {{SIGIR} Forum},
volume = {25},
number = {1},
pages = {24--25},
year = {1991},
url = {https://doi.org/10.1145/122642.1096778},
doi = {10.1145/122642.1096778},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Can91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox91,
author = {Christopher J. Fox},
title = {From the Editor},
journal = {{SIGIR} Forum},
volume = {25},
number = {1},
pages = {1},
year = {1991},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Fox91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox91a,
author = {Edward A. Fox},
title = {Chairman's Message},
journal = {{SIGIR} Forum},
volume = {25},
number = {2},
pages = {2--3},
year = {1991},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Fox91a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Frakes91,
author = {William B. Frakes},
title = {ReNews - The Electronic Software Reuse Newsletter},
journal = {{SIGIR} Forum},
volume = {25},
number = {1},
pages = {18--23},
year = {1991},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Frakes91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Frakes91a,
author = {William B. Frakes},
title = {Editor's Message},
journal = {{SIGIR} Forum},
volume = {25},
number = {2},
pages = {1},
year = {1991},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Frakes91a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey91,
author = {Susanne M. Humphrey},
title = {Selected IR-Related Dissertation Abstracts},
journal = {{SIGIR} Forum},
volume = {25},
number = {1},
pages = {26--60},
year = {1991},
url = {https://doi.org/10.1145/122642.1096779},
doi = {10.1145/122642.1096779},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Humphrey91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey91a,
author = {Susanne M. Humphrey},
title = {Selected IR-Related Dissertation Abstracts},
journal = {{SIGIR} Forum},
volume = {25},
number = {2},
pages = {106--136},
year = {1991},
url = {https://doi.org/10.1145/122665.1096777},
doi = {10.1145/122665.1096777},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Humphrey91a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HumphreyF91,
author = {Susanne M. Humphrey and
William B. Frakes},
title = {Bibliography of Software Reuse: 1988-1991},
journal = {{SIGIR} Forum},
volume = {25},
number = {2},
pages = {24--90},
year = {1991},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/HumphreyF91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Jones91,
author = {Karen Sparck Jones},
title = {Notes and References on Early Automatic Classification Work},
journal = {{SIGIR} Forum},
volume = {25},
number = {1},
pages = {10--17},
year = {1991},
url = {https://doi.org/10.1145/122642.122644},
doi = {10.1145/122642.122644},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Jones91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KorfhageY91,
author = {Robert R. Korfhage and
Jing{-}Jye Yang},
title = {A Cautionary Tale},
journal = {{SIGIR} Forum},
volume = {25},
number = {2},
pages = {104--105},
year = {1991},
url = {https://doi.org/10.1145/122665.122669},
doi = {10.1145/122665.122669},
timestamp = {Tue, 06 Dec 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KorfhageY91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lesk91,
author = {Michael Lesk},
title = {{SIGIR} '91: The Move Things Change, the More They Stay The Same},
journal = {{SIGIR} Forum},
volume = {25},
number = {2},
pages = {4--7},
year = {1991},
url = {https://doi.org/10.1145/122665.122666},
doi = {10.1145/122665.122666},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Lesk91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Maarek91,
author = {Yo{\"{e}}lle S. Maarek},
title = {Software Library Construction from an {IR} Perspective},
journal = {{SIGIR} Forum},
volume = {25},
number = {2},
pages = {8--18},
year = {1991},
url = {https://doi.org/10.1145/122665.122667},
doi = {10.1145/122665.122667},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Maarek91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X91,
title = {AdaNET},
journal = {{SIGIR} Forum},
volume = {25},
number = {2},
pages = {19--23},
year = {1991},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X91.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X91a,
title = {Title},
journal = {{SIGIR} Forum},
volume = {25},
number = {1},
year = {1991},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X91a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X91b,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {25},
number = {1},
pages = {61--80},
year = {1991},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X91b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X91c,
title = {Title},
journal = {{SIGIR} Forum},
volume = {25},
number = {2},
year = {1991},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X91c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X91d,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {25},
number = {2},
pages = {137--152},
year = {1991},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X91d.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Aoe90,
author = {Jun{-}ichi Aoe},
title = {A Method for Building Knowledge Bases with Morphological Semantics},
journal = {{SIGIR} Forum},
volume = {24},
number = {1-2},
pages = {11--18},
year = {1990},
url = {https://doi.org/10.1145/378881.378887},
doi = {10.1145/378881.378887},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Aoe90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Aoe90a,
author = {Jun{-}ichi Aoe},
title = {A Compendium of Key Search References},
journal = {{SIGIR} Forum},
volume = {24},
number = {3},
pages = {26--42},
year = {1990},
url = {https://doi.org/10.1145/101306.101308},
doi = {10.1145/101306.101308},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Aoe90a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belkin90,
author = {Nicholas J. Belkin},
title = {{ACM} {SIGIR} Annual General Meeting, Brussels, 7 September 1990},
journal = {{SIGIR} Forum},
volume = {24},
number = {3},
pages = {3--5},
year = {1990},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Belkin90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Bruza90,
author = {Peter Bruza},
title = {Language and Representation in Information Retrieval by D. C. Blair
(Book Review)},
journal = {{SIGIR} Forum},
volume = {24},
number = {3},
pages = {74--75},
year = {1990},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Bruza90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/BruzaW90,
author = {Peter Bruza and
Theo P. van der Weide},
title = {Assessing the Quality of Hypertext Views},
journal = {{SIGIR} Forum},
volume = {24},
number = {3},
pages = {6--25},
year = {1990},
url = {https://doi.org/10.1145/101306.101307},
doi = {10.1145/101306.101307},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/BruzaW90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Can90,
author = {Fazli Can},
title = {An Introduction to Text Processing, Peter D. Smith (Book Review)},
journal = {{SIGIR} Forum},
volume = {24},
number = {3},
pages = {72--73},
year = {1990},
url = {https://doi.org/10.1145/101306.1096780},
doi = {10.1145/101306.1096780},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Can90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Craft90,
author = {W. Bruce Croft},
title = {Chairman's Message},
journal = {{SIGIR} Forum},
volume = {24},
number = {3},
pages = {2},
year = {1990},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Craft90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox90,
author = {Christopher J. Fox},
title = {A Stop List for General Text},
journal = {{SIGIR} Forum},
volume = {24},
number = {1-2},
pages = {19--35},
year = {1990},
url = {https://doi.org/10.1145/378881.378888},
doi = {10.1145/378881.378888},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Fox90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox90a,
author = {Christopher J. Fox},
title = {From the Editor},
journal = {{SIGIR} Forum},
volume = {24},
number = {1-2},
pages = {1},
year = {1990},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Fox90a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Frakes90,
author = {William B. Frakes},
title = {From the Editor},
journal = {{SIGIR} Forum},
volume = {24},
number = {3},
pages = {1},
year = {1990},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Frakes90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FrakesP90,
author = {William B. Frakes and
Thomas P. Pole},
title = {Proteus: {A} Software Reuse Library System that Supports Multiple
Representation Methods},
journal = {{SIGIR} Forum},
volume = {24},
number = {3},
pages = {43--55},
year = {1990},
url = {https://doi.org/10.1145/101306.101309},
doi = {10.1145/101306.101309},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/FrakesP90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey90,
author = {Susanne M. Humphrey},
title = {Selected IR-Related Dissertation Abstracts},
journal = {{SIGIR} Forum},
volume = {24},
number = {1-2},
pages = {40--83},
year = {1990},
url = {https://doi.org/10.1145/378881.378890},
doi = {10.1145/378881.378890},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Humphrey90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey90a,
author = {Susanne M. Humphrey},
title = {Selected IR-Related Dessertation Abstracts},
journal = {{SIGIR} Forum},
volume = {24},
number = {3},
pages = {85--111},
year = {1990},
url = {https://doi.org/10.1145/101306.1096783},
doi = {10.1145/101306.1096783},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Humphrey90a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Nielsen90,
author = {Jakob Nielsen},
title = {Three Medium-Sized Hypertexts on {CD-ROM}},
journal = {{SIGIR} Forum},
volume = {24},
number = {1-2},
pages = {2--10},
year = {1990},
url = {https://doi.org/10.1145/378881.378885},
doi = {10.1145/378881.378885},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Nielsen90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Paice90,
author = {Chris D. Paice},
title = {Another Stemmer},
journal = {{SIGIR} Forum},
volume = {24},
number = {3},
pages = {56--61},
year = {1990},
url = {https://doi.org/10.1145/101306.101310},
doi = {10.1145/101306.101310},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Paice90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton90,
author = {Gerard Salton},
title = {IR-Related Abstracts},
journal = {{SIGIR} Forum},
volume = {24},
number = {1-2},
pages = {36--39},
year = {1990},
url = {https://doi.org/10.1145/378881.378889},
doi = {10.1145/378881.378889},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Salton90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton90a,
author = {Gerard Salton},
title = {Information Retrieval Abstracts},
journal = {{SIGIR} Forum},
volume = {24},
number = {3},
pages = {76--84},
year = {1990},
url = {https://doi.org/10.1145/101306.1096782},
doi = {10.1145/101306.1096782},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Salton90a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Savoy90,
author = {Jacques Savoy},
title = {Statistical Behavior of Fast Hashing of Variable-Length Text Strings},
journal = {{SIGIR} Forum},
volume = {24},
number = {3},
pages = {62--71},
year = {1990},
url = {https://doi.org/10.1145/101306.101311},
doi = {10.1145/101306.101311},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Savoy90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X90,
title = {Title},
journal = {{SIGIR} Forum},
volume = {24},
number = {1-2},
year = {1990},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X90.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X90a,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {24},
number = {1-2},
pages = {84--114},
year = {1990},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X90a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X90b,
title = {Title},
journal = {{SIGIR} Forum},
volume = {24},
number = {3},
year = {1990},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X90b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X90c,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {24},
number = {3},
pages = {112--132},
year = {1990},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X90c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Aoe89,
author = {Jun{-}Ichi Aoe},
title = {Storing a Tree Structure by Using Decimal Notations},
journal = {{SIGIR} Forum},
volume = {23},
number = {3-4},
pages = {8--21},
year = {1989},
url = {https://doi.org/10.1145/74697.74698},
doi = {10.1145/74697.74698},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Aoe89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Aoe89a,
author = {Jun{-}Ichi Aoe},
title = {An Efficient Implementation of String Pattern Matching Machines for
a Finite Number of Keywords},
journal = {{SIGIR} Forum},
volume = {23},
number = {3-4},
pages = {22--33},
year = {1989},
url = {https://doi.org/10.1145/74697.74699},
doi = {10.1145/74697.74699},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Aoe89a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Baeza-Yates89,
author = {Ricardo A. Baeza{-}Yates},
title = {Algorithms for String Searching: {A} Survey},
journal = {{SIGIR} Forum},
volume = {23},
number = {3-4},
pages = {34--58},
year = {1989},
url = {https://doi.org/10.1145/74697.74700},
doi = {10.1145/74697.74700},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Baeza-Yates89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Baeza-YatesG89,
author = {Ricardo A. Baeza{-}Yates and
Gaston H. Gonnet},
title = {A New Approach to Text Searching (correction)},
journal = {{SIGIR} Forum},
volume = {23},
number = {3-4},
pages = {7},
year = {1989},
url = {https://doi.org/10.1145/75335.75352},
doi = {10.1145/75335.75352},
timestamp = {Mon, 26 Oct 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Baeza-YatesG89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Belkin89,
author = {Nicholas J. Belkin},
title = {Minutes from {SIGIR} Meeting 1989},
journal = {{SIGIR} Forum},
volume = {23},
number = {3-4},
pages = {3--6},
year = {1989},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Belkin89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/ColinL89,
author = {Cathi Colin and
Robert Levinson},
title = {Partial Order Maintenance},
journal = {{SIGIR} Forum},
volume = {23},
number = {3-4},
pages = {59--88},
year = {1989},
url = {https://doi.org/10.1145/74697.74701},
doi = {10.1145/74697.74701},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/ColinL89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Croft89,
author = {W. Bruce Croft},
title = {Chairman's Message},
journal = {{SIGIR} Forum},
volume = {23},
number = {3-4},
pages = {2},
year = {1989},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Croft89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Frakes89,
author = {William B. Frakes},
title = {From the Editor},
journal = {{SIGIR} Forum},
volume = {23},
number = {3-4},
pages = {1},
year = {1989},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Frakes89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/GeyC89,
author = {Fredric C. Gey and
Wingkei Chan},
title = {Comparing Vector Space Retrieval with the {RUBRIC} Expert System},
journal = {{SIGIR} Forum},
volume = {23},
number = {1-2},
pages = {5--15},
year = {1989},
url = {https://doi.org/10.1145/1095483.1095484},
doi = {10.1145/1095483.1095484},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/GeyC89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HarmanC89,
author = {Donna Harman and
Gerald T. Candela},
title = {A Very Fast Prototype Retrieval System Using Statistical Ranking},
journal = {{SIGIR} Forum},
volume = {23},
number = {3-4},
pages = {100--110},
year = {1989},
url = {https://doi.org/10.1145/74697.74703},
doi = {10.1145/74697.74703},
timestamp = {Tue, 22 Jun 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/HarmanC89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey89,
author = {Susanne M. Humphrey},
title = {Selected IR-Related Dessertation Abstracts},
journal = {{SIGIR} Forum},
volume = {23},
number = {1-2},
pages = {26--35},
year = {1989},
url = {https://doi.org/10.1145/1095483.1095486},
doi = {10.1145/1095483.1095486},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Humphrey89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey89a,
author = {Susanne M. Humphrey},
title = {Selected IR-Related Dissertation Abstracts},
journal = {{SIGIR} Forum},
volume = {23},
number = {3-4},
pages = {114--122},
year = {1989},
url = {https://doi.org/10.1145/74697.1096799},
doi = {10.1145/74697.1096799},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Humphrey89a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/KuoC89,
author = {Shufen Kuo and
George R. Cross},
title = {An Improved Algorithm to Find the Length of the Longest Common Subsequence
of Two Strings},
journal = {{SIGIR} Forum},
volume = {23},
number = {3-4},
pages = {89--99},
year = {1989},
url = {https://doi.org/10.1145/74697.74702},
doi = {10.1145/74697.74702},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/KuoC89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Raghavan89,
author = {Vijay V. Raghavan},
title = {From the Editor},
journal = {{SIGIR} Forum},
volume = {23},
number = {1-2},
pages = {1},
year = {1989},
timestamp = {Mon, 26 Oct 2015 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Raghavan89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton89,
author = {Gerard Salton},
title = {Abstracts from Recent Issues of Journals in the Retrieval Area},
journal = {{SIGIR} Forum},
volume = {23},
number = {1-2},
pages = {16--25},
year = {1989},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Salton89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton89a,
author = {Gerard Salton},
title = {Abstracts Chosen from Recent Issues of Journals in the Retrieval Area},
journal = {{SIGIR} Forum},
volume = {23},
number = {3-4},
pages = {123--138},
year = {1989},
url = {https://doi.org/10.1145/74697.1096800},
doi = {10.1145/74697.1096800},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Salton89a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Singer89,
author = {Robin Singer},
title = {Crafting Knowledge Based Systems, Expert Systems Made Realistic (book
review)},
journal = {{SIGIR} Forum},
volume = {23},
number = {3-4},
pages = {111--113},
year = {1989},
url = {https://doi.org/10.1145/74697.1096798},
doi = {10.1145/74697.1096798},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Singer89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WeyerO89,
author = {Stephen A. Weyer and
Tim Oren},
title = {{IR} Activities at Apple Computer Inc., ... Institutional Sponsor
Report},
journal = {{SIGIR} Forum},
volume = {23},
number = {1-2},
pages = {4},
year = {1989},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/WeyerO89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X89,
title = {Title},
journal = {{SIGIR} Forum},
volume = {23},
number = {1-2},
year = {1989},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X89.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X89a,
title = {Institutional Sponsorship Program},
journal = {{SIGIR} Forum},
volume = {23},
number = {1-2},
pages = {2--3},
year = {1989},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X89a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X89b,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {23},
number = {1-2},
pages = {36--48},
year = {1989},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X89b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X89c,
title = {Title},
journal = {{SIGIR} Forum},
volume = {23},
number = {3-4},
year = {1989},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X89c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X89d,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {23},
number = {3-4},
pages = {139--157},
year = {1989},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X89d.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Croft88,
author = {W. Bruce Croft},
title = {Chairman's Message},
journal = {{SIGIR} Forum},
volume = {22},
number = {1-2},
pages = {1},
year = {1988},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Croft88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox88,
author = {Edward A. Fox},
title = {New from the Vice Chairman},
journal = {{SIGIR} Forum},
volume = {22},
number = {1-2},
pages = {2},
year = {1988},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Fox88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox88a,
author = {Edward A. Fox},
title = {{SIGIR} Session at {ASIS} 50th Anniversary Conference / Microsoft's
Third Int. {CDROM} Conference},
journal = {{SIGIR} Forum},
volume = {22},
number = {1-2},
pages = {27--28},
year = {1988},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Fox88a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Frakes88,
author = {William B. Frakes},
title = {From the Editor},
journal = {{SIGIR} Forum},
volume = {22},
number = {3-4},
pages = {1},
year = {1988},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Frakes88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Hanson88,
author = {Robin Hanson},
title = {Toward Hypertext Publishing: Issues and Choices in Database Design},
journal = {{SIGIR} Forum},
volume = {22},
number = {1-2},
pages = {9--26},
year = {1988},
url = {https://doi.org/10.1145/43936.43938},
doi = {10.1145/43936.43938},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Hanson88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HarmanBFHG88,
author = {Donna Harman and
Dennis A. Benson and
Larry Fitzpatrick and
Rand Huntzinger and
Charles Goldstein},
title = {{IRX:} An Information Retrieval System for Experimentation and User
Applications},
journal = {{SIGIR} Forum},
volume = {22},
number = {3-4},
pages = {2--10},
year = {1988},
url = {https://doi.org/10.1145/54347.54348},
doi = {10.1145/54347.54348},
timestamp = {Fri, 27 May 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/HarmanBFHG88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey88,
author = {Susanne M. Humphrey},
title = {Selected IR-Related Dissertation Abstracts},
journal = {{SIGIR} Forum},
volume = {22},
number = {1-2},
pages = {38--51},
year = {1988},
url = {https://doi.org/10.1145/43936.1096827},
doi = {10.1145/43936.1096827},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Humphrey88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey88a,
author = {Susanne M. Humphrey},
title = {Disertation Abstracts},
journal = {{SIGIR} Forum},
volume = {22},
number = {3-4},
pages = {29--51},
year = {1988},
url = {https://doi.org/10.1145/54347.1096814},
doi = {10.1145/54347.1096814},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Humphrey88a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/McGuiness88,
author = {Deborah L. McGuinness},
title = {Remarks on the 11th International Conference on Research and Development
in Information Retrieval},
journal = {{SIGIR} Forum},
volume = {22},
number = {3-4},
pages = {52--59},
year = {1988},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/McGuiness88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Meadow88,
author = {Charles T. Meadow},
title = {Comment on Some Recent Comments on Information Retrieval},
journal = {{SIGIR} Forum},
volume = {22},
number = {1-2},
pages = {5--8},
year = {1988},
url = {https://doi.org/10.1145/43936.43937},
doi = {10.1145/43936.43937},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Meadow88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton88,
author = {Gerard Salton},
title = {Abstracts Selected from Recent Issues of Journals in the Retrieval
Area},
journal = {{SIGIR} Forum},
volume = {22},
number = {1-2},
pages = {29--37},
year = {1988},
url = {https://doi.org/10.1145/43936.1096826},
doi = {10.1145/43936.1096826},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Salton88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/WoodS88,
author = {Murray Wood and
Ian Sommerville},
title = {An Information Retrieval System for Software Components},
journal = {{SIGIR} Forum},
volume = {22},
number = {3-4},
pages = {11--28},
year = {1988},
url = {https://doi.org/10.1145/54347.54349},
doi = {10.1145/54347.54349},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/WoodS88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X88,
title = {Title},
journal = {{SIGIR} Forum},
volume = {22},
number = {1-2},
year = {1988},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X88.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X88a,
title = {Institutional Sponsorship Program},
journal = {{SIGIR} Forum},
volume = {22},
number = {1-2},
pages = {3--4},
year = {1988},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X88a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X88b,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {22},
number = {1-2},
pages = {52--68},
year = {1988},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X88b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X88c,
title = {Title},
journal = {{SIGIR} Forum},
volume = {22},
number = {3-4},
year = {1988},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X88c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X88d,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {22},
number = {3-4},
pages = {60--68},
year = {1988},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X88d.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Eastman87,
author = {Caroline M. Eastman},
title = {The First International Conference on Expert Database Systems: {A}
Summary},
journal = {{SIGIR} Forum},
volume = {21},
number = {1-2},
pages = {6--10},
year = {1987},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Eastman87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox87,
author = {Edward A. Fox},
title = {Workshop on Distributed Expert-Based Information Systems: {A} Perspective},
journal = {{SIGIR} Forum},
volume = {21},
number = {3-4},
pages = {18--20},
year = {1987},
url = {https://doi.org/10.1145/30075.30078},
doi = {10.1145/30075.30078},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Fox87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Fox87a,
author = {Edward A. Fox},
title = {From the Editor / Growth of IRList Digest},
journal = {{SIGIR} Forum},
volume = {21},
number = {1-2},
pages = {1},
year = {1987},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Fox87a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/FrakesN87,
author = {William B. Frakes and
Brian A. Nejmeh},
title = {Software Reuse Through Information Retrieval},
journal = {{SIGIR} Forum},
volume = {21},
number = {1-2},
pages = {30--36},
year = {1987},
url = {https://doi.org/10.1145/24634.24636},
doi = {10.1145/24634.24636},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/FrakesN87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Harman87,
author = {Donna Harman},
title = {From the Treasurer},
journal = {{SIGIR} Forum},
volume = {21},
number = {1-2},
pages = {2},
year = {1987},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Harman87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey87,
author = {Susanne M. Humphrey},
title = {Selected IR-Related Dissertation Abstracts},
journal = {{SIGIR} Forum},
volume = {21},
number = {3-4},
pages = {38--45},
year = {1987},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Humphrey87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Marcus87,
author = {Robert Marcus},
title = {Some Observations on Retrieval From a Large Technical Document Database},
journal = {{SIGIR} Forum},
volume = {21},
number = {1-2},
pages = {37--38},
year = {1987},
url = {https://doi.org/10.1145/24634.24637},
doi = {10.1145/24634.24637},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Marcus87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Rijsbergen87,
author = {C. J. van Rijsbergen},
title = {A New Theoretical Framework for Information Retrieval},
journal = {{SIGIR} Forum},
volume = {21},
number = {1-2},
pages = {23--29},
year = {1987},
url = {https://doi.org/10.1145/24634.24635},
doi = {10.1145/24634.24635},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Rijsbergen87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton87,
author = {Gerard Salton},
title = {Abstracts of Articles in the Information Retrieval Area},
journal = {{SIGIR} Forum},
volume = {21},
number = {1-2},
pages = {39--50},
year = {1987},
url = {https://doi.org/10.1145/24634.1096830},
doi = {10.1145/24634.1096830},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Salton87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton87a,
author = {Gerard Salton},
title = {Expert Systems and Information Retrieval},
journal = {{SIGIR} Forum},
volume = {21},
number = {3-4},
pages = {3--9},
year = {1987},
url = {https://doi.org/10.1145/30075.30076},
doi = {10.1145/30075.30076},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Salton87a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Salton87b,
author = {Gerard Salton},
title = {Selected from Recent Issues of Journals},
journal = {{SIGIR} Forum},
volume = {21},
number = {3-4},
pages = {22--37},
year = {1987},
url = {https://doi.org/10.1145/30075.1096829},
doi = {10.1145/30075.1096829},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Salton87b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Tague87,
author = {Jean Tague},
title = {Informativeness as an Ordinal Utility Function for Information Retrieval},
journal = {{SIGIR} Forum},
volume = {21},
number = {3-4},
pages = {10--17},
year = {1987},
url = {https://doi.org/10.1145/30075.30077},
doi = {10.1145/30075.30077},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Tague87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Wyle87,
author = {Mitchell F. Wyle},
title = {Annotated Bibliography Relating to Automatic Indexing in Information
Retrieval},
journal = {{SIGIR} Forum},
volume = {21},
number = {1-2},
pages = {51--60},
year = {1987},
url = {https://doi.org/10.1145/24634.1096831},
doi = {10.1145/24634.1096831},
timestamp = {Wed, 21 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Wyle87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X87,
title = {Remarks on the {ACM} {SIGIR} Conference in Pisa, September 1986},
journal = {{SIGIR} Forum},
volume = {21},
number = {1-2},
pages = {4--5},
year = {1987},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X87.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X87a,
title = {Fiscal Year 1986 Research Projects Funded by the Information Science
Program},
journal = {{SIGIR} Forum},
volume = {21},
number = {1-2},
pages = {11--22},
year = {1987},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X87a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X87b,
title = {Database System Concept by Henry F. Korth and Abraham Silberschatz},
journal = {{SIGIR} Forum},
volume = {21},
number = {3-4},
pages = {21},
year = {1987},
url = {https://doi.org/10.1145/30075.1096828},
doi = {10.1145/30075.1096828},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/X87b.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X87c,
title = {Title},
journal = {{SIGIR} Forum},
volume = {21},
number = {1-2},
year = {1987},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X87c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X87d,
title = {New Arrangement between {SIGIR} and IP{\&}M},
journal = {{SIGIR} Forum},
volume = {21},
number = {1-2},
pages = {3},
year = {1987},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X87d.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/X87e,
title = {Announcements},
journal = {{SIGIR} Forum},
volume = {21},
number = {1-2},
pages = {61--65},
year = {1987},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/X87e.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Dalphin86,
author = {John F. Dalphin},
title = {Recommendations for Visitors for the Computing Sciences Accreditation
Commitee},
journal = {{SIGIR} Forum},
volume = {19},
number = {1-4},
pages = {8},
year = {1986},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Dalphin86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Doszkocs86,
author = {Tamas E. Doszkocs},
title = {Natural Language User Interfaces for Information Retrieval},
journal = {{SIGIR} Forum},
volume = {19},
number = {1-4},
pages = {15--16},
year = {1986},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Doszkocs86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Frakes86,
author = {William B. Frakes},
title = {Information and Misinformation: An Investigation of the Notions of
Information, Misinformation, Informing and Misinforming by C. J. Fox
(Review)},
journal = {{SIGIR} Forum},
volume = {20},
number = {1-4},
pages = {22},
year = {1986},
url = {https://doi.org/10.1145/15497.1096832},
doi = {10.1145/15497.1096832},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Frakes86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Goldfarb86,
author = {Lev Goldfarb},
title = {Metric Data Models and Associated Search Strategies},
journal = {{SIGIR} Forum},
volume = {20},
number = {1-4},
pages = {7--11},
year = {1986},
url = {https://doi.org/10.1145/15497.15498},
doi = {10.1145/15497.15498},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Goldfarb86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Humphrey86,
author = {Susanne M. Humphrey},
title = {Automated Classification and Retrieval Program: Indexing Aid Project},
journal = {{SIGIR} Forum},
volume = {19},
number = {1-4},
pages = {16--17},
year = {1986},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Humphrey86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Kraft86,
author = {Donald H. Kraft},
title = {Research into Fuzzy Extensions of Information Retrieval},
journal = {{SIGIR} Forum},
volume = {20},
number = {1-4},
pages = {12--13},
year = {1986},
url = {https://doi.org/10.1145/15497.15499},
doi = {10.1145/15497.15499},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Kraft86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lesk86,
author = {Michael Lesk},
title = {Information in Data: Using the Oxford English Dictionary on a Computer},
journal = {{SIGIR} Forum},
volume = {20},
number = {1-4},
pages = {18--21},
year = {1986},
url = {https://doi.org/10.1145/15497.15502},
doi = {10.1145/15497.15502},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Lesk86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Lesk86a,
author = {Michael Lesk},
title = {Writing to be Searched: {A} Workshop on Document Generation Principles},
journal = {{SIGIR} Forum},
volume = {19},
number = {1-4},
pages = {9--14},
year = {1986},
url = {https://doi.org/10.1145/16287.16288},
doi = {10.1145/16287.16288},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Lesk86a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Martin86,
author = {Ann Martin},
title = {Database: {A} Primer by C. J. Date (Review)},
journal = {{SIGIR} Forum},
volume = {19},
number = {1-4},
pages = {23--24},
year = {1986},
url = {https://doi.org/10.1145/16287.1096835},
doi = {10.1145/16287.1096835},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Martin86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Rada86,
author = {Roy Rada},
title = {A Methodological Approach to Automatic Thesaurus Construction},
journal = {{SIGIR} Forum},
volume = {19},
number = {1-4},
pages = {17--18},
year = {1986},
timestamp = {Wed, 19 Sep 2012 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/sigir/Rada86.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Rada86a,
author = {Roy Rada},
title = {Which Way for a Classification Scheme for Computers and Medicine},
journal = {{SIGIR} Forum},
volume = {19},
number = {1-4},
pages = {21--22},
year = {1986},
url = {https://doi.org/10.1145/16287.16290},
doi = {10.1145/16287.16290},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/sigir/Rada86a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
retrieved on 2024-05-05 06:17 CEST from data curated by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
