BibTeX records: Cliff Young

download as .bib file

@article{DBLP:journals/corr/abs-1910-01500,
  author    = {Peter Mattson and
               Christine Cheng and
               Cody Coleman and
               Greg Diamos and
               Paulius Micikevicius and
               David A. Patterson and
               Hanlin Tang and
               Gu{-}Yeon Wei and
               Peter Bailis and
               Victor Bittorf and
               David Brooks and
               Dehao Chen and
               Debojyoti Dutta and
               Udit Gupta and
               Kim M. Hazelwood and
               Andrew Hock and
               Xinyuan Huang and
               Bill Jia and
               Daniel Kang and
               David Kanter and
               Naveen Kumar and
               Jeffery Liao and
               Guokai Ma and
               Deepak Narayanan and
               Tayo Oguntebi and
               Gennady Pekhimenko and
               Lillian Pentecost and
               Vijay Janapa Reddi and
               Taylor Robie and
               Tom St. John and
               Carole{-}Jean Wu and
               Lingjie Xu and
               Cliff Young and
               Matei Zaharia},
  title     = {MLPerf Training Benchmark},
  journal   = {CoRR},
  volume    = {abs/1910.01500},
  year      = {2019}
}
@article{DBLP:journals/cacm/JouppiYPP18,
  author    = {Norman P. Jouppi and
               Cliff Young and
               Nishant Patil and
               David A. Patterson},
  title     = {A domain-specific architecture for deep neural networks},
  journal   = {Commun. {ACM}},
  volume    = {61},
  number    = {9},
  pages     = {50--59},
  year      = {2018}
}
@article{DBLP:journals/micro/DeanPY18,
  author    = {Jeff Dean and
               David A. Patterson and
               Cliff Young},
  title     = {A New Golden Age in Computer Architecture: Empowering the Machine-Learning
               Revolution},
  journal   = {{IEEE} Micro},
  volume    = {38},
  number    = {2},
  pages     = {21--29},
  year      = {2018}
}
@article{DBLP:journals/micro/JouppiYPP18,
  author    = {Norman P. Jouppi and
               Cliff Young and
               Nishant Patil and
               David A. Patterson},
  title     = {Motivation for and Evaluation of the First Tensor Processing Unit},
  journal   = {{IEEE} Micro},
  volume    = {38},
  number    = {3},
  pages     = {10--19},
  year      = {2018}
}
@inproceedings{DBLP:conf/nips/ShazeerCPTVKHLH18,
  author    = {Noam Shazeer and
               Youlong Cheng and
               Niki Parmar and
               Dustin Tran and
               Ashish Vaswani and
               Penporn Koanantakool and
               Peter Hawkins and
               HyoukJoong Lee and
               Mingsheng Hong and
               Cliff Young and
               Ryan Sepassi and
               Blake A. Hechtman},
  title     = {Mesh-TensorFlow: Deep Learning for Supercomputers},
  booktitle = {NeurIPS},
  pages     = {10435--10444},
  year      = {2018}
}
@article{DBLP:journals/corr/abs-1811-02084,
  author    = {Noam Shazeer and
               Youlong Cheng and
               Niki Parmar and
               Dustin Tran and
               Ashish Vaswani and
               Penporn Koanantakool and
               Peter Hawkins and
               HyoukJoong Lee and
               Mingsheng Hong and
               Cliff Young and
               Ryan Sepassi and
               Blake A. Hechtman},
  title     = {Mesh-TensorFlow: Deep Learning for Supercomputers},
  journal   = {CoRR},
  volume    = {abs/1811.02084},
  year      = {2018}
}
@inproceedings{DBLP:conf/isca/JouppiYPPABBBBB17,
  author    = {Norman P. Jouppi and
               Cliff Young and
               Nishant Patil and
               David A. Patterson and
               Gaurav Agrawal and
               Raminder Bajwa and
               Sarah Bates and
               Suresh Bhatia and
               Nan Boden and
               Al Borchers and
               Rick Boyle and
               Pierre{-}luc Cantin and
               Clifford Chao and
               Chris Clark and
               Jeremy Coriell and
               Mike Daley and
               Matt Dau and
               Jeffrey Dean and
               Ben Gelb and
               Tara Vazir Ghaemmaghami and
               Rajendra Gottipati and
               William Gulland and
               Robert Hagmann and
               C. Richard Ho and
               Doug Hogberg and
               John Hu and
               Robert Hundt and
               Dan Hurt and
               Julian Ibarz and
               Aaron Jaffey and
               Alek Jaworski and
               Alexander Kaplan and
               Harshit Khaitan and
               Daniel Killebrew and
               Andy Koch and
               Naveen Kumar and
               Steve Lacy and
               James Laudon and
               James Law and
               Diemthu Le and
               Chris Leary and
               Zhuyuan Liu and
               Kyle Lucke and
               Alan Lundin and
               Gordon MacKean and
               Adriana Maggiore and
               Maire Mahony and
               Kieran Miller and
               Rahul Nagarajan and
               Ravi Narayanaswami and
               Ray Ni and
               Kathy Nix and
               Thomas Norrie and
               Mark Omernick and
               Narayana Penukonda and
               Andy Phelps and
               Jonathan Ross and
               Matt Ross and
               Amir Salek and
               Emad Samadiani and
               Chris Severn and
               Gregory Sizikov and
               Matthew Snelham and
               Jed Souter and
               Dan Steinberg and
               Andy Swing and
               Mercedes Tan and
               Gregory Thorson and
               Bo Tian and
               Horia Toma and
               Erick Tuttle and
               Vijay Vasudevan and
               Richard Walter and
               Walter Wang and
               Eric Wilcox and
               Doe Hyun Yoon},
  title     = {In-Datacenter Performance Analysis of a Tensor Processing Unit},
  booktitle = {{ISCA}},
  pages     = {1--12},
  publisher = {{ACM}},
  year      = {2017}
}
@article{DBLP:journals/corr/JouppiYPPABBBBB17,
  author    = {Norman P. Jouppi and
               Cliff Young and
               Nishant Patil and
               David A. Patterson and
               Gaurav Agrawal and
               Raminder Bajwa and
               Sarah Bates and
               Suresh Bhatia and
               Nan Boden and
               Al Borchers and
               Rick Boyle and
               Pierre{-}luc Cantin and
               Clifford Chao and
               Chris Clark and
               Jeremy Coriell and
               Mike Daley and
               Matt Dau and
               Jeffrey Dean and
               Ben Gelb and
               Tara Vazir Ghaemmaghami and
               Rajendra Gottipati and
               William Gulland and
               Robert Hagmann and
               Richard C. Ho and
               Doug Hogberg and
               John Hu and
               Robert Hundt and
               Dan Hurt and
               Julian Ibarz and
               Aaron Jaffey and
               Alek Jaworski and
               Alexander Kaplan and
               Harshit Khaitan and
               Andy Koch and
               Naveen Kumar and
               Steve Lacy and
               James Laudon and
               James Law and
               Diemthu Le and
               Chris Leary and
               Zhuyuan Liu and
               Kyle Lucke and
               Alan Lundin and
               Gordon MacKean and
               Adriana Maggiore and
               Maire Mahony and
               Kieran Miller and
               Rahul Nagarajan and
               Ravi Narayanaswami and
               Ray Ni and
               Kathy Nix and
               Thomas Norrie and
               Mark Omernick and
               Narayana Penukonda and
               Andy Phelps and
               Jonathan Ross and
               Amir Salek and
               Emad Samadiani and
               Chris Severn and
               Gregory Sizikov and
               Matthew Snelham and
               Jed Souter and
               Dan Steinberg and
               Andy Swing and
               Mercedes Tan and
               Gregory Thorson and
               Bo Tian and
               Horia Toma and
               Erick Tuttle and
               Vijay Vasudevan and
               Richard Walter and
               Walter Wang and
               Eric Wilcox and
               Doe Hyun Yoon},
  title     = {In-Datacenter Performance Analysis of a Tensor Processing Unit},
  journal   = {CoRR},
  volume    = {abs/1704.04760},
  year      = {2017}
}
@article{DBLP:journals/corr/WuSCLNMKCGMKSJL16,
  author    = {Yonghui Wu and
               Mike Schuster and
               Zhifeng Chen and
               Quoc V. Le and
               Mohammad Norouzi and
               Wolfgang Macherey and
               Maxim Krikun and
               Yuan Cao and
               Qin Gao and
               Klaus Macherey and
               Jeff Klingner and
               Apurva Shah and
               Melvin Johnson and
               Xiaobing Liu and
               Lukasz Kaiser and
               Stephan Gouws and
               Yoshikiyo Kato and
               Taku Kudo and
               Hideto Kazawa and
               Keith Stevens and
               George Kurian and
               Nishant Patil and
               Wei Wang and
               Cliff Young and
               Jason Smith and
               Jason Riesa and
               Alex Rudnick and
               Oriol Vinyals and
               Greg Corrado and
               Macduff Hughes and
               Jeffrey Dean},
  title     = {Google's Neural Machine Translation System: Bridging the Gap between
               Human and Machine Translation},
  journal   = {CoRR},
  volume    = {abs/1609.08144},
  year      = {2016}
}
@inproceedings{DBLP:conf/sc/ShawGBBBCDDEFFGGGHIIKLLLLLKMMMMNPQRSSSSSSTTTTVWY14,
  author    = {David E. Shaw and
               J. P. Grossman and
               Joseph A. Bank and
               Brannon Batson and
               J. Adam Butts and
               Jack C. Chao and
               Martin M. Deneroff and
               Ron O. Dror and
               Amos Even and
               Christopher H. Fenton and
               Anthony Forte and
               Joseph Gagliardo and
               Gennette Gill and
               Brian Greskamp and
               Richard C. Ho and
               Douglas J. Ierardi and
               Lev Iserovich and
               Jeffrey Kuskin and
               Richard H. Larson and
               Timothy Layman and
               Li{-}Siang Lee and
               Adam K. Lerer and
               Chester Li and
               Daniel Killebrew and
               Kenneth M. Mackenzie and
               Shark Yeuk{-}Hai Mok and
               Mark A. Moraes and
               Rolf Mueller and
               Lawrence J. Nociolo and
               Jon L. Peticolas and
               Terry Quan and
               Daniel Ramot and
               John K. Salmon and
               Daniele Paolo Scarpazza and
               U. Ben Schafer and
               Naseer Siddique and
               Christopher W. Snyder and
               Jochen Spengler and
               Ping Tak Peter Tang and
               Michael Theobald and
               Horia Toma and
               Brian Towles and
               Benjamin Vitale and
               Stanley C. Wang and
               Cliff Young},
  title     = {Anton 2: Raising the Bar for Performance and Programmability in a
               Special-Purpose Molecular Dynamics Supercomputer},
  booktitle = {{SC}},
  pages     = {41--53},
  publisher = {{IEEE} Computer Society},
  year      = {2014}
}
@inproceedings{DBLP:conf/asplos/GrossmanKBTDILSTYS13,
  author    = {J. P. Grossman and
               Jeffrey Kuskin and
               Joseph A. Bank and
               Michael Theobald and
               Ron O. Dror and
               Douglas J. Ierardi and
               Richard H. Larson and
               U. Ben Schafer and
               Brian Towles and
               Cliff Young and
               David E. Shaw},
  title     = {Hardware support for fine-grained event-driven computation in Anton
               2},
  booktitle = {{ASPLOS}},
  pages     = {549--560},
  publisher = {{ACM}},
  year      = {2013}
}
@article{DBLP:journals/micro/DrorGMTCSYBBSKLMS11,
  author    = {Ron O. Dror and
               J. P. Grossman and
               Kenneth M. Mackenzie and
               Brian Towles and
               Edmond Chow and
               John K. Salmon and
               Cliff Young and
               Joseph A. Bank and
               Brannon Batson and
               Martin M. Deneroff and
               Jeffrey Kuskin and
               Richard H. Larson and
               Mark A. Moraes and
               David E. Shaw},
  title     = {Overcoming Communication Latency Barriers in Massively Parallel Scientific
               Computation},
  journal   = {{IEEE} Micro},
  volume    = {31},
  number    = {3},
  pages     = {8--19},
  year      = {2011}
}
@incollection{DBLP:reference/parallel/DrorYS11,
  author    = {Ron O. Dror and
               Cliff Young and
               David E. Shaw},
  title     = {Anton, {A} Special-Purpose Molecular Simulation Machine},
  booktitle = {Encyclopedia of Parallel Computing},
  pages     = {60--71},
  publisher = {Springer},
  year      = {2011}
}
@incollection{DBLP:reference/parallel/FisherFY11,
  author    = {Joseph A. Fisher and
               Paolo Faraboschi and
               Cliff Young},
  title     = {{VLIW} Processors},
  booktitle = {Encyclopedia of Parallel Computing},
  pages     = {2135--2142},
  publisher = {Springer},
  year      = {2011}
}
@inproceedings{DBLP:conf/sc/DrorGMTCSYBBDKLMS10,
  author    = {Ron O. Dror and
               J. P. Grossman and
               Kenneth M. Mackenzie and
               Brian Towles and
               Edmond Chow and
               John K. Salmon and
               Cliff Young and
               Joseph A. Bank and
               Brannon Batson and
               Martin M. Deneroff and
               Jeffrey Kuskin and
               Richard H. Larson and
               Mark A. Moraes and
               David E. Shaw},
  title     = {Exploiting 162-Nanosecond End-to-End Communication Latency on Anton},
  booktitle = {{SC}},
  pages     = {1--12},
  publisher = {{IEEE}},
  year      = {2010}
}
@inproceedings{DBLP:conf/sc/ShawDSGMBYDBBCEIKKLLMMPST09,
  author    = {David E. Shaw and
               Ron O. Dror and
               John K. Salmon and
               J. P. Grossman and
               Kenneth M. Mackenzie and
               Joseph A. Bank and
               Cliff Young and
               Martin M. Deneroff and
               Brannon Batson and
               Kevin J. Bowers and
               Edmond Chow and
               Michael P. Eastwood and
               Doug Ierardi and
               John L. Klepeis and
               Jeffrey Kuskin and
               Richard H. Larson and
               Kresten Lindorff{-}Larsen and
               Paul Maragakis and
               Mark A. Moraes and
               Stefano Piana and
               Yibing Shan and
               Brian Towles},
  title     = {Millisecond-scale molecular dynamics simulations on Anton},
  booktitle = {{SC}},
  publisher = {{ACM}},
  year      = {2009}
}
@inproceedings{DBLP:conf/sc/ShawDSGMBYDBBCEIKKLLMMPST09a,
  author    = {David E. Shaw and
               Ron O. Dror and
               John K. Salmon and
               J. P. Grossman and
               Kenneth M. Mackenzie and
               Joseph A. Bank and
               Cliff Young and
               Martin M. Deneroff and
               Brannon Batson and
               Kevin J. Bowers and
               Edmond Chow and
               Michael P. Eastwood and
               Doug Ierardi and
               John L. Klepeis and
               Jeffrey Kuskin and
               Richard H. Larson and
               Kresten Lindorff{-}Larsen and
               Paul Maragakis and
               Mark A. Moraes and
               Stefano Piana and
               Yibing Shan and
               Brian Towles},
  title     = {Millisecond-scale molecular dynamics simulations on Anton},
  booktitle = {{SC}},
  publisher = {{ACM}},
  year      = {2009}
}
@inproceedings{DBLP:conf/sc/YoungBDGSS09,
  author    = {Cliff Young and
               Joseph A. Bank and
               Ron O. Dror and
               J. P. Grossman and
               John K. Salmon and
               David E. Shaw},
  title     = {A 32x32x32, spatially distributed 3D {FFT} in four microseconds on
               Anton},
  booktitle = {{SC}},
  publisher = {{ACM}},
  year      = {2009}
}
@article{DBLP:journals/cacm/ShawDDKLSYBBCEGGHIKKLMMMPSSTTW08,
  author    = {David E. Shaw and
               Martin M. Deneroff and
               Ron O. Dror and
               Jeffrey Kuskin and
               Richard H. Larson and
               John K. Salmon and
               Cliff Young and
               Brannon Batson and
               Kevin J. Bowers and
               Jack C. Chao and
               Michael P. Eastwood and
               Joseph Gagliardo and
               J. P. Grossman and
               Richard C. Ho and
               Doug Ierardi and
               Istv{\'{a}}n Kolossv{\'{a}}ry and
               John L. Klepeis and
               Timothy Layman and
               Christine McLeavey and
               Mark A. Moraes and
               Rolf Mueller and
               Edward C. Priest and
               Yibing Shan and
               Jochen Spengler and
               Michael Theobald and
               Brian Towles and
               Stanley C. Wang},
  title     = {Anton, a special-purpose machine for molecular dynamics simulation},
  journal   = {Commun. {ACM}},
  volume    = {51},
  number    = {7},
  pages     = {91--97},
  year      = {2008}
}
@inproceedings{DBLP:conf/codes/GrossmanYBMISDS08,
  author    = {J. P. Grossman and
               Cliff Young and
               Joseph A. Bank and
               Kenneth M. Mackenzie and
               Doug Ierardi and
               John K. Salmon and
               Ron O. Dror and
               David E. Shaw},
  title     = {Simulation and embedded software development for Anton, a parallel
               machine with heterogeneous multicore ASICs},
  booktitle = {{CODES+ISSS}},
  pages     = {125--130},
  publisher = {{ACM}},
  year      = {2008}
}
@inproceedings{DBLP:conf/hpca/LarsonSDDYGSKS08,
  author    = {Richard H. Larson and
               John K. Salmon and
               Ron O. Dror and
               Martin M. Deneroff and
               Cliff Young and
               J. P. Grossman and
               Yibing Shan and
               John L. Klepeis and
               David E. Shaw},
  title     = {High-throughput pairwise point interactions in Anton, a specialized
               machine for molecular dynamics simulation},
  booktitle = {{HPCA}},
  pages     = {331--342},
  publisher = {{IEEE} Computer Society},
  year      = {2008}
}
@inproceedings{DBLP:conf/hpca/KuskinYGBDDS08,
  author    = {Jeffrey Kuskin and
               Cliff Young and
               J. P. Grossman and
               Brannon Batson and
               Martin M. Deneroff and
               Ron O. Dror and
               David E. Shaw},
  title     = {Incorporating flexibility in Anton, a specialized machine for molecular
               dynamics simulation},
  booktitle = {{HPCA}},
  pages     = {343--354},
  publisher = {{IEEE} Computer Society},
  year      = {2008}
}
@inproceedings{DBLP:conf/iccd/GrossmanSHITBSWMTYGDDS08,
  author    = {J. P. Grossman and
               John K. Salmon and
               Richard C. Ho and
               Doug Ierardi and
               Brian Towles and
               Brannon Batson and
               Jochen Spengler and
               Stanley C. Wang and
               Rolf Mueller and
               Michael Theobald and
               Cliff Young and
               Joseph Gagliardo and
               Martin M. Deneroff and
               Ron O. Dror and
               David E. Shaw},
  title     = {Hierarchical simulation-based verification of Anton, a special-purpose
               parallel machine},
  booktitle = {{ICCD}},
  pages     = {340--347},
  publisher = {{IEEE} Computer Society},
  year      = {2008}
}
@inproceedings{DBLP:conf/isca/ShawDDKLSYBBCEGGHIKKLMMMPSSTTW07,
  author    = {David E. Shaw and
               Martin M. Deneroff and
               Ron O. Dror and
               Jeffrey Kuskin and
               Richard H. Larson and
               John K. Salmon and
               Cliff Young and
               Brannon Batson and
               Kevin J. Bowers and
               Jack C. Chao and
               Michael P. Eastwood and
               Joseph Gagliardo and
               J. P. Grossman and
               Richard C. Ho and
               Doug Ierardi and
               Istv{\'{a}}n Kolossv{\'{a}}ry and
               John L. Klepeis and
               Timothy Layman and
               Christine McLeavey and
               Mark A. Moraes and
               Rolf Mueller and
               Edward C. Priest and
               Yibing Shan and
               Jochen Spengler and
               Michael Theobald and
               Brian Towles and
               Stanley C. Wang},
  title     = {Anton, a special-purpose machine for molecular dynamics simulation},
  booktitle = {{ISCA}},
  pages     = {1--12},
  publisher = {{ACM}},
  year      = {2007}
}
@inproceedings{DBLP:conf/usenix/Young06,
  author    = {Cliff Young},
  title     = {Architectures and Algorithms for Biomolecular Simulation},
  booktitle = {{USENIX} Annual Technical Conference, General Track},
  publisher = {{USENIX}},
  year      = {2006}
}
@book{DBLP:books/daglib/0013596,
  author    = {Joseph A. Fisher and
               Paolo Faraboschi and
               Cliff Young},
  title     = {Embedded computing - a {VLIW} approach to architecture, compilers,
               and tools},
  publisher = {Morgan Kaufmann},
  year      = {2005}
}
@inproceedings{DBLP:conf/hotos/YoungLSRPPNMG01,
  author    = {Cliff Young and
               Yagati N. Lakshman and
               Tom Szymanski and
               John H. Reppy and
               David L. Presotto and
               Rob Pike and
               Girija J. Narlikar and
               Sape J. Mullender and
               Eric Grosse},
  title     = {Protium, an Infrastructure for Partitioned Applications},
  booktitle = {HotOS},
  pages     = {47--52},
  publisher = {{IEEE} Computer Society},
  year      = {2001}
}
@article{DBLP:journals/jilp/SavariY00,
  author    = {Serap A. Savari and
               Cliff Young},
  title     = {Comparing and Combining Profiles},
  journal   = {J. Instruction-Level Parallelism},
  volume    = {2},
  year      = {2000}
}
@inproceedings{DBLP:conf/hpca/KaxirasY00,
  author    = {Stefanos Kaxiras and
               Cliff Young},
  title     = {Coherence Communication Prediction in Shared-Memory Multiprocessors},
  booktitle = {{HPCA}},
  pages     = {156--167},
  publisher = {{IEEE} Computer Society},
  year      = {2000}
}
@article{DBLP:journals/toplas/YoungS99,
  author    = {Cliff Young and
               Michael D. Smith},
  title     = {Static correlated branch prediction},
  journal   = {{ACM} Trans. Program. Lang. Syst.},
  volume    = {21},
  number    = {5},
  pages     = {1028--1075},
  year      = {1999}
}
@inproceedings{DBLP:conf/micro/YoungS98,
  author    = {Cliff Young and
               Michael D. Smith},
  title     = {Better Global Scheduling Using Path Profiles},
  booktitle = {{MICRO}},
  pages     = {115--123},
  publisher = {{ACM/IEEE} Computer Society},
  year      = {1998}
}
@inproceedings{DBLP:conf/pldi/YoungJKS97,
  author    = {Cliff Young and
               David S. Johnson and
               David R. Karger and
               Michael D. Smith},
  title     = {Near-optimal Intraprocedural Branch Alignment},
  booktitle = {{PLDI}},
  pages     = {183--193},
  publisher = {{ACM}},
  year      = {1997}
}
@inproceedings{DBLP:conf/isca/Gloy96,
  author    = {Nicholas C. Gloy and
               Cliff Young and
               J. Bradley Chen and
               Michael D. Smith},
  title     = {An Analysis of Dynamic Branch Prediction Schemes on System Workloads},
  booktitle = {{ISCA}},
  pages     = {12--21},
  publisher = {{ACM}},
  year      = {1996}
}
@inproceedings{DBLP:conf/isca/YoungGS95,
  author    = {Cliff Young and
               Nicholas C. Gloy and
               Michael D. Smith},
  title     = {A Comparative Analysis of Schemes for Correlated Branch Prediction},
  booktitle = {{ISCA}},
  pages     = {276--286},
  publisher = {{ACM}},
  year      = {1995}
}
@inproceedings{DBLP:conf/micro/GloySY95,
  author    = {Nicholas C. Gloy and
               Michael D. Smith and
               Cliff Young},
  title     = {Performance issues in correlated branch prediction schemes},
  booktitle = {{MICRO}},
  pages     = {3--14},
  publisher = {{ACM} / {IEEE} Computer Society},
  year      = {1995}
}
@inproceedings{DBLP:conf/asplos/YoungS94,
  author    = {Cliff Young and
               Michael D. Smith},
  title     = {Improving the Accuracy of Static Branch Prediction Using Branch Correlation},
  booktitle = {{ASPLOS}},
  pages     = {232--241},
  publisher = {{ACM} Press},
  year      = {1994}
}
@inproceedings{DBLP:conf/usenix/BlackwellCCCGKKLLMPTYZ94,
  author    = {Trevor Blackwell and
               Kee Chan and
               Koling Chang and
               Thomas Charuhas and
               James Gwertzman and
               Brad Karp and
               H. T. Kung and
               David Li and
               Dong Lin and
               Robert Tappan Morris and
               Rob Polansky and
               Diane Tang and
               Cliff Young and
               John Zao},
  title     = {Secure Short-Cut Routing for Mobile {IP}},
  booktitle = {{USENIX} Summer},
  pages     = {305--316},
  publisher = {{USENIX} Association},
  year      = {1994}
}
a service of Schloss Dagstuhl - Leibniz Center for Informatics