BibTeX records: David Zhang 0001

download as .bib file

@article{DBLP:journals/cbm/ZhangJLZ24,
  author       = {Nannan Zhang and
                  Zhixing Jiang and
                  Mu Li and
                  David Zhang},
  title        = {A novel multi-feature learning model for disease diagnosis using face
                  skin images},
  journal      = {Comput. Biol. Medicine},
  volume       = {168},
  pages        = {107837},
  year         = {2024},
  url          = {https://doi.org/10.1016/j.compbiomed.2023.107837},
  doi          = {10.1016/J.COMPBIOMED.2023.107837},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cbm/ZhangJLZ24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/PengLCXXSZ24,
  author       = {Tianhao Peng and
                  Mu Li and
                  Fangmei Chen and
                  Yong Xu and
                  Yuan Xie and
                  Yahan Sun and
                  David Zhang},
  title        = {{ISFB-GAN:} Interpretable semantic face beautification with generative
                  adversarial network},
  journal      = {Expert Syst. Appl.},
  volume       = {236},
  pages        = {121131},
  year         = {2024},
  url          = {https://doi.org/10.1016/j.eswa.2023.121131},
  doi          = {10.1016/J.ESWA.2023.121131},
  timestamp    = {Sun, 10 Dec 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/eswa/PengLCXXSZ24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/ZengCHLZC24,
  author       = {Biqing Zeng and
                  Junlong Chi and
                  Peilin Hong and
                  Guangming Lu and
                  David Zhang and
                  Bingzhi Chen},
  title        = {Context-aware graph embedding with gate and attention for session-based
                  recommendation},
  journal      = {Neurocomputing},
  volume       = {574},
  pages        = {127221},
  year         = {2024},
  url          = {https://doi.org/10.1016/j.neucom.2023.127221},
  doi          = {10.1016/J.NEUCOM.2023.127221},
  timestamp    = {Thu, 29 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/ZengCHLZC24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/inffus/LiZJLLXZ24,
  author       = {Jinxing Li and
                  Chuhao Zhou and
                  Xiaoqiang Ji and
                  Mu Li and
                  Guangming Lu and
                  Yong Xu and
                  David Zhang},
  title        = {Multi-view Instance Attention Fusion Network for classification},
  journal      = {Inf. Fusion},
  volume       = {101},
  pages        = {101974},
  year         = {2024},
  url          = {https://doi.org/10.1016/j.inffus.2023.101974},
  doi          = {10.1016/J.INFFUS.2023.101974},
  timestamp    = {Fri, 27 Oct 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/inffus/LiZJLLXZ24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/LiuLYZ24,
  author       = {Guang{-}Hai Liu and
                  Zuo{-}Yong Li and
                  Jing{-}Yu Yang and
                  David Zhang},
  title        = {Exploiting sublimated deep features for image retrieval},
  journal      = {Pattern Recognit.},
  volume       = {147},
  pages        = {110076},
  year         = {2024},
  url          = {https://doi.org/10.1016/j.patcog.2023.110076},
  doi          = {10.1016/J.PATCOG.2023.110076},
  timestamp    = {Fri, 26 Jan 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/LiuLYZ24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/FengJPLLZ24,
  author       = {Xin Feng and
                  Haobo Ji and
                  Wenjie Pei and
                  Jinxing Li and
                  Guangming Lu and
                  David Zhang},
  title        = {U{\({^2}\)}-Former: Nested U-Shaped Transformer for Image Restoration
                  via Multi-View Contrastive Learning},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {34},
  number       = {1},
  pages        = {168--181},
  year         = {2024},
  url          = {https://doi.org/10.1109/TCSVT.2023.3286405},
  doi          = {10.1109/TCSVT.2023.3286405},
  timestamp    = {Fri, 26 Jan 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcsv/FengJPLLZ24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/LiLFLZ24,
  author       = {Wei Li and
                  Guanghai Liu and
                  Haoyi Fan and
                  Zuoyong Li and
                  David Zhang},
  title        = {Self-Supervised Multi-Scale Cropping and Simple Masked Attentive Predicting
                  for Lung CT-Scan Anomaly Detection},
  journal      = {{IEEE} Trans. Medical Imaging},
  volume       = {43},
  number       = {1},
  pages        = {594--607},
  year         = {2024},
  url          = {https://doi.org/10.1109/TMI.2023.3313778},
  doi          = {10.1109/TMI.2023.3313778},
  timestamp    = {Fri, 26 Jan 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tmi/LiLFLZ24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/WuWXYLZ24,
  author       = {Zhihao Wu and
                  Jie Wen and
                  Yong Xu and
                  Jian Yang and
                  Xuelong Li and
                  David Zhang},
  title        = {Enhanced Spatial Feature Learning for Weakly Supervised Object Detection},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {35},
  number       = {1},
  pages        = {961--972},
  year         = {2024},
  url          = {https://doi.org/10.1109/TNNLS.2022.3178180},
  doi          = {10.1109/TNNLS.2022.3178180},
  timestamp    = {Fri, 26 Jan 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tnn/WuWXYLZ24.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/air/MinaeeASB023,
  author       = {Shervin Minaee and
                  Amirali Abdolrashidi and
                  Hang Su and
                  Mohammed Bennamoun and
                  David Zhang},
  title        = {Biometrics recognition using deep learning: a survey},
  journal      = {Artif. Intell. Rev.},
  volume       = {56},
  number       = {8},
  pages        = {8647--8695},
  year         = {2023},
  url          = {https://doi.org/10.1007/s10462-022-10237-x},
  doi          = {10.1007/S10462-022-10237-X},
  timestamp    = {Sun, 06 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/air/MinaeeASB023.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbm/ZhangJLZ23,
  author       = {Nannan Zhang and
                  Zhixing Jiang and
                  Jinxing Li and
                  David Zhang},
  title        = {Multiple color representation and fusion for diabetes mellitus diagnosis
                  based on back tongue images},
  journal      = {Comput. Biol. Medicine},
  volume       = {155},
  pages        = {106652},
  year         = {2023},
  url          = {https://doi.org/10.1016/j.compbiomed.2023.106652},
  doi          = {10.1016/J.COMPBIOMED.2023.106652},
  timestamp    = {Tue, 30 Jan 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cbm/ZhangJLZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/GuoFJZ23,
  author       = {Chaoxun Guo and
                  Dandan Fan and
                  Zhixing Jiang and
                  David Zhang},
  title        = {{MDFN:} Mask deep fusion network for visible and infrared image fusion
                  without reference ground-truth},
  journal      = {Expert Syst. Appl.},
  volume       = {211},
  pages        = {118631},
  year         = {2023},
  url          = {https://doi.org/10.1016/j.eswa.2022.118631},
  doi          = {10.1016/J.ESWA.2022.118631},
  timestamp    = {Wed, 17 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/eswa/GuoFJZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcv/HeZGZ23,
  author       = {Zhenwei He and
                  Lei Zhang and
                  Xinbo Gao and
                  David Zhang},
  title        = {Multi-adversarial Faster-RCNN with Paradigm Teacher for Unrestricted
                  Object Detection},
  journal      = {Int. J. Comput. Vis.},
  volume       = {131},
  number       = {3},
  pages        = {680--700},
  year         = {2023},
  url          = {https://doi.org/10.1007/s11263-022-01728-z},
  doi          = {10.1007/S11263-022-01728-Z},
  timestamp    = {Sat, 11 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijcv/HeZGZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/inffus/JiangLLLZL23,
  author       = {Bo Jiang and
                  Jinxing Li and
                  Huafeng Li and
                  Ruxian Li and
                  David Zhang and
                  Guangming Lu},
  title        = {Enhanced Frequency Fusion Network with Dynamic Hash Attention for
                  image denoising},
  journal      = {Inf. Fusion},
  volume       = {92},
  pages        = {420--434},
  year         = {2023},
  url          = {https://doi.org/10.1016/j.inffus.2022.12.015},
  doi          = {10.1016/J.INFFUS.2022.12.015},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/inffus/JiangLLLZL23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jstsp/LiangFYJLZ23,
  author       = {Xu Liang and
                  Dandan Fan and
                  Jinyang Yang and
                  Wei Jia and
                  Guangming Lu and
                  David Zhang},
  title        = {PKLNet: Keypoint Localization Neural Network for Touchless Palmprint
                  Recognition Based on Edge-Aware Regression},
  journal      = {{IEEE} J. Sel. Top. Signal Process.},
  volume       = {17},
  number       = {3},
  pages        = {662--676},
  year         = {2023},
  url          = {https://doi.org/10.1109/JSTSP.2023.3241540},
  doi          = {10.1109/JSTSP.2023.3241540},
  timestamp    = {Sat, 05 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jstsp/LiangFYJLZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/NingJZ23,
  author       = {Zhihan Ning and
                  Zhixing Jiang and
                  David Zhang},
  title        = {Sparse projection infinite selection ensemble for imbalanced classification},
  journal      = {Knowl. Based Syst.},
  volume       = {262},
  pages        = {110246},
  year         = {2023},
  url          = {https://doi.org/10.1016/j.knosys.2022.110246},
  doi          = {10.1016/J.KNOSYS.2022.110246},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/kbs/NingJZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/ZhangLLCLZ23,
  author       = {Le Zhang and
                  Yao Lu and
                  Jinxing Li and
                  Fanglin Chen and
                  Guangming Lu and
                  David Zhang},
  title        = {Deep adaptive hiding network for image hiding using attentive frequency
                  extraction and gradual depth extraction},
  journal      = {Neural Comput. Appl.},
  volume       = {35},
  number       = {15},
  pages        = {10909--10927},
  year         = {2023},
  url          = {https://doi.org/10.1007/s00521-023-08274-w},
  doi          = {10.1007/S00521-023-08274-W},
  timestamp    = {Sat, 29 Apr 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nca/ZhangLLCLZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/JiaJSCDZ23,
  author       = {Xiaodong Jia and
                  Xiao{-}Yuan Jing and
                  Qixing Sun and
                  Songcan Chen and
                  Bo Du and
                  David Zhang},
  title        = {Human Collective Intelligence Inspired Multi-View Representation Learning
                  - Enabling View Communication by Simulating Human Communication Mechanism},
  journal      = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
  volume       = {45},
  number       = {6},
  pages        = {7412--7429},
  year         = {2023},
  url          = {https://doi.org/10.1109/TPAMI.2022.3218605},
  doi          = {10.1109/TPAMI.2022.3218605},
  timestamp    = {Wed, 17 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pami/JiaJSCDZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/TianZZZZZ23,
  author       = {Chunwei Tian and
                  Menghua Zheng and
                  Wangmeng Zuo and
                  Bob Zhang and
                  Yanning Zhang and
                  David Zhang},
  title        = {Multi-stage image denoising with the wavelet transform},
  journal      = {Pattern Recognit.},
  volume       = {134},
  pages        = {109050},
  year         = {2023},
  url          = {https://doi.org/10.1016/j.patcog.2022.109050},
  doi          = {10.1016/J.PATCOG.2022.109050},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/TianZZZZZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/PengLCXZ23,
  author       = {Tianhao Peng and
                  Mu Li and
                  Fangmei Chen and
                  Yong Xu and
                  David Zhang},
  title        = {Learning efficient facial landmark model for human attractiveness
                  analysis},
  journal      = {Pattern Recognit.},
  volume       = {138},
  pages        = {109370},
  year         = {2023},
  url          = {https://doi.org/10.1016/j.patcog.2023.109370},
  doi          = {10.1016/J.PATCOG.2023.109370},
  timestamp    = {Tue, 01 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/PengLCXZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taffco/LiLLZZ23,
  author       = {Yingjian Li and
                  Guangming Lu and
                  Jinxing Li and
                  Zheng Zhang and
                  David Zhang},
  title        = {Facial Expression Recognition in the Wild Using Multi-Level Features
                  and Attention Mechanisms},
  journal      = {{IEEE} Trans. Affect. Comput.},
  volume       = {14},
  number       = {1},
  pages        = {451--462},
  year         = {2023},
  url          = {https://doi.org/10.1109/TAFFC.2020.3031602},
  doi          = {10.1109/TAFFC.2020.3031602},
  timestamp    = {Sat, 11 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/taffco/LiLLZZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/LiuZZ23,
  author       = {Zhipu Liu and
                  Lei Zhang and
                  David Zhang},
  title        = {Neural Image Parts Group Search for Person Re-Identification},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {33},
  number       = {6},
  pages        = {2724--2737},
  year         = {2023},
  url          = {https://doi.org/10.1109/TCSVT.2022.3225285},
  doi          = {10.1109/TCSVT.2022.3225285},
  timestamp    = {Thu, 15 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcsv/LiuZZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/ZhuZFZZ23,
  author       = {Qi Zhu and
                  Yuze Zhou and
                  Lunke Fei and
                  Daoqiang Zhang and
                  David Zhang},
  title        = {Multi-Spectral Palmprints Joint Attack and Defense With Adversarial
                  Examples Learning},
  journal      = {{IEEE} Trans. Inf. Forensics Secur.},
  volume       = {18},
  pages        = {1789--1799},
  year         = {2023},
  url          = {https://doi.org/10.1109/TIFS.2023.3254432},
  doi          = {10.1109/TIFS.2023.3254432},
  timestamp    = {Sun, 16 Apr 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tifs/ZhuZFZZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/ZhuXFLZZZ23,
  author       = {Qi Zhu and
                  Guangnan Xin and
                  Lunke Fei and
                  Dong Liang and
                  Zheng Zhang and
                  Daoqiang Zhang and
                  David Zhang},
  title        = {Contactless Palmprint Image Recognition Across Smartphones With Self-Paced
                  CycleGAN},
  journal      = {{IEEE} Trans. Inf. Forensics Secur.},
  volume       = {18},
  pages        = {4944--4954},
  year         = {2023},
  url          = {https://doi.org/10.1109/TIFS.2023.3301729},
  doi          = {10.1109/TIFS.2023.3301729},
  timestamp    = {Fri, 18 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tifs/ZhuXFLZZZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/LinPCZL23,
  author       = {Zebin Lin and
                  Wenjie Pei and
                  Fanglin Chen and
                  David Zhang and
                  Guangming Lu},
  title        = {Pedestrian Detection by Exemplar-Guided Contrastive Learning},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {32},
  pages        = {2003--2016},
  year         = {2023},
  url          = {https://doi.org/10.1109/TIP.2022.3189803},
  doi          = {10.1109/TIP.2022.3189803},
  timestamp    = {Sat, 29 Apr 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/LinPCZL23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/ZhangLZZ23,
  author       = {Lei Zhang and
                  Zhipu Liu and
                  Wensheng Zhang and
                  David Zhang},
  title        = {Style Uncertainty Based Self-Paced Meta Learning for Generalizable
                  Person Re-Identification},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {32},
  pages        = {2107--2119},
  year         = {2023},
  url          = {https://doi.org/10.1109/TIP.2023.3263112},
  doi          = {10.1109/TIP.2023.3263112},
  timestamp    = {Sun, 22 Oct 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/ZhangLZZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/CaiQLLYWZ23,
  author       = {Qing Cai and
                  Yiming Qian and
                  Jinxing Li and
                  Jun Lyu and
                  Yee{-}Hong Yang and
                  Feng Wu and
                  David Zhang},
  title        = {{HIPA:} Hierarchical Patch Transformer for Single Image Super Resolution},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {32},
  pages        = {3226--3237},
  year         = {2023},
  url          = {https://doi.org/10.1109/TIP.2023.3279977},
  doi          = {10.1109/TIP.2023.3279977},
  timestamp    = {Thu, 15 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/CaiQLLYWZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmm/WuWXYZ23,
  author       = {Zhihao Wu and
                  Jie Wen and
                  Yong Xu and
                  Jian Yang and
                  David Zhang},
  title        = {Multiple Instance Detection Networks With Adaptive Instance Refinement},
  journal      = {{IEEE} Trans. Multim.},
  volume       = {25},
  pages        = {267--279},
  year         = {2023},
  url          = {https://doi.org/10.1109/TMM.2021.3125130},
  doi          = {10.1109/TMM.2021.3125130},
  timestamp    = {Fri, 12 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tmm/WuWXYZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmm/LiZCLZ23,
  author       = {Yingjian Li and
                  Zheng Zhang and
                  Bingzhi Chen and
                  Guangming Lu and
                  David Zhang},
  title        = {Deep Margin-Sensitive Representation Learning for Cross-Domain Facial
                  Expression Recognition},
  journal      = {{IEEE} Trans. Multim.},
  volume       = {25},
  pages        = {1359--1373},
  year         = {2023},
  url          = {https://doi.org/10.1109/TMM.2022.3141604},
  doi          = {10.1109/TMM.2022.3141604},
  timestamp    = {Wed, 17 May 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tmm/LiZCLZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/LiZLZTZ23,
  author       = {Mu Li and
                  Kai Zhang and
                  Jinxing Li and
                  Wangmeng Zuo and
                  Radu Timofte and
                  David Zhang},
  title        = {Learning Context-Based Nonlocal Entropy Modeling for Image Compression},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {34},
  number       = {3},
  pages        = {1132--1145},
  year         = {2023},
  url          = {https://doi.org/10.1109/TNNLS.2021.3104974},
  doi          = {10.1109/TNNLS.2021.3104974},
  timestamp    = {Mon, 28 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tnn/LiZLZTZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/HuangWXJYWZ23,
  author       = {Chao Huang and
                  Jie Wen and
                  Yong Xu and
                  Qiuping Jiang and
                  Jian Yang and
                  Yaowei Wang and
                  David Zhang},
  title        = {Self-Supervised Attentive Generative Adversarial Networks for Video
                  Anomaly Detection},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {34},
  number       = {11},
  pages        = {9389--9403},
  year         = {2023},
  url          = {https://doi.org/10.1109/TNNLS.2022.3159538},
  doi          = {10.1109/TNNLS.2022.3159538},
  timestamp    = {Thu, 09 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tnn/HuangWXJYWZ23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/ZhangZNWBJ023,
  author       = {Weilong Zhang and
                  Chongyang Zhang and
                  Zhihan Ning and
                  Guopeng Wang and
                  Yingjie Bai and
                  Zhixing Jiang and
                  David Zhang},
  title        = {{M2SH:} {A} Hybrid Approach to Table Structure Recognition using Two-Stage
                  Multi-Modality Feature Fusion},
  booktitle    = {{IEEE} International Conference on Systems, Man, and Cybernetics,
                  {SMC} 2023, Honolulu, Oahu, HI, USA, October 1-4, 2023},
  pages        = {791--798},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/SMC53992.2023.10394093},
  doi          = {10.1109/SMC53992.2023.10394093},
  timestamp    = {Tue, 13 Feb 2024 09:22:04 +0100},
  biburl       = {https://dblp.org/rec/conf/smc/ZhangZNWBJ023.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/sp/LiZZ22,
  author       = {Jinxing Li and
                  Bob Zhang and
                  David Zhang},
  title        = {Information Fusion - Machine Learning Methods},
  publisher    = {Springer},
  year         = {2022},
  url          = {https://doi.org/10.1007/978-981-16-8976-5},
  doi          = {10.1007/978-981-16-8976-5},
  isbn         = {978-981-16-8975-8},
  timestamp    = {Mon, 14 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/books/sp/LiZZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbm/GuoJHLZ22,
  author       = {Chaoxun Guo and
                  Zhixing Jiang and
                  Haoze He and
                  Yining Liao and
                  David Zhang},
  title        = {Wrist pulse signal acquisition and analysis for disease diagnosis:
                  {A} review},
  journal      = {Comput. Biol. Medicine},
  volume       = {143},
  pages        = {105312},
  year         = {2022},
  url          = {https://doi.org/10.1016/j.compbiomed.2022.105312},
  doi          = {10.1016/J.COMPBIOMED.2022.105312},
  timestamp    = {Mon, 04 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cbm/GuoJHLZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/JiangGZ22,
  author       = {Zhixing Jiang and
                  Chaoxun Guo and
                  David Zhang},
  title        = {Pressure wrist pulse signal analysis by sparse decomposition using
                  improved Gabor function},
  journal      = {Comput. Methods Programs Biomed.},
  volume       = {219},
  pages        = {106766},
  year         = {2022},
  url          = {https://doi.org/10.1016/j.cmpb.2022.106766},
  doi          = {10.1016/J.CMPB.2022.106766},
  timestamp    = {Tue, 16 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cmpb/JiangGZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/NingYJZ22,
  author       = {Zhihan Ning and
                  Ziqing Ye and
                  Zhixing Jiang and
                  David Zhang},
  title        = {{BESS:} Balanced evolutionary semi-stacking for disease detection
                  using partially labeled imbalanced data},
  journal      = {Inf. Sci.},
  volume       = {594},
  pages        = {233--248},
  year         = {2022},
  url          = {https://doi.org/10.1016/j.ins.2022.02.026},
  doi          = {10.1016/J.INS.2022.02.026},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/isci/NingYJZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/ZhangLCCZ22,
  author       = {Fan Zhang and
                  Huiying Liu and
                  Chuanshuo Cao and
                  Qing Cai and
                  David Zhang},
  title        = {{RVLSM:} Robust variational level set method for image segmentation
                  with intensity inhomogeneity and high noise},
  journal      = {Inf. Sci.},
  volume       = {596},
  pages        = {439--459},
  year         = {2022},
  url          = {https://doi.org/10.1016/j.ins.2022.03.035},
  doi          = {10.1016/J.INS.2022.03.035},
  timestamp    = {Thu, 06 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/isci/ZhangLCCZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/JiangLLZ22,
  author       = {Bo Jiang and
                  Yao Lu and
                  Guangming Lu and
                  David Zhang},
  title        = {Real noise image adjustment networks for saliency-aware stylistic
                  color retouch},
  journal      = {Knowl. Based Syst.},
  volume       = {242},
  pages        = {108317},
  year         = {2022},
  url          = {https://doi.org/10.1016/j.knosys.2022.108317},
  doi          = {10.1016/J.KNOSYS.2022.108317},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/kbs/JiangLLZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/LiangLFLJZ22,
  author       = {Xu Liang and
                  Zhaoqun Li and
                  Dandan Fan and
                  Jinxing Li and
                  Wei Jia and
                  David Zhang},
  title        = {Touchless palmprint recognition based on 3D Gabor template and block
                  feature refinement},
  journal      = {Knowl. Based Syst.},
  volume       = {249},
  pages        = {108855},
  year         = {2022},
  url          = {https://doi.org/10.1016/j.knosys.2022.108855},
  doi          = {10.1016/J.KNOSYS.2022.108855},
  timestamp    = {Tue, 28 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/kbs/LiangLFLJZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nn/TianYZLZZ22,
  author       = {Chunwei Tian and
                  Yixuan Yuan and
                  Shichao Zhang and
                  Chia{-}Wen Lin and
                  Wangmeng Zuo and
                  David Zhang},
  title        = {Image super-resolution with an enhanced group convolutional neural
                  network},
  journal      = {Neural Networks},
  volume       = {153},
  pages        = {373--385},
  year         = {2022},
  url          = {https://doi.org/10.1016/j.neunet.2022.06.009},
  doi          = {10.1016/J.NEUNET.2022.06.009},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nn/TianYZLZZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/LiXMBZ22,
  author       = {Haifeng Li and
                  Cong Xu and
                  Lin Ma and
                  Hongjian Bo and
                  David Zhang},
  title        = {{MODENN:} {A} Shallow Broad Neural Network Model Based on Multi-Order
                  Descartes Expansion},
  journal      = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
  volume       = {44},
  number       = {12},
  pages        = {9417--9433},
  year         = {2022},
  url          = {https://doi.org/10.1109/TPAMI.2021.3125690},
  doi          = {10.1109/TPAMI.2021.3125690},
  timestamp    = {Mon, 05 Dec 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pami/LiXMBZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/speech/JiangHWLZL22,
  author       = {Bo Jiang and
                  Mixiao Hou and
                  Jiahuan Wang and
                  Yao Lu and
                  David Zhang and
                  Guangming Lu},
  title        = {Recursive Feature Diversity Network for audio super-resolution},
  journal      = {Speech Commun.},
  volume       = {144},
  pages        = {57--66},
  year         = {2022},
  url          = {https://doi.org/10.1016/j.specom.2022.08.005},
  doi          = {10.1016/J.SPECOM.2022.08.005},
  timestamp    = {Mon, 26 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/speech/JiangHWLZL22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/HouZCZL22,
  author       = {Mixiao Hou and
                  Zheng Zhang and
                  Qi Cao and
                  David Zhang and
                  Guangming Lu},
  title        = {Multi-View Speech Emotion Recognition Via Collective Relation Construction},
  journal      = {{IEEE} {ACM} Trans. Audio Speech Lang. Process.},
  volume       = {30},
  pages        = {218--229},
  year         = {2022},
  url          = {https://doi.org/10.1109/TASLP.2021.3133196},
  doi          = {10.1109/TASLP.2021.3133196},
  timestamp    = {Tue, 08 Feb 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/taslp/HouZCZL22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/YaoPCLZ22,
  author       = {Zengwei Yao and
                  Wenjie Pei and
                  Fanglin Chen and
                  Guangming Lu and
                  David Zhang},
  title        = {Stepwise-Refining Speech Separation Network via Fine-Grained Encoding
                  in High-Order Latent Domain},
  journal      = {{IEEE} {ACM} Trans. Audio Speech Lang. Process.},
  volume       = {30},
  pages        = {378--393},
  year         = {2022},
  url          = {https://doi.org/10.1109/TASLP.2022.3140556},
  doi          = {10.1109/TASLP.2022.3140556},
  timestamp    = {Tue, 08 Feb 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/taslp/YaoPCLZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/ChenZLLZ22,
  author       = {Bingzhi Chen and
                  Zheng Zhang and
                  Ying{-}Jian Li and
                  Guangming Lu and
                  David Zhang},
  title        = {Multi-Label Chest X-Ray Image Classification via Semantic Similarity
                  Graph Embedding},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {32},
  number       = {4},
  pages        = {2455--2468},
  year         = {2022},
  url          = {https://doi.org/10.1109/TCSVT.2021.3079900},
  doi          = {10.1109/TCSVT.2021.3079900},
  timestamp    = {Wed, 27 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcsv/ChenZLLZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/LiLCZLLZ22,
  author       = {Yingjian Li and
                  Yao Lu and
                  Bingzhi Chen and
                  Zheng Zhang and
                  Jinxing Li and
                  Guangming Lu and
                  David Zhang},
  title        = {Learning Informative and Discriminative Features for Facial Expression
                  Recognition in the Wild},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {32},
  number       = {5},
  pages        = {3178--3189},
  year         = {2022},
  url          = {https://doi.org/10.1109/TCSVT.2021.3103760},
  doi          = {10.1109/TCSVT.2021.3103760},
  timestamp    = {Wed, 18 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcsv/LiLCZLLZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/LiGCZLZ22,
  author       = {Yingjian Li and
                  Yingnan Gao and
                  Bingzhi Chen and
                  Zheng Zhang and
                  Guangming Lu and
                  David Zhang},
  title        = {Self-Supervised Exclusive-Inclusive Interactive Learning for Multi-Label
                  Facial Expression Recognition in the Wild},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {32},
  number       = {5},
  pages        = {3190--3202},
  year         = {2022},
  url          = {https://doi.org/10.1109/TCSVT.2021.3103782},
  doi          = {10.1109/TCSVT.2021.3103782},
  timestamp    = {Wed, 18 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcsv/LiGCZLZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/JiangLWLZ22,
  author       = {Bo Jiang and
                  Yao Lu and
                  Jiahuan Wang and
                  Guangming Lu and
                  David Zhang},
  title        = {Deep Image Denoising With Adaptive Priors},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {32},
  number       = {8},
  pages        = {5124--5136},
  year         = {2022},
  url          = {https://doi.org/10.1109/TCSVT.2022.3149518},
  doi          = {10.1109/TCSVT.2022.3149518},
  timestamp    = {Thu, 25 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcsv/JiangLWLZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/FengPLCZL22,
  author       = {Xin Feng and
                  Wenjie Pei and
                  Fengjun Li and
                  Fanglin Chen and
                  David Zhang and
                  Guangming Lu},
  title        = {Generative Memory-Guided Semantic Reasoning Model for Image Inpainting},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {32},
  number       = {11},
  pages        = {7432--7447},
  year         = {2022},
  url          = {https://doi.org/10.1109/TCSVT.2022.3188169},
  doi          = {10.1109/TCSVT.2022.3188169},
  timestamp    = {Sun, 13 Nov 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcsv/FengPLCZL22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/LuLLXZZ22,
  author       = {Yao Lu and
                  Guangming Lu and
                  Jinxing Li and
                  Yuanrong Xu and
                  Zheng Zhang and
                  David Zhang},
  title        = {Multiscale Conditional Regularization for Convolutional Neural Networks},
  journal      = {{IEEE} Trans. Cybern.},
  volume       = {52},
  number       = {1},
  pages        = {444--458},
  year         = {2022},
  url          = {https://doi.org/10.1109/TCYB.2020.2979968},
  doi          = {10.1109/TCYB.2020.2979968},
  timestamp    = {Wed, 16 Mar 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcyb/LuLLXZZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/LuZLZLZ22,
  author       = {Yao Lu and
                  Zheng Zhang and
                  Guangming Lu and
                  Yicong Zhou and
                  Jinxing Li and
                  David Zhang},
  title        = {Addi-Reg: {A} Better Generalization-Optimization Tradeoff Regularization
                  Method for Convolutional Neural Networks},
  journal      = {{IEEE} Trans. Cybern.},
  volume       = {52},
  number       = {10},
  pages        = {10827--10842},
  year         = {2022},
  url          = {https://doi.org/10.1109/TCYB.2021.3062881},
  doi          = {10.1109/TCYB.2021.3062881},
  timestamp    = {Tue, 18 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcyb/LuZLZLZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/XuLCLZ22,
  author       = {Yuanrong Xu and
                  Yao Lu and
                  Fanglin Chen and
                  Guangming Lu and
                  David Zhang},
  title        = {High Resolution Fingerprint Retrieval Based on Pore Indexing and Graph
                  Comparison},
  journal      = {{IEEE} Trans. Inf. Forensics Secur.},
  volume       = {17},
  pages        = {226--236},
  year         = {2022},
  url          = {https://doi.org/10.1109/TIFS.2021.3139219},
  doi          = {10.1109/TIFS.2021.3139219},
  timestamp    = {Fri, 21 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tifs/XuLCLZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/JiangWLLZ22,
  author       = {Bo Jiang and
                  Jiahuan Wang and
                  Yao Lu and
                  Guangming Lu and
                  David Zhang},
  title        = {Multilevel Noise Contrastive Network for Few-Shot Image Denoising},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {71},
  pages        = {1--13},
  year         = {2022},
  url          = {https://doi.org/10.1109/TIM.2022.3189739},
  doi          = {10.1109/TIM.2022.3189739},
  timestamp    = {Sat, 10 Sep 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tim/JiangWLLZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/LinCXZLZ22,
  author       = {Ailiang Lin and
                  Bingzhi Chen and
                  Jiayu Xu and
                  Zheng Zhang and
                  Guangming Lu and
                  David Zhang},
  title        = {DS-TransUNet: Dual Swin Transformer U-Net for Medical Image Segmentation},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {71},
  pages        = {1--15},
  year         = {2022},
  url          = {https://doi.org/10.1109/TIM.2022.3178991},
  doi          = {10.1109/TIM.2022.3178991},
  timestamp    = {Tue, 28 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tim/LinCXZLZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/PangX0L022,
  author       = {Qianting Pang and
                  Yuanrong Xu and
                  Fanglin Chen and
                  Guangming Lu and
                  David Zhang},
  title        = {Hierarchical Pore-Based High-Resolution Fingerprint Indexing},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {71},
  pages        = {1--13},
  year         = {2022},
  url          = {https://doi.org/10.1109/TIM.2022.3146944},
  doi          = {10.1109/TIM.2022.3146944},
  timestamp    = {Tue, 15 Mar 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tim/PangX0L022.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/CaiQZLYWZ22,
  author       = {Qing Cai and
                  Yiming Qian and
                  Sanping Zhou and
                  Jinxing Li and
                  Yee{-}Hong Yang and
                  Feng Wu and
                  David Zhang},
  title        = {{AVLSM:} Adaptive Variational Level Set Model for Image Segmentation
                  in the Presence of Severe Intensity Inhomogeneity and High Noise},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {31},
  pages        = {43--57},
  year         = {2022},
  url          = {https://doi.org/10.1109/TIP.2021.3127848},
  doi          = {10.1109/TIP.2021.3127848},
  timestamp    = {Wed, 15 Dec 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tip/CaiQZLYWZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/CaiLLYWZ22,
  author       = {Qing Cai and
                  Jinxing Li and
                  Huafeng Li and
                  Yee{-}Hong Yang and
                  Feng Wu and
                  David Zhang},
  title        = {{TDPN:} Texture and Detail-Preserving Network for Single Image Super-Resolution},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {31},
  pages        = {2375--2389},
  year         = {2022},
  url          = {https://doi.org/10.1109/TIP.2022.3154614},
  doi          = {10.1109/TIP.2022.3154614},
  timestamp    = {Fri, 01 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/CaiLLYWZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/QinFZWXZ22,
  author       = {Jianyang Qin and
                  Lunke Fei and
                  Zheng Zhang and
                  Jie Wen and
                  Yong Xu and
                  David Zhang},
  title        = {Joint Specifics and Consistency Hash Learning for Large-Scale Cross-Modal
                  Retrieval},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {31},
  pages        = {5343--5358},
  year         = {2022},
  url          = {https://doi.org/10.1109/TIP.2022.3195059},
  doi          = {10.1109/TIP.2022.3195059},
  timestamp    = {Thu, 25 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/QinFZWXZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/LiLGWZ22,
  author       = {Mu Li and
                  Jinxing Li and
                  Shuhang Gu and
                  Feng Wu and
                  David Zhang},
  title        = {End-to-End Optimized 360{\textdegree} Image Compression},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {31},
  pages        = {6267--6281},
  year         = {2022},
  url          = {https://doi.org/10.1109/TIP.2022.3208429},
  doi          = {10.1109/TIP.2022.3208429},
  timestamp    = {Sun, 13 Nov 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tip/LiLGWZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/GuoJZ22,
  author       = {Chaoxun Guo and
                  Zhixing Jiang and
                  David Zhang},
  title        = {Multi-Feature Complementary Learning for Diabetes Mellitus Detection
                  Using Pulse Signals},
  journal      = {{IEEE} J. Biomed. Health Informatics},
  volume       = {26},
  number       = {11},
  pages        = {5684--5694},
  year         = {2022},
  url          = {https://doi.org/10.1109/JBHI.2022.3198792},
  doi          = {10.1109/JBHI.2022.3198792},
  timestamp    = {Mon, 05 Dec 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/titb/GuoJZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmm/WuXZYZ22,
  author       = {Shuai Wu and
                  Yong Xu and
                  Bob Zhang and
                  Jian Yang and
                  David Zhang},
  title        = {Deformable Template Network {(DTN)} for Object Detection},
  journal      = {{IEEE} Trans. Multim.},
  volume       = {24},
  pages        = {2058--2068},
  year         = {2022},
  url          = {https://doi.org/10.1109/TMM.2021.3075323},
  doi          = {10.1109/TMM.2021.3075323},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tmm/WuXZYZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/FeiZXTRZ22,
  author       = {Lunke Fei and
                  Bob Zhang and
                  Yong Xu and
                  Chunwei Tian and
                  Imad Rida and
                  David Zhang},
  title        = {Jointly Heterogeneous Palmprint Discriminant Feature Learning},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {33},
  number       = {9},
  pages        = {4979--4990},
  year         = {2022},
  url          = {https://doi.org/10.1109/TNNLS.2021.3066381},
  doi          = {10.1109/TNNLS.2021.3066381},
  timestamp    = {Mon, 28 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tnn/FeiZXTRZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/TianXZLZ22,
  author       = {Chunwei Tian and
                  Yong Xu and
                  Wangmeng Zuo and
                  Chia{-}Wen Lin and
                  David Zhang},
  title        = {Asymmetric {CNN} for Image Superresolution},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Syst.},
  volume       = {52},
  number       = {6},
  pages        = {3718--3730},
  year         = {2022},
  url          = {https://doi.org/10.1109/TSMC.2021.3069265},
  doi          = {10.1109/TSMC.2021.3069265},
  timestamp    = {Mon, 13 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/TianXZLZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/ChenZLCLZ22,
  author       = {Bingzhi Chen and
                  Zheng Zhang and
                  Yao Lu and
                  Fanglin Chen and
                  Guangming Lu and
                  David Zhang},
  title        = {Semantic-Interactive Graph Convolutional Network for Multilabel Image
                  Recognition},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Syst.},
  volume       = {52},
  number       = {8},
  pages        = {4887--4899},
  year         = {2022},
  url          = {https://doi.org/10.1109/TSMC.2021.3103842},
  doi          = {10.1109/TSMC.2021.3103842},
  timestamp    = {Mon, 08 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/ChenZLCLZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/LiangLFZLZ22,
  author       = {Xu Liang and
                  Zhaoqun Li and
                  Dandan Fan and
                  Bob Zhang and
                  Guangming Lu and
                  David Zhang},
  title        = {Innovative Contactless Palmprint Recognition System Based on Dual-Camera
                  Alignment},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Syst.},
  volume       = {52},
  number       = {10},
  pages        = {6464--6476},
  year         = {2022},
  url          = {https://doi.org/10.1109/TSMC.2022.3146777},
  doi          = {10.1109/TSMC.2022.3146777},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/LiangLFZLZ22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/LinLMLLXL022,
  author       = {Xinyu Lin and
                  Jinxing Li and
                  Zeyu Ma and
                  Huafeng Li and
                  Shuang Li and
                  Kaixiong Xu and
                  Guangming Lu and
                  David Zhang},
  title        = {Learning Modal-Invariant and Temporal-Memory for Video-based Visible-Infrared
                  Person Re-Identification},
  booktitle    = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition,
                  {CVPR} 2022, New Orleans, LA, USA, June 18-24, 2022},
  pages        = {20941--20950},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/CVPR52688.2022.02030},
  doi          = {10.1109/CVPR52688.2022.02030},
  timestamp    = {Wed, 05 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cvpr/LinLMLLXL022.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2203-10247,
  author       = {Qing Cai and
                  Yiming Qian and
                  Jinxing Li and
                  Jun Lv and
                  Yee{-}Hong Yang and
                  Feng Wu and
                  David Zhang},
  title        = {{HIPA:} Hierarchical Patch Transformer for Single Image Super Resolution},
  journal      = {CoRR},
  volume       = {abs/2203.10247},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2203.10247},
  doi          = {10.48550/ARXIV.2203.10247},
  eprinttype    = {arXiv},
  eprint       = {2203.10247},
  timestamp    = {Wed, 14 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2203-10247.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2205-14548,
  author       = {Chunwei Tian and
                  Yixuan Yuan and
                  Shichao Zhang and
                  Chia{-}Wen Lin and
                  Wangmeng Zuo and
                  David Zhang},
  title        = {Image Super-resolution with An Enhanced Group Convolutional Neural
                  Network},
  journal      = {CoRR},
  volume       = {abs/2205.14548},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2205.14548},
  doi          = {10.48550/ARXIV.2205.14548},
  eprinttype    = {arXiv},
  eprint       = {2205.14548},
  timestamp    = {Wed, 01 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2205-14548.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2207-08808,
  author       = {Xin Feng and
                  Haobo Ji and
                  Wenjie Pei and
                  Fanglin Chen and
                  David Zhang and
                  Guangming Lu},
  title        = {Global-Local Stepwise Generative Network for Ultra High-Resolution
                  Image Restoration},
  journal      = {CoRR},
  volume       = {abs/2207.08808},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2207.08808},
  doi          = {10.48550/ARXIV.2207.08808},
  eprinttype    = {arXiv},
  eprint       = {2207.08808},
  timestamp    = {Mon, 25 Jul 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2207-08808.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2208-02450,
  author       = {Xinyu Lin and
                  Jinxing Li and
                  Zeyu Ma and
                  Huafeng Li and
                  Shuang Li and
                  Kaixiong Xu and
                  Guangming Lu and
                  David Zhang},
  title        = {Learning Modal-Invariant and Temporal-Memory for Video-based Visible-Infrared
                  Person Re-Identification},
  journal      = {CoRR},
  volume       = {abs/2208.02450},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2208.02450},
  doi          = {10.48550/ARXIV.2208.02450},
  eprinttype    = {arXiv},
  eprint       = {2208.02450},
  timestamp    = {Tue, 09 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2208-02450.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2209-12394,
  author       = {Chunwei Tian and
                  Menghua Zheng and
                  Wangmeng Zuo and
                  Bob Zhang and
                  Yanning Zhang and
                  David Zhang},
  title        = {Multi-stage image denoising with the wavelet transform},
  journal      = {CoRR},
  volume       = {abs/2209.12394},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2209.12394},
  doi          = {10.48550/ARXIV.2209.12394},
  eprinttype    = {arXiv},
  eprint       = {2209.12394},
  timestamp    = {Mon, 14 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2209-12394.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2209-12406,
  author       = {Chunwei Tian and
                  Yanning Zhang and
                  Wangmeng Zuo and
                  Chia{-}Wen Lin and
                  David Zhang and
                  Yixuan Yuan},
  title        = {A heterogeneous group {CNN} for image super-resolution},
  journal      = {CoRR},
  volume       = {abs/2209.12406},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2209.12406},
  doi          = {10.48550/ARXIV.2209.12406},
  eprinttype    = {arXiv},
  eprint       = {2209.12406},
  timestamp    = {Thu, 06 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2209-12406.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/LuLZLXZ21,
  author       = {Yao Lu and
                  Guangming Lu and
                  Yicong Zhou and
                  Jinxing Li and
                  Yuanrong Xu and
                  David Zhang},
  title        = {Highly shared Convolutional Neural Networks},
  journal      = {Expert Syst. Appl.},
  volume       = {175},
  pages        = {114782},
  year         = {2021},
  url          = {https://doi.org/10.1016/j.eswa.2021.114782},
  doi          = {10.1016/J.ESWA.2021.114782},
  timestamp    = {Fri, 25 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/eswa/LuLZLXZ21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/inffus/LiLLXZZ21,
  author       = {Jinxing Li and
                  Zhaoqun Li and
                  Guangming Lu and
                  Yong Xu and
                  Bob Zhang and
                  David Zhang},
  title        = {Asymmetric Gaussian Process multi-view learning for visual classification},
  journal      = {Inf. Fusion},
  volume       = {65},
  pages        = {108--118},
  year         = {2021},
  url          = {https://doi.org/10.1016/j.inffus.2020.08.020},
  doi          = {10.1016/J.INFFUS.2020.08.020},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/inffus/LiLLXZZ21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/kbs/TianXZDLZ21,
  author       = {Chunwei Tian and
                  Yong Xu and
                  Wangmeng Zuo and
                  Bo Du and
                  Chia{-}Wen Lin and
                  David Zhang},
  title        = {Designing and training of a dual {CNN} for image denoising},
  journal      = {Knowl. Based Syst.},
  volume       = {226},
  pages        = {106949},
  year         = {2021},
  url          = {https://doi.org/10.1016/j.knosys.2021.106949},
  doi          = {10.1016/J.KNOSYS.2021.106949},
  timestamp    = {Tue, 11 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/kbs/TianXZDLZ21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/RenZZZY21,
  author       = {Dongwei Ren and
                  Wangmeng Zuo and
                  David Zhang and
                  Lei Zhang and
                  Ming{-}Hsuan Yang},
  title        = {Simultaneous Fidelity and Regularization Learning for Image Restoration},
  journal      = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
  volume       = {43},
  number       = {1},
  pages        = {284--299},
  year         = {2021},
  url          = {https://doi.org/10.1109/TPAMI.2019.2926357},
  doi          = {10.1109/TPAMI.2019.2926357},
  timestamp    = {Thu, 04 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pami/RenZZZY21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/0005ZGY021,
  author       = {Mu Li and
                  Wangmeng Zuo and
                  Shuhang Gu and
                  Jane You and
                  David Zhang},
  title        = {Learning Content-Weighted Deep Image Compression},
  journal      = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
  volume       = {43},
  number       = {10},
  pages        = {3446--3461},
  year         = {2021},
  url          = {https://doi.org/10.1109/TPAMI.2020.2983926},
  doi          = {10.1109/TPAMI.2020.2983926},
  timestamp    = {Wed, 16 Mar 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pami/0005ZGY021.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/FeiZWTLZ21,
  author       = {Lunke Fei and
                  Bob Zhang and
                  Jie Wen and
                  Shaohua Teng and
                  Shuyi Li and
                  David Zhang},
  title        = {Jointly learning compact multi-view hash codes for few-shot {FKP}
                  recognition},
  journal      = {Pattern Recognit.},
  volume       = {115},
  pages        = {107894},
  year         = {2021},
  url          = {https://doi.org/10.1016/j.patcog.2021.107894},
  doi          = {10.1016/J.PATCOG.2021.107894},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/FeiZWTLZ21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spl/LiangYLZ21,
  author       = {Xu Liang and
                  Jinyang Yang and
                  Guangming Lu and
                  David Zhang},
  title        = {CompNet: Competitive Neural Network for Palmprint Recognition Using
                  Learnable Gabor Kernels},
  journal      = {{IEEE} Signal Process. Lett.},
  volume       = {28},
  pages        = {1739--1743},
  year         = {2021},
  url          = {https://doi.org/10.1109/LSP.2021.3103475},
  doi          = {10.1109/LSP.2021.3103475},
  timestamp    = {Tue, 05 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/spl/LiangYLZ21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taslp/ChenCHZLZ21,
  author       = {Bingzhi Chen and
                  Qi Cao and
                  Mixiao Hou and
                  Zheng Zhang and
                  Guangming Lu and
                  David Zhang},
  title        = {Multimodal Emotion Recognition With Temporal and Semantic Consistency},
  journal      = {{IEEE} {ACM} Trans. Audio Speech Lang. Process.},
  volume       = {29},
  pages        = {3592--3603},
  year         = {2021},
  url          = {https://doi.org/10.1109/TASLP.2021.3129331},
  doi          = {10.1109/TASLP.2021.3129331},
  timestamp    = {Sat, 09 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/taslp/ChenCHZLZ21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/WuZ0021,
  author       = {Jian Wu and
                  Bob Zhang and
                  Yong Xu and
                  David Zhang},
  title        = {Illuminance Compensation and Texture Enhancement via the Hodge Decomposition},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {31},
  number       = {3},
  pages        = {956--971},
  year         = {2021},
  url          = {https://doi.org/10.1109/TCSVT.2020.2997856},
  doi          = {10.1109/TCSVT.2020.2997856},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcsv/WuZ0021.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/ZhangLZ21,
  author       = {Lei Zhang and
                  Fangyi Liu and
                  David Zhang},
  title        = {Adversarial View Confusion Feature Learning for Person Re-Identification},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {31},
  number       = {4},
  pages        = {1490--1502},
  year         = {2021},
  url          = {https://doi.org/10.1109/TCSVT.2020.3002956},
  doi          = {10.1109/TCSVT.2020.3002956},
  timestamp    = {Thu, 29 Apr 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcsv/ZhangLZ21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/LiLZYZ21,
  author       = {Jinxing Li and
                  Guangming Lu and
                  Bob Zhang and
                  Jane You and
                  David Zhang},
  title        = {Shared Linear Encoder-Based Multikernel Gaussian Process Latent Variable
                  Model for Visual Classification},
  journal      = {{IEEE} Trans. Cybern.},
  volume       = {51},
  number       = {2},
  pages        = {534--547},
  year         = {2021},
  url          = {https://doi.org/10.1109/TCYB.2019.2915789},
  doi          = {10.1109/TCYB.2019.2915789},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcyb/LiLZYZ21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/XuYSZMZZ21,
  author       = {Jun Xu and
                  Mengyang Yu and
                  Ling Shao and
                  Wangmeng Zuo and
                  Deyu Meng and
                  Lei Zhang and
                  David Zhang},
  title        = {Scaled Simplex Representation for Subspace Clustering},
  journal      = {{IEEE} Trans. Cybern.},
  volume       = {51},
  number       = {3},
  pages        = {1493--1505},
  year         = {2021},
  url          = {https://doi.org/10.1109/TCYB.2019.2943691},
  doi          = {10.1109/TCYB.2019.2943691},
  timestamp    = {Tue, 01 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcyb/XuYSZMZZ21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/ZhangDZJW21,
  author       = {Lei Zhang and
                  Qingyan Duan and
                  David Zhang and
                  Wei Jia and
                  Xizhao Wang},
  title        = {AdvKin: Adversarial Convolutional Network for Kinship Verification},
  journal      = {{IEEE} Trans. Cybern.},
  volume       = {51},
  number       = {12},
  pages        = {5883--5896},
  year         = {2021},
  url          = {https://doi.org/10.1109/TCYB.2019.2959403},
  doi          = {10.1109/TCYB.2019.2959403},
  timestamp    = {Wed, 16 Mar 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcyb/ZhangDZJW21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/LiFYGLXZ21,
  author       = {Jinxing Li and
                  Dandan Fan and
                  Lingxiao Yang and
                  Shuhang Gu and
                  Guangming Lu and
                  Yong Xu and
                  David Zhang},
  title        = {Layer-Output Guided Complementary Attention Learning for Image Defocus
                  Blur Detection},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {30},
  pages        = {3748--3763},
  year         = {2021},
  url          = {https://doi.org/10.1109/TIP.2021.3065171},
  doi          = {10.1109/TIP.2021.3065171},
  timestamp    = {Wed, 07 Apr 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/LiFYGLXZ21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/FengPJCZL21,
  author       = {Xin Feng and
                  Wenjie Pei and
                  Zihui Jia and
                  Fanglin Chen and
                  David Zhang and
                  Guangming Lu},
  title        = {Deep-Masking Generative Network: {A} Unified Framework for Background
                  Restoration From Superimposed Images},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {30},
  pages        = {4867--4882},
  year         = {2021},
  url          = {https://doi.org/10.1109/TIP.2021.3076589},
  doi          = {10.1109/TIP.2021.3076589},
  timestamp    = {Tue, 16 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/FengPJCZL21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/LiZLXWZ21,
  author       = {Jinxing Li and
                  Bob Zhang and
                  Guangming Lu and
                  Yong Xu and
                  Feng Wu and
                  David Zhang},
  title        = {Harmonization Shared Autoencoder Gaussian Process Latent Variable
                  Model With Relaxed Hamming Distance},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {32},
  number       = {11},
  pages        = {5093--5107},
  year         = {2021},
  url          = {https://doi.org/10.1109/TNNLS.2020.3026876},
  doi          = {10.1109/TNNLS.2020.3026876},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tnn/LiZLXWZ21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/LiangZLGL21,
  author       = {Xu Liang and
                  David Zhang and
                  Guangming Lu and
                  Zhenhua Guo and
                  Nan Luo},
  title        = {A Novel Multicamera System for High-Speed Touchless Palm Recognition},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Syst.},
  volume       = {51},
  number       = {3},
  pages        = {1534--1548},
  year         = {2021},
  url          = {https://doi.org/10.1109/TSMC.2019.2898684},
  doi          = {10.1109/TSMC.2019.2898684},
  timestamp    = {Wed, 07 Apr 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/LiangZLGL21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/XuLLLZ21,
  author       = {Yuanrong Xu and
                  Yao Lu and
                  Guangming Lu and
                  Jinxing Li and
                  David Zhang},
  title        = {Fast Pore Comparison for High Resolution Fingerprint Images Based
                  on Multiple Co-Occurrence Descriptors and Local Topology Similarities},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Syst.},
  volume       = {51},
  number       = {9},
  pages        = {5721--5731},
  year         = {2021},
  url          = {https://doi.org/10.1109/TSMC.2019.2957411},
  doi          = {10.1109/TSMC.2019.2957411},
  timestamp    = {Tue, 05 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/XuLLLZ21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acpr/LiangLFYLZ21,
  author       = {Xu Liang and
                  Zhaoqun Li and
                  Dandan Fan and
                  Jinyang Yang and
                  Guangming Lu and
                  David Zhang},
  editor       = {Christian Wallraven and
                  Qingshan Liu and
                  Hajime Nagahara},
  title        = {SaME: Sharpness-aware Matching Ensemble for Robust Palmprint Recognition},
  booktitle    = {Pattern Recognition - 6th Asian Conference, {ACPR} 2021, Jeju Island,
                  South Korea, November 9-12, 2021, Revised Selected Papers, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {13188},
  pages        = {488--500},
  publisher    = {Springer},
  year         = {2021},
  url          = {https://doi.org/10.1007/978-3-031-02375-0\_36},
  doi          = {10.1007/978-3-031-02375-0\_36},
  timestamp    = {Fri, 13 May 2022 16:17:44 +0200},
  biburl       = {https://dblp.org/rec/conf/acpr/LiangLFYLZ21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iconip/LiLFL021,
  author       = {Zhaoqun Li and
                  Xu Liang and
                  Dandan Fan and
                  Jinxing Li and
                  David Zhang},
  editor       = {Teddy Mantoro and
                  Minho Lee and
                  Media Anugerah Ayu and
                  Kok Wai Wong and
                  Achmad Nizar Hidayanto},
  title        = {BPFNet: {A} Unified Framework for Bimodal Palmprint Alignment and
                  Fusion},
  booktitle    = {Neural Information Processing - 28th International Conference, {ICONIP}
                  2021, Sanur, Bali, Indonesia, December 8-12, 2021, Proceedings, Part
                  {VI}},
  series       = {Communications in Computer and Information Science},
  volume       = {1517},
  pages        = {28--36},
  publisher    = {Springer},
  year         = {2021},
  url          = {https://doi.org/10.1007/978-3-030-92310-5\_4},
  doi          = {10.1007/978-3-030-92310-5\_4},
  timestamp    = {Thu, 23 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iconip/LiLFL021.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2103-02167,
  author       = {Zhaoqun Li and
                  Xu Liang and
                  Dandan Fan and
                  Jinxing Li and
                  Wei Jia and
                  David Zhang},
  title        = {Touchless Palmprint Recognition based on 3D Gabor Template and Block
                  Feature Refinement},
  journal      = {CoRR},
  volume       = {abs/2103.02167},
  year         = {2021},
  url          = {https://arxiv.org/abs/2103.02167},
  eprinttype    = {arXiv},
  eprint       = {2103.02167},
  timestamp    = {Thu, 06 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2103-02167.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2103-13634,
  author       = {Chunwei Tian and
                  Yong Xu and
                  Wangmeng Zuo and
                  Chia{-}Wen Lin and
                  David Zhang},
  title        = {Asymmetric {CNN} for image super-resolution},
  journal      = {CoRR},
  volume       = {abs/2103.13634},
  year         = {2021},
  url          = {https://arxiv.org/abs/2103.13634},
  eprinttype    = {arXiv},
  eprint       = {2103.13634},
  timestamp    = {Tue, 22 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2103-13634.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2106-13929,
  author       = {Huafeng Li and
                  Kaixiong Xu and
                  Jinxing Li and
                  Guangming Lu and
                  Yong Xu and
                  Zhengtao Yu and
                  David Zhang},
  title        = {Dual-Stream Reciprocal Disentanglement Learning for Domain Adaption
                  Person Re-Identification},
  journal      = {CoRR},
  volume       = {abs/2106.13929},
  year         = {2021},
  url          = {https://arxiv.org/abs/2106.13929},
  eprinttype    = {arXiv},
  eprint       = {2106.13929},
  timestamp    = {Wed, 30 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2106-13929.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2107-05274,
  author       = {Bingzhi Chen and
                  Yishu Liu and
                  Zheng Zhang and
                  Guangming Lu and
                  David Zhang},
  title        = {TransAttUnet: Multi-level Attention-guided U-Net with Transformer
                  for Medical Image Segmentation},
  journal      = {CoRR},
  volume       = {abs/2107.05274},
  year         = {2021},
  url          = {https://arxiv.org/abs/2107.05274},
  eprinttype    = {arXiv},
  eprint       = {2107.05274},
  timestamp    = {Tue, 10 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2107-05274.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2110-00261,
  author       = {Xin Feng and
                  Wenjie Pei and
                  Fengjun Li and
                  Fanglin Chen and
                  David Zhang and
                  Guangming Lu},
  title        = {Generative Memory-Guided Semantic Reasoning Model for Image Inpainting},
  journal      = {CoRR},
  volume       = {abs/2110.00261},
  year         = {2021},
  url          = {https://arxiv.org/abs/2110.00261},
  eprinttype    = {arXiv},
  eprint       = {2110.00261},
  timestamp    = {Fri, 08 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2110-00261.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2110-01179,
  author       = {Zhaoqun Li and
                  Xu Liang and
                  Dandan Fan and
                  Jinxing Li and
                  David Zhang},
  title        = {BPFNet: {A} Unified Framework for Bimodal Palmprint Alignment and
                  Fusion},
  journal      = {CoRR},
  volume       = {abs/2110.01179},
  year         = {2021},
  url          = {https://arxiv.org/abs/2110.01179},
  eprinttype    = {arXiv},
  eprint       = {2110.01179},
  timestamp    = {Fri, 08 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2110-01179.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2110-04791,
  author       = {Zengwei Yao and
                  Wenjie Pei and
                  Fanglin Chen and
                  Guangming Lu and
                  David Zhang},
  title        = {Stepwise-Refining Speech Separation Network via Fine-Grained Encoding
                  in High-order Latent Domain},
  journal      = {CoRR},
  volume       = {abs/2110.04791},
  year         = {2021},
  url          = {https://arxiv.org/abs/2110.04791},
  eprinttype    = {arXiv},
  eprint       = {2110.04791},
  timestamp    = {Mon, 25 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2110-04791.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2110-08080,
  author       = {Chun{-}Mei Feng and
                  Huazhu Fu and
                  Tianfei Zhou and
                  Yong Xu and
                  Ling Shao and
                  David Zhang},
  title        = {Multi-modal Aggregation Network for Fast {MR} Imaging},
  journal      = {CoRR},
  volume       = {abs/2110.08080},
  year         = {2021},
  url          = {https://arxiv.org/abs/2110.08080},
  eprinttype    = {arXiv},
  eprint       = {2110.08080},
  timestamp    = {Tue, 26 Jul 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2110-08080.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2111-08974,
  author       = {Zebin Lin and
                  Wenjie Pei and
                  Fanglin Chen and
                  David Zhang and
                  Guangming Lu},
  title        = {Pedestrian Detection by Exemplar-Guided Contrastive Learning},
  journal      = {CoRR},
  volume       = {abs/2111.08974},
  year         = {2021},
  url          = {https://arxiv.org/abs/2111.08974},
  eprinttype    = {arXiv},
  eprint       = {2111.08974},
  timestamp    = {Mon, 22 Nov 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2111-08974.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2112-13227,
  author       = {Mu Li and
                  Kede Ma and
                  Jinxing Li and
                  David Zhang},
  title        = {Pseudocylindrical Convolutions for Learned Omnidirectional Image Compression},
  journal      = {CoRR},
  volume       = {abs/2112.13227},
  year         = {2021},
  url          = {https://arxiv.org/abs/2112.13227},
  eprinttype    = {arXiv},
  eprint       = {2112.13227},
  timestamp    = {Wed, 05 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2112-13227.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/sp/LiuZZ20,
  author       = {Feng Liu and
                  Qijun Zhao and
                  David Zhang},
  title        = {Advanced Fingerprint Recognition: From 3D Shape to Ridge Detail, 2},
  publisher    = {Springer},
  year         = {2020},
  url          = {https://doi.org/10.1007/978-981-15-4128-5},
  doi          = {10.1007/978-981-15-4128-5},
  isbn         = {978-981-15-4127-8},
  timestamp    = {Fri, 17 Jul 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/books/sp/LiuZZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/sp/ZhangW20,
  author       = {David Zhang and
                  Kebin Wu},
  title        = {Pathological Voice Analysis},
  publisher    = {Springer},
  year         = {2020},
  url          = {https://doi.org/10.1007/978-981-32-9196-6},
  doi          = {10.1007/978-981-32-9196-6},
  isbn         = {978-981-32-9195-9},
  timestamp    = {Sat, 25 Dec 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/books/sp/ZhangW20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/WuZXZ20,
  author       = {Jian Wu and
                  Bob Zhang and
                  Yong Xu and
                  David Zhang},
  title        = {Tongue Image Alignment via Conformal Mapping for Disease Detection},
  journal      = {{IEEE} Access},
  volume       = {8},
  pages        = {9796--9808},
  year         = {2020},
  url          = {https://doi.org/10.1109/ACCESS.2019.2960578},
  doi          = {10.1109/ACCESS.2019.2960578},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/access/WuZXZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bspc/JiangGZLZ20,
  author       = {Zhixing Jiang and
                  Chaoxun Guo and
                  Jin Zang and
                  Guangming Lu and
                  David Zhang},
  title        = {Features fusion of multichannel wrist pulse signal based on {KL-MGDCCA}
                  and decision level combination},
  journal      = {Biomed. Signal Process. Control.},
  volume       = {57},
  year         = {2020},
  url          = {https://doi.org/10.1016/j.bspc.2019.101751},
  doi          = {10.1016/J.BSPC.2019.101751},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/bspc/JiangGZLZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/LiLLZYZ20,
  author       = {Jinxing Li and
                  Mu Li and
                  Guangming Lu and
                  Bob Zhang and
                  Hongpeng Yin and
                  David Zhang},
  title        = {Similarity and diversity induced paired projection for cross-modal
                  retrieval},
  journal      = {Inf. Sci.},
  volume       = {539},
  pages        = {215--228},
  year         = {2020},
  url          = {https://doi.org/10.1016/j.ins.2020.06.032},
  doi          = {10.1016/J.INS.2020.06.032},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/isci/LiLLZYZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/LuLLXZ20,
  author       = {Yao Lu and
                  Guangming Lu and
                  Jinxing Li and
                  Yuanrong Xu and
                  David Zhang},
  title        = {High-parameter-efficiency convolutional neural networks},
  journal      = {Neural Comput. Appl.},
  volume       = {32},
  number       = {14},
  pages        = {10633--10644},
  year         = {2020},
  url          = {https://doi.org/10.1007/s00521-019-04596-w},
  doi          = {10.1007/S00521-019-04596-W},
  timestamp    = {Thu, 10 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nca/LuLLXZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/BaiMGZZ20,
  author       = {Xuefei Bai and
                  Zhaozong Meng and
                  Nan Gao and
                  Zonghua Zhang and
                  David Zhang},
  title        = {3D palmprint identification using blocked histogram and improved sparse
                  representation-based classifier},
  journal      = {Neural Comput. Appl.},
  volume       = {32},
  number       = {16},
  pages        = {12547--12560},
  year         = {2020},
  url          = {https://doi.org/10.1007/s00521-020-04711-2},
  doi          = {10.1007/S00521-020-04711-2},
  timestamp    = {Thu, 10 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nca/BaiMGZZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/ZhangLYHNZ20,
  author       = {Lei Zhang and
                  Ji Liu and
                  Yang Yang and
                  Fuxiang Huang and
                  Feiping Nie and
                  David Zhang},
  title        = {Optimal Projection Guided Transfer Hashing for Image Retrieval},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {30},
  number       = {10},
  pages        = {3788--3802},
  year         = {2020},
  url          = {https://doi.org/10.1109/TCSVT.2019.2943902},
  doi          = {10.1109/TCSVT.2019.2943902},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcsv/ZhangLYHNZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/FeiZJWZ20,
  author       = {Lunke Fei and
                  Bob Zhang and
                  Wei Jia and
                  Jie Wen and
                  David Zhang},
  title        = {Feature Extraction for 3-D Palmprint Recognition: {A} Survey},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {69},
  number       = {3},
  pages        = {645--656},
  year         = {2020},
  url          = {https://doi.org/10.1109/TIM.2020.2964076},
  doi          = {10.1109/TIM.2020.2964076},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tim/FeiZJWZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/ZhangLZZZ20,
  author       = {Lei Zhang and
                  Ji Liu and
                  Bob Zhang and
                  David Zhang and
                  Ce Zhu},
  title        = {Deep Cascade Model-Based Face Recognition: When Deep-Layered Learning
                  Meets Small Data},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {29},
  pages        = {1016--1029},
  year         = {2020},
  url          = {https://doi.org/10.1109/TIP.2019.2938307},
  doi          = {10.1109/TIP.2019.2938307},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/ZhangLZZZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/LiGLZXWZ20,
  author       = {Jinxing Li and
                  Xiaobao Guo and
                  Guangming Lu and
                  Bob Zhang and
                  Yong Xu and
                  Feng Wu and
                  David Zhang},
  title        = {{DRPL:} Deep Regression Pair Learning for Multi-Focus Image Fusion},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {29},
  pages        = {4816--4831},
  year         = {2020},
  url          = {https://doi.org/10.1109/TIP.2020.2976190},
  doi          = {10.1109/TIP.2020.2976190},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/LiGLZXWZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/LiMYZZ20,
  author       = {Mu Li and
                  Kede Ma and
                  Jane You and
                  David Zhang and
                  Wangmeng Zuo},
  title        = {Efficient and Effective Context-Based Convolutional Entropy Modeling
                  for Image Compression},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {29},
  pages        = {5900--5911},
  year         = {2020},
  url          = {https://doi.org/10.1109/TIP.2020.2985225},
  doi          = {10.1109/TIP.2020.2985225},
  timestamp    = {Tue, 22 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/LiMYZZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/LiWZZZ20,
  author       = {Feng Li and
                  Xiaohe Wu and
                  Wangmeng Zuo and
                  David Zhang and
                  Lei Zhang},
  title        = {Remove Cosine Window From Correlation Filter-Based Visual Trackers:
                  When and How},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {29},
  pages        = {7045--7060},
  year         = {2020},
  url          = {https://doi.org/10.1109/TIP.2020.2997521},
  doi          = {10.1109/TIP.2020.2997521},
  timestamp    = {Wed, 25 Nov 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tip/LiWZZZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/ZhangLHYZ20,
  author       = {Lei Zhang and
                  Ji Liu and
                  Fuxiang Huang and
                  Yang Yang and
                  David Zhang},
  title        = {Deep-Like Hashing-in-Hash for Visual Retrieval: An Embarrassingly
                  Simple Method},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {29},
  pages        = {8149--8162},
  year         = {2020},
  url          = {https://doi.org/10.1109/TIP.2020.3011796},
  doi          = {10.1109/TIP.2020.3011796},
  timestamp    = {Fri, 25 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tip/ZhangLHYZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/ChenLL020,
  author       = {Bingzhi Chen and
                  Jinxing Li and
                  Guangming Lu and
                  David Zhang},
  title        = {Lesion Location Attention Guided Network for Multi-Label Thoracic
                  Disease Classification in Chest X-Rays},
  journal      = {{IEEE} J. Biomed. Health Informatics},
  volume       = {24},
  number       = {7},
  pages        = {2016--2027},
  year         = {2020},
  url          = {https://doi.org/10.1109/JBHI.2019.2952597},
  doi          = {10.1109/JBHI.2019.2952597},
  timestamp    = {Thu, 13 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/titb/ChenLL020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/ChenLLYZ20,
  author       = {Bingzhi Chen and
                  Jinxing Li and
                  Guangming Lu and
                  Hongbing Yu and
                  David Zhang},
  title        = {Label Co-Occurrence Learning With Graph Convolutional Networks for
                  Multi-Label Chest X-Ray Image Classification},
  journal      = {{IEEE} J. Biomed. Health Informatics},
  volume       = {24},
  number       = {8},
  pages        = {2292--2302},
  year         = {2020},
  url          = {https://doi.org/10.1109/JBHI.2020.2967084},
  doi          = {10.1109/JBHI.2020.2967084},
  timestamp    = {Thu, 04 Mar 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/titb/ChenLLYZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/LuLLLZ20,
  author       = {Yao Lu and
                  Guangming Lu and
                  Rui Lin and
                  Jinxing Li and
                  David Zhang},
  title        = {SRGC-Nets: Sparse Repeated Group Convolutional Neural Networks},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {31},
  number       = {8},
  pages        = {2889--2902},
  year         = {2020},
  url          = {https://doi.org/10.1109/TNNLS.2019.2933665},
  doi          = {10.1109/TNNLS.2019.2933665},
  timestamp    = {Thu, 04 Mar 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tnn/LuLLLZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/ZhangFWZDC20,
  author       = {Lei Zhang and
                  Jingru Fu and
                  Shanshan Wang and
                  David Zhang and
                  Zhaoyang Dong and
                  C. L. Philip Chen},
  title        = {Guide Subspace Learning for Unsupervised Domain Adaptation},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {31},
  number       = {9},
  pages        = {3374--3388},
  year         = {2020},
  url          = {https://doi.org/10.1109/TNNLS.2019.2944455},
  doi          = {10.1109/TNNLS.2019.2944455},
  timestamp    = {Tue, 03 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tnn/ZhangFWZDC20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/LiZLYXWZ20,
  author       = {Jinxing Li and
                  Bob Zhang and
                  Guangming Lu and
                  Jane You and
                  Yong Xu and
                  Feng Wu and
                  David Zhang},
  title        = {Relaxed Asymmetric Deep Hashing Learning: Point-to-Angle Matching},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {31},
  number       = {11},
  pages        = {4791--4805},
  year         = {2020},
  url          = {https://doi.org/10.1109/TNNLS.2019.2958061},
  doi          = {10.1109/TNNLS.2019.2958061},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tnn/LiZLYXWZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2005-04661,
  author       = {Mu Li and
                  Kai Zhang and
                  Wangmeng Zuo and
                  Radu Timofte and
                  David Zhang},
  title        = {Learning Context-Based Non-local Entropy Modeling for Image Compression},
  journal      = {CoRR},
  volume       = {abs/2005.04661},
  year         = {2020},
  url          = {https://arxiv.org/abs/2005.04661},
  eprinttype    = {arXiv},
  eprint       = {2005.04661},
  timestamp    = {Thu, 04 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2005-04661.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2007-03951,
  author       = {Chunwei Tian and
                  Yong Xu and
                  Wangmeng Zuo and
                  Bo Du and
                  Chia{-}Wen Lin and
                  David Zhang},
  title        = {Designing and Training of {A} Dual {CNN} for Image Denoising},
  journal      = {CoRR},
  volume       = {abs/2007.03951},
  year         = {2020},
  url          = {https://arxiv.org/abs/2007.03951},
  eprinttype    = {arXiv},
  eprint       = {2007.03951},
  timestamp    = {Tue, 24 Jan 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2007-03951.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2010-04324,
  author       = {Xin Feng and
                  Wenjie Pei and
                  Zihui Jia and
                  David Zhang and
                  Guangming Lu},
  title        = {Deep-Masking Generative Network: {A} Unified Framework for Background
                  Restoration from Superimposed Images},
  journal      = {CoRR},
  volume       = {abs/2010.04324},
  year         = {2020},
  url          = {https://arxiv.org/abs/2010.04324},
  eprinttype    = {arXiv},
  eprint       = {2010.04324},
  timestamp    = {Tue, 25 May 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2010-04324.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/WuCCZZY19,
  author       = {Guangbin Wu and
                  Weishan Chen and
                  Hui Cheng and
                  Wangmeng Zuo and
                  David Zhang and
                  Jane You},
  title        = {Multi-Object Grasping Detection With Hierarchical Feature Fusion},
  journal      = {{IEEE} Access},
  volume       = {7},
  pages        = {43884--43894},
  year         = {2019},
  url          = {https://doi.org/10.1109/ACCESS.2019.2908281},
  doi          = {10.1109/ACCESS.2019.2908281},
  timestamp    = {Thu, 17 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/access/WuCCZZY19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/LiZLZ19,
  author       = {Jinxing Li and
                  Bob Zhang and
                  Guangming Lu and
                  David Zhang},
  title        = {Dual Asymmetric Deep Hashing Learning},
  journal      = {{IEEE} Access},
  volume       = {7},
  pages        = {113372--113384},
  year         = {2019},
  url          = {https://doi.org/10.1109/ACCESS.2019.2927524},
  doi          = {10.1109/ACCESS.2019.2927524},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/access/LiZLZ19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/JiangZL19,
  author       = {Zhixing Jiang and
                  David Zhang and
                  Guangming Lu},
  title        = {Radial artery pulse waveform analysis based on curve fitting using
                  discrete Fourier series},
  journal      = {Comput. Methods Programs Biomed.},
  volume       = {174},
  pages        = {25--31},
  year         = {2019},
  url          = {https://doi.org/10.1016/j.cmpb.2018.04.019},
  doi          = {10.1016/J.CMPB.2018.04.019},
  timestamp    = {Sat, 30 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cmpb/JiangZL19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijprai/WuZCZX19,
  author       = {Guangbin Wu and
                  David Zhang and
                  Weishan Chen and
                  Wangmeng Zuo and
                  Zhuang Xia},
  title        = {Robust Deep Softmax Regression Against Label Noise for Unsupervised
                  Domain Adaptation},
  journal      = {Int. J. Pattern Recognit. Artif. Intell.},
  volume       = {33},
  number       = {7},
  pages        = {1940002:1--1940002:30},
  year         = {2019},
  url          = {https://doi.org/10.1142/S0218001419400020},
  doi          = {10.1142/S0218001419400020},
  timestamp    = {Mon, 11 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijprai/WuZCZX19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/inffus/LiZLZ19,
  author       = {Jinxing Li and
                  Bob Zhang and
                  Guangming Lu and
                  David Zhang},
  title        = {Generative multi-view and multi-feature learning for classification},
  journal      = {Inf. Fusion},
  volume       = {45},
  pages        = {215--226},
  year         = {2019},
  url          = {https://doi.org/10.1016/j.inffus.2018.02.005},
  doi          = {10.1016/J.INFFUS.2018.02.005},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/inffus/LiZLZ19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/LiZLYZ19,
  author       = {Jinxing Li and
                  Bob Zhang and
                  Guangming Lu and
                  Jane You and
                  David Zhang},
  title        = {Body surface feature-based multi-modal Learning for Diabetes Mellitus
                  detection},
  journal      = {Inf. Sci.},
  volume       = {472},
  pages        = {1--14},
  year         = {2019},
  url          = {https://doi.org/10.1016/j.ins.2018.09.010},
  doi          = {10.1016/J.INS.2018.09.010},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/isci/LiZLYZ19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/WuZLG19,
  author       = {Kebin Wu and
                  David Zhang and
                  Guangming Lu and
                  Zhenhua Guo},
  title        = {Joint learning for voice based disease detection},
  journal      = {Pattern Recognit.},
  volume       = {87},
  pages        = {130--139},
  year         = {2019},
  url          = {https://doi.org/10.1016/j.patcog.2018.09.013},
  doi          = {10.1016/J.PATCOG.2018.09.013},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/WuZLG19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/XuAZZ19,
  author       = {Jun Xu and
                  Wangpeng An and
                  Lei Zhang and
                  David Zhang},
  title        = {Sparse, collaborative, or nonnegative representation: Which helps
                  pattern classification?},
  journal      = {Pattern Recognit.},
  volume       = {88},
  pages        = {679--688},
  year         = {2019},
  url          = {https://doi.org/10.1016/j.patcog.2018.12.023},
  doi          = {10.1016/J.PATCOG.2018.12.023},
  timestamp    = {Thu, 04 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/XuAZZ19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/XuLL019,
  author       = {Yuanrong Xu and
                  Guangming Lu and
                  Yao Lu and
                  David Zhang},
  title        = {High resolution fingerprint recognition using pore and edge descriptors},
  journal      = {Pattern Recognit. Lett.},
  volume       = {125},
  pages        = {773--779},
  year         = {2019},
  url          = {https://doi.org/10.1016/j.patrec.2019.08.006},
  doi          = {10.1016/J.PATREC.2019.08.006},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/prl/XuLL019.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/LuYLLZW19,
  author       = {Yuwu Lu and
                  Chun Yuan and
                  Zhihui Lai and
                  Xuelong Li and
                  David Zhang and
                  Wai Keung Wong},
  title        = {Horizontal and Vertical Nuclear Norm-Based 2DLDA for Image Representation},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {29},
  number       = {4},
  pages        = {941--955},
  year         = {2019},
  url          = {https://doi.org/10.1109/TCSVT.2018.2822761},
  doi          = {10.1109/TCSVT.2018.2822761},
  timestamp    = {Mon, 14 Feb 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcsv/LuYLLZW19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/LuYLLZS19,
  author       = {Yuwu Lu and
                  Chun Yuan and
                  Xuelong Li and
                  Zhihui Lai and
                  David Zhang and
                  Linlin Shen},
  title        = {Structurally Incoherent Low-Rank 2DLPP for Image Classification},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {29},
  number       = {6},
  pages        = {1701--1714},
  year         = {2019},
  url          = {https://doi.org/10.1109/TCSVT.2018.2849757},
  doi          = {10.1109/TCSVT.2018.2849757},
  timestamp    = {Mon, 14 Feb 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcsv/LuYLLZS19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/XuLLLZ19,
  author       = {Yuanrong Xu and
                  Guangming Lu and
                  Yao Lu and
                  Feng Liu and
                  David Zhang},
  title        = {Fingerprint Pore Comparison Using Local Features and Spatial Relations},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {29},
  number       = {10},
  pages        = {2927--2940},
  year         = {2019},
  url          = {https://doi.org/10.1109/TCSVT.2018.2875147},
  doi          = {10.1109/TCSVT.2018.2875147},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcsv/XuLLLZ19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/LuLLWYZ19,
  author       = {Yuwu Lu and
                  Zhihui Lai and
                  Xuelong Li and
                  Wai Keung Wong and
                  Chun Yuan and
                  David Zhang},
  title        = {Low-Rank 2-D Neighborhood Preserving Projection for Enhanced Robust
                  Image Representation},
  journal      = {{IEEE} Trans. Cybern.},
  volume       = {49},
  number       = {5},
  pages        = {1859--1872},
  year         = {2019},
  url          = {https://doi.org/10.1109/TCYB.2018.2815559},
  doi          = {10.1109/TCYB.2018.2815559},
  timestamp    = {Mon, 14 Feb 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcyb/LuLLWYZ19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/LiZLRZ19,
  author       = {Jinxing Li and
                  Bob Zhang and
                  Guangming Lu and
                  Hu Ren and
                  David Zhang},
  title        = {Visual Classification With Multikernel Shared Gaussian Process Latent
                  Variable Model},
  journal      = {{IEEE} Trans. Cybern.},
  volume       = {49},
  number       = {8},
  pages        = {2886--2899},
  year         = {2019},
  url          = {https://doi.org/10.1109/TCYB.2018.2831457},
  doi          = {10.1109/TCYB.2018.2831457},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcyb/LiZLRZ19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/BaiGZZ19,
  author       = {Xuefei Bai and
                  Nan Gao and
                  Zonghua Zhang and
                  David Zhang},
  title        = {Person Recognition Using 3-D Palmprint Data Based on Full-Field Sinusoidal
                  Fringe Projection},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {68},
  number       = {9},
  pages        = {3287--3298},
  year         = {2019},
  url          = {https://doi.org/10.1109/TIM.2018.2877226},
  doi          = {10.1109/TIM.2018.2877226},
  timestamp    = {Mon, 08 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tim/BaiGZZ19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/JiangZL19,
  author       = {Zhixing Jiang and
                  David Zhang and
                  Guangming Lu},
  title        = {A Robust Wrist Pulse Acquisition System Based on Multisensor Collaboration
                  and Signal Quality Assessment},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {68},
  number       = {12},
  pages        = {4807--4816},
  year         = {2019},
  url          = {https://doi.org/10.1109/TIM.2019.2899514},
  doi          = {10.1109/TIM.2019.2899514},
  timestamp    = {Mon, 08 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tim/JiangZL19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/ZhangWHZYZ19,
  author       = {Lei Zhang and
                  Shanshan Wang and
                  Guang{-}Bin Huang and
                  Wangmeng Zuo and
                  Jian Yang and
                  David Zhang},
  title        = {Manifold Criterion Guided Transfer Learning via Intermediate Domain
                  Generation},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {30},
  number       = {12},
  pages        = {3759--3773},
  year         = {2019},
  url          = {https://doi.org/10.1109/TNNLS.2019.2899037},
  doi          = {10.1109/TNNLS.2019.2899037},
  timestamp    = {Tue, 03 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tnn/ZhangWHZYZ19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/FeiLJTZ19,
  author       = {Lunke Fei and
                  Guangming Lu and
                  Wei Jia and
                  Shaohua Teng and
                  David Zhang},
  title        = {Feature Extraction Methods for Palmprint Recognition: {A} Survey and
                  Evaluation},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Syst.},
  volume       = {49},
  number       = {2},
  pages        = {346--363},
  year         = {2019},
  url          = {https://doi.org/10.1109/TSMC.2018.2795609},
  doi          = {10.1109/TSMC.2018.2795609},
  timestamp    = {Wed, 20 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/FeiLJTZ19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/YangZ019,
  author       = {Lingxiao Yang and
                  David Zhang and
                  Lei Zhang},
  title        = {Learning a Visual Tracker from a Single Movie without Annotation},
  booktitle    = {The Thirty-Third {AAAI} Conference on Artificial Intelligence, {AAAI}
                  2019, The Thirty-First Innovative Applications of Artificial Intelligence
                  Conference, {IAAI} 2019, The Ninth {AAAI} Symposium on Educational
                  Advances in Artificial Intelligence, {EAAI} 2019, Honolulu, Hawaii,
                  USA, January 27 - February 1, 2019},
  pages        = {9095--9102},
  publisher    = {{AAAI} Press},
  year         = {2019},
  url          = {https://doi.org/10.1609/aaai.v33i01.33019095},
  doi          = {10.1609/AAAI.V33I01.33019095},
  timestamp    = {Mon, 04 Sep 2023 12:29:24 +0200},
  biburl       = {https://dblp.org/rec/conf/aaai/YangZ019.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1903-10211,
  author       = {Lei Zhang and
                  Shanshan Wang and
                  Guang{-}Bin Huang and
                  Wangmeng Zuo and
                  Jian Yang and
                  David Zhang},
  title        = {Manifold Criterion Guided Transfer Learning via Intermediate Domain
                  Generation},
  journal      = {CoRR},
  volume       = {abs/1903.10211},
  year         = {2019},
  url          = {http://arxiv.org/abs/1903.10211},
  eprinttype    = {arXiv},
  eprint       = {1903.10211},
  timestamp    = {Tue, 03 May 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1903-10211.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1904-00664,
  author       = {Mu Li and
                  Wangmeng Zuo and
                  Shuhang Gu and
                  Jane You and
                  David Zhang},
  title        = {Learning Content-Weighted Deep Image Compression},
  journal      = {CoRR},
  volume       = {abs/1904.00664},
  year         = {2019},
  url          = {http://arxiv.org/abs/1904.00664},
  eprinttype    = {arXiv},
  eprint       = {1904.00664},
  timestamp    = {Tue, 22 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1904-00664.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1905-06648,
  author       = {Feng Li and
                  Xiaohe Wu and
                  Wangmeng Zuo and
                  David Zhang and
                  Lei Zhang},
  title        = {Remove Cosine Window from Correlation Filter-based Visual Trackers:
                  When and How},
  journal      = {CoRR},
  volume       = {abs/1905.06648},
  year         = {2019},
  url          = {http://arxiv.org/abs/1905.06648},
  eprinttype    = {arXiv},
  eprint       = {1905.06648},
  timestamp    = {Thu, 04 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1905-06648.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1906-10057,
  author       = {Mu Li and
                  Kede Ma and
                  Jane You and
                  David Zhang and
                  Wangmeng Zuo},
  title        = {Efficient and Effective Context-Based Convolutional Entropy Modeling
                  for Image Compression},
  journal      = {CoRR},
  volume       = {abs/1906.10057},
  year         = {2019},
  url          = {http://arxiv.org/abs/1906.10057},
  eprinttype    = {arXiv},
  eprint       = {1906.10057},
  timestamp    = {Tue, 22 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1906-10057.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1912-00271,
  author       = {Shervin Minaee and
                  AmirAli Abdolrashidi and
                  Hang Su and
                  Mohammed Bennamoun and
                  David Zhang},
  title        = {Biometric Recognition Using Deep Learning: {A} Survey},
  journal      = {CoRR},
  volume       = {abs/1912.00271},
  year         = {2019},
  url          = {http://arxiv.org/abs/1912.00271},
  eprinttype    = {arXiv},
  eprint       = {1912.00271},
  timestamp    = {Thu, 06 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1912-00271.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/sp/ZhangZW18,
  author       = {David Zhang and
                  Wangmeng Zuo and
                  Peng Wang},
  title        = {Computational Pulse Signal Analysis},
  publisher    = {Springer},
  year         = {2018},
  url          = {https://doi.org/10.1007/978-981-10-4044-3},
  doi          = {10.1007/978-981-10-4044-3},
  isbn         = {978-981-10-4043-6},
  timestamp    = {Tue, 17 Nov 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/books/sp/ZhangZW18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/sp/ZhangTZ18,
  author       = {Lei Zhang and
                  Fengchun Tian and
                  David Zhang},
  title        = {Electronic Nose: Algorithmic Challenges},
  publisher    = {Springer},
  year         = {2018},
  url          = {https://doi.org/10.1007/978-981-13-2167-2},
  doi          = {10.1007/978-981-13-2167-2},
  isbn         = {978-981-13-2166-5},
  timestamp    = {Wed, 12 Sep 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/books/sp/ZhangTZ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/GouYZZSD18,
  author       = {Jianping Gou and
                  Zhang Yi and
                  David Zhang and
                  Yongzhao Zhan and
                  Xiangjun Shen and
                  Lan Du},
  title        = {Sparsity and Geometry Preserving Graph Embedding for Dimensionality
                  Reduction},
  journal      = {{IEEE} Access},
  volume       = {6},
  pages        = {75748--75766},
  year         = {2018},
  url          = {https://doi.org/10.1109/ACCESS.2018.2884027},
  doi          = {10.1109/ACCESS.2018.2884027},
  timestamp    = {Thu, 23 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/access/GouYZZSD18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/WuZLG18,
  author       = {Kebin Wu and
                  David Zhang and
                  Guangming Lu and
                  Zhenhua Guo},
  title        = {Learning acoustic features to detect Parkinson's disease},
  journal      = {Neurocomputing},
  volume       = {318},
  pages        = {102--108},
  year         = {2018},
  url          = {https://doi.org/10.1016/j.neucom.2018.08.036},
  doi          = {10.1016/J.NEUCOM.2018.08.036},
  timestamp    = {Thu, 17 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijon/WuZLG18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/GouXZMDZ18,
  author       = {Jianping Gou and
                  Yong Xu and
                  David Zhang and
                  Qirong Mao and
                  Lan Du and
                  Yongzhao Zhan},
  title        = {Two-phase linear reconstruction measure-based classification for face
                  recognition},
  journal      = {Inf. Sci.},
  volume       = {433-434},
  pages        = {17--36},
  year         = {2018},
  url          = {https://doi.org/10.1016/j.ins.2017.12.025},
  doi          = {10.1016/J.INS.2017.12.025},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/isci/GouXZMDZ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ZhaoWMWZ0018,
  author       = {Cairong Zhao and
                  Xuekuan Wang and
                  Duoqian Miao and
                  Hanli Wang and
                  Wei{-}Shi Zheng and
                  Yong Xu and
                  David Zhang},
  title        = {Maximal granularity structure and generalized multi-view discriminant
                  analysis for person re-identification},
  journal      = {Pattern Recognit.},
  volume       = {79},
  pages        = {79--96},
  year         = {2018},
  url          = {https://doi.org/10.1016/j.patcog.2018.01.033},
  doi          = {10.1016/J.PATCOG.2018.01.033},
  timestamp    = {Thu, 12 Jan 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/ZhaoWMWZ0018.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/taffco/ChenXZ18,
  author       = {Fangmei Chen and
                  Xihua Xiao and
                  David Zhang},
  title        = {Data-Driven Facial Beauty Analysis: Prediction, Retrieval and Manipulation},
  journal      = {{IEEE} Trans. Affect. Comput.},
  volume       = {9},
  number       = {2},
  pages        = {205--216},
  year         = {2018},
  url          = {https://doi.org/10.1109/TAFFC.2016.2599534},
  doi          = {10.1109/TAFFC.2016.2599534},
  timestamp    = {Fri, 24 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/taffco/ChenXZ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/LuLL0WY18,
  author       = {Yuwu Lu and
                  Zhihui Lai and
                  Xuelong Li and
                  David Zhang and
                  Wai Keung Wong and
                  Chun Yuan},
  title        = {Learning Parts-Based and Global Representation for Image Classification},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {28},
  number       = {12},
  pages        = {3345--3360},
  year         = {2018},
  url          = {https://doi.org/10.1109/TCSVT.2017.2749980},
  doi          = {10.1109/TCSVT.2017.2749980},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcsv/LuLL0WY18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/YanKZ18,
  author       = {Ke Yan and
                  Lu Kou and
                  David Zhang},
  title        = {Learning Domain-Invariant Subspace Using Domain Features and Independence
                  Maximization},
  journal      = {{IEEE} Trans. Cybern.},
  volume       = {48},
  number       = {1},
  pages        = {288--299},
  year         = {2018},
  url          = {https://doi.org/10.1109/TCYB.2016.2633306},
  doi          = {10.1109/TCYB.2016.2633306},
  timestamp    = {Tue, 30 Nov 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcyb/YanKZ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/LaiMWXMZ18,
  author       = {Zhihui Lai and
                  Dongmei Mo and
                  Wai Keung Wong and
                  Yong Xu and
                  Duoqian Miao and
                  David Zhang},
  title        = {Robust Discriminant Regression for Feature Extraction},
  journal      = {{IEEE} Trans. Cybern.},
  volume       = {48},
  number       = {8},
  pages        = {2472--2484},
  year         = {2018},
  url          = {https://doi.org/10.1109/TCYB.2017.2740949},
  doi          = {10.1109/TCYB.2017.2740949},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcyb/LaiMWXMZ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/FeiLJWZ18,
  author       = {Lunke Fei and
                  Guangming Lu and
                  Wei Jia and
                  Jie Wen and
                  David Zhang},
  title        = {Complete Binary Representation for 3-D Palmprint Recognition},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {67},
  number       = {12},
  pages        = {2761--2771},
  year         = {2018},
  url          = {https://doi.org/10.1109/TIM.2018.2830858},
  doi          = {10.1109/TIM.2018.2830858},
  timestamp    = {Sat, 22 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tim/FeiLJWZ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/RenZZXZ18,
  author       = {Dongwei Ren and
                  Wangmeng Zuo and
                  David Zhang and
                  Jun Xu and
                  Lei Zhang},
  title        = {Partial Deconvolution With Inaccurate Blur Kernel},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {27},
  number       = {1},
  pages        = {511--524},
  year         = {2018},
  url          = {https://doi.org/10.1109/TIP.2017.2764261},
  doi          = {10.1109/TIP.2017.2764261},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tip/RenZZXZ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/XuZZ18,
  author       = {Jun Xu and
                  Lei Zhang and
                  David Zhang},
  title        = {External Prior Guided Internal Prior Learning for Real-World Noisy
                  Image Denoising},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {27},
  number       = {6},
  pages        = {2996--3010},
  year         = {2018},
  url          = {https://doi.org/10.1109/TIP.2018.2811546},
  doi          = {10.1109/TIP.2018.2811546},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/XuZZ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/LiZZ18,
  author       = {Jinxing Li and
                  Bob Zhang and
                  David Zhang},
  title        = {Shared Autoencoder Gaussian Process Latent Variable Model for Visual
                  Classification},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {29},
  number       = {9},
  pages        = {4272--4286},
  year         = {2018},
  url          = {https://doi.org/10.1109/TNNLS.2017.2761401},
  doi          = {10.1109/TNNLS.2017.2761401},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tnn/LiZZ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/WuZLJZ18,
  author       = {Xiaohe Wu and
                  Wangmeng Zuo and
                  Liang Lin and
                  Wei Jia and
                  David Zhang},
  title        = {{F-SVM:} Combination of Feature Transformation and {SVM} Learning
                  via Convex Relaxation},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {29},
  number       = {11},
  pages        = {5185--5199},
  year         = {2018},
  url          = {https://doi.org/10.1109/TNNLS.2018.2791507},
  doi          = {10.1109/TNNLS.2018.2791507},
  timestamp    = {Sat, 30 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tnn/WuZLJZ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/XuFWZ18,
  author       = {Yong Xu and
                  Lunke Fei and
                  Jie Wen and
                  David Zhang},
  title        = {Discriminative and Robust Competitive Code for Palmprint Recognition},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Syst.},
  volume       = {48},
  number       = {2},
  pages        = {232--241},
  year         = {2018},
  url          = {https://doi.org/10.1109/TSMC.2016.2597291},
  doi          = {10.1109/TSMC.2016.2597291},
  timestamp    = {Sat, 05 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/XuFWZ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/ZhangZ18,
  author       = {Lei Zhang and
                  David Zhang},
  title        = {Efficient Solutions for Discreteness, Drift, and Disturbance {(3D)}
                  in Electronic Olfaction},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Syst.},
  volume       = {48},
  number       = {2},
  pages        = {242--254},
  year         = {2018},
  url          = {https://doi.org/10.1109/TSMC.2016.2597800},
  doi          = {10.1109/TSMC.2016.2597800},
  timestamp    = {Wed, 20 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/ZhangZ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/LiYZLZZ18,
  author       = {Jinxing Li and
                  Hongwei Yong and
                  Bob Zhang and
                  Mu Li and
                  Lei Zhang and
                  David Zhang},
  editor       = {Sheila A. McIlraith and
                  Kilian Q. Weinberger},
  title        = {A Probabilistic Hierarchical Model for Multi-View and Multi-Feature
                  Classification},
  booktitle    = {Proceedings of the Thirty-Second {AAAI} Conference on Artificial Intelligence,
                  (AAAI-18), the 30th innovative Applications of Artificial Intelligence
                  (IAAI-18), and the 8th {AAAI} Symposium on Educational Advances in
                  Artificial Intelligence (EAAI-18), New Orleans, Louisiana, USA, February
                  2-7, 2018},
  pages        = {3498--3505},
  publisher    = {{AAAI} Press},
  year         = {2018},
  url          = {https://doi.org/10.1609/aaai.v32i1.11611},
  doi          = {10.1609/AAAI.V32I1.11611},
  timestamp    = {Mon, 04 Sep 2023 12:29:24 +0200},
  biburl       = {https://dblp.org/rec/conf/aaai/LiYZLZZ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/LiZGZ018,
  author       = {Mu Li and
                  Wangmeng Zuo and
                  Shuhang Gu and
                  Debin Zhao and
                  David Zhang},
  title        = {Learning Convolutional Networks for Content-Weighted Image Compression},
  booktitle    = {2018 {IEEE} Conference on Computer Vision and Pattern Recognition,
                  {CVPR} 2018, Salt Lake City, UT, USA, June 18-22, 2018},
  pages        = {3214--3223},
  publisher    = {Computer Vision Foundation / {IEEE} Computer Society},
  year         = {2018},
  url          = {http://openaccess.thecvf.com/content\_cvpr\_2018/html/Li\_Learning\_Convolutional\_Networks\_CVPR\_2018\_paper.html},
  doi          = {10.1109/CVPR.2018.00339},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/LiZGZ018.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/Liang0ZC018,
  author       = {Zhetong Liang and
                  Jun Xu and
                  David Zhang and
                  Zisheng Cao and
                  Lei Zhang},
  title        = {A Hybrid l1-l0 Layer Decomposition Model for Tone Mapping},
  booktitle    = {2018 {IEEE} Conference on Computer Vision and Pattern Recognition,
                  {CVPR} 2018, Salt Lake City, UT, USA, June 18-22, 2018},
  pages        = {4758--4766},
  publisher    = {Computer Vision Foundation / {IEEE} Computer Society},
  year         = {2018},
  url          = {http://openaccess.thecvf.com/content\_cvpr\_2018/html/Liang\_A\_Hybrid\_l1-l0\_CVPR\_2018\_paper.html},
  doi          = {10.1109/CVPR.2018.00500},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/Liang0ZC018.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/XuZZ18,
  author       = {Jun Xu and
                  Lei Zhang and
                  David Zhang},
  editor       = {Vittorio Ferrari and
                  Martial Hebert and
                  Cristian Sminchisescu and
                  Yair Weiss},
  title        = {A Trilateral Weighted Sparse Coding Scheme for Real-World Image Denoising},
  booktitle    = {Computer Vision - {ECCV} 2018 - 15th European Conference, Munich,
                  Germany, September 8-14, 2018, Proceedings, Part {VIII}},
  series       = {Lecture Notes in Computer Science},
  volume       = {11212},
  pages        = {21--38},
  publisher    = {Springer},
  year         = {2018},
  url          = {https://doi.org/10.1007/978-3-030-01237-3\_2},
  doi          = {10.1007/978-3-030-01237-3\_2},
  timestamp    = {Mon, 30 Sep 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/eccv/XuZZ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscide/YaoWZZ18,
  author       = {Yingjie Yao and
                  Xiaohe Wu and
                  Wangmeng Zuo and
                  David Zhang},
  editor       = {Yuxin Peng and
                  Kai Yu and
                  Jiwen Lu and
                  Xingpeng Jiang},
  title        = {Learning Siamese Network with Top-Down Modulation for Visual Tracking},
  booktitle    = {Intelligence Science and Big Data Engineering - 8th International
                  Conference, IScIDE 2018, Lanzhou, China, August 18-19, 2018, Revised
                  Selected Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {11266},
  pages        = {378--388},
  publisher    = {Springer},
  year         = {2018},
  url          = {https://doi.org/10.1007/978-3-030-02698-1\_33},
  doi          = {10.1007/978-3-030-02698-1\_33},
  timestamp    = {Thu, 17 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iscide/YaoWZZ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/LiZLZ18,
  author       = {Jinxing Li and
                  Bob Zhang and
                  Guangming Lu and
                  David Zhang},
  editor       = {Susanne Boll and
                  Kyoung Mu Lee and
                  Jiebo Luo and
                  Wenwu Zhu and
                  Hyeran Byun and
                  Chang Wen Chen and
                  Rainer Lienhart and
                  Tao Mei},
  title        = {Shared Linear Encoder-based Gaussian Process Latent Variable Model
                  for Visual Classification},
  booktitle    = {2018 {ACM} Multimedia Conference on Multimedia Conference, {MM} 2018,
                  Seoul, Republic of Korea, October 22-26, 2018},
  pages        = {26--34},
  publisher    = {{ACM}},
  year         = {2018},
  url          = {https://doi.org/10.1145/3240508.3240520},
  doi          = {10.1145/3240508.3240520},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/mm/LiZLZ18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1801-04662,
  author       = {Mu Li and
                  Shuhang Gu and
                  David Zhang and
                  Wangmeng Zuo},
  title        = {Efficient Trimmed Convolutional Arithmetic Encoding for Lossless Image
                  Compression},
  journal      = {CoRR},
  volume       = {abs/1801.04662},
  year         = {2018},
  url          = {http://arxiv.org/abs/1801.04662},
  eprinttype    = {arXiv},
  eprint       = {1801.04662},
  timestamp    = {Tue, 22 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1801-04662.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1801-08360,
  author       = {Jinxing Li and
                  Bob Zhang and
                  Guangming Lu and
                  David Zhang},
  title        = {Dual Asymmetric Deep Hashing Learning},
  journal      = {CoRR},
  volume       = {abs/1801.08360},
  year         = {2018},
  url          = {http://arxiv.org/abs/1801.08360},
  eprinttype    = {arXiv},
  eprint       = {1801.08360},
  timestamp    = {Mon, 14 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1801-08360.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1804-02603,
  author       = {Jun Xu and
                  Hui Li and
                  Zhetong Liang and
                  David Zhang and
                  Lei Zhang},
  title        = {Real-world Noisy Image Denoising: {A} New Benchmark},
  journal      = {CoRR},
  volume       = {abs/1804.02603},
  year         = {2018},
  url          = {http://arxiv.org/abs/1804.02603},
  eprinttype    = {arXiv},
  eprint       = {1804.02603},
  timestamp    = {Thu, 17 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1804-02603.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1804-04522,
  author       = {Dongwei Ren and
                  Wangmeng Zuo and
                  David Zhang and
                  Lei Zhang and
                  Ming{-}Hsuan Yang},
  title        = {Simultaneous Fidelity and Regularization Learning for Image Restoration},
  journal      = {CoRR},
  volume       = {abs/1804.04522},
  year         = {2018},
  url          = {http://arxiv.org/abs/1804.04522},
  eprinttype    = {arXiv},
  eprint       = {1804.04522},
  timestamp    = {Thu, 04 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1804-04522.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1806-04329,
  author       = {Jun Xu and
                  Wangpeng An and
                  Lei Zhang and
                  David Zhang},
  title        = {Sparse, Collaborative, or Nonnegative Representation: Which Helps
                  Pattern Classification?},
  journal      = {CoRR},
  volume       = {abs/1806.04329},
  year         = {2018},
  url          = {http://arxiv.org/abs/1806.04329},
  eprinttype    = {arXiv},
  eprint       = {1806.04329},
  timestamp    = {Tue, 19 Feb 2019 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1806-04329.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1807-04364,
  author       = {Jun Xu and
                  Lei Zhang and
                  David Zhang},
  title        = {A Trilateral Weighted Sparse Coding Scheme for Real-World Image Denoising},
  journal      = {CoRR},
  volume       = {abs/1807.04364},
  year         = {2018},
  url          = {http://arxiv.org/abs/1807.04364},
  eprinttype    = {arXiv},
  eprint       = {1807.04364},
  timestamp    = {Tue, 19 Feb 2019 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1807-04364.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/sp/ZhangGYZGY17,
  author       = {David Zhang and
                  Dongmin Guo and
                  Ke Yan},
  title        = {Breath Analysis for Medical Applications},
  publisher    = {Springer},
  year         = {2017},
  url          = {https://doi.org/10.1007/978-981-10-4322-2},
  doi          = {10.1007/978-981-10-4322-2},
  isbn         = {978-981-10-4321-5},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/books/sp/ZhangGYZGY17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/sp/ZhangZZ17,
  author       = {David Zhang and
                  Hongzhi Zhang and
                  Bob Zhang},
  title        = {Tongue Image Analysis},
  publisher    = {Springer},
  year         = {2017},
  url          = {https://doi.org/10.1007/978-981-10-2167-1},
  doi          = {10.1007/978-981-10-2167-1},
  isbn         = {978-981-10-2166-4},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/books/sp/ZhangZZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/XuLYZ17,
  author       = {Yong Xu and
                  Zhengming Li and
                  Jian Yang and
                  David Zhang},
  title        = {A Survey of Dictionary Learning Algorithms for Face Recognition},
  journal      = {{IEEE} Access},
  volume       = {5},
  pages        = {8502--8514},
  year         = {2017},
  url          = {https://doi.org/10.1109/ACCESS.2017.2695239},
  doi          = {10.1109/ACCESS.2017.2695239},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/access/XuLYZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dsp/WuZL17,
  author       = {Kebin Wu and
                  David Zhang and
                  Guangming Lu},
  title        = {{GMAT:} Glottal closure instants detection based on the Multiresolution
                  Absolute Teager-Kaiser energy operator},
  journal      = {Digit. Signal Process.},
  volume       = {69},
  pages        = {286--299},
  year         = {2017},
  url          = {https://doi.org/10.1016/j.dsp.2017.07.006},
  doi          = {10.1016/J.DSP.2017.07.006},
  timestamp    = {Thu, 20 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/dsp/WuZL17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/ZhangZSC17,
  author       = {Lei Zhang and
                  David Zhang and
                  Ming{-}ming Sun and
                  Fangmei Chen},
  title        = {Facial beauty analysis based on geometric feature: Toward attractiveness
                  assessment application},
  journal      = {Expert Syst. Appl.},
  volume       = {82},
  pages        = {252--265},
  year         = {2017},
  url          = {https://doi.org/10.1016/j.eswa.2017.04.021},
  doi          = {10.1016/J.ESWA.2017.04.021},
  timestamp    = {Fri, 30 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/eswa/ZhangZSC17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/LiZZ17,
  author       = {Jinxing Li and
                  Bob Zhang and
                  David Zhang},
  title        = {Joint discriminative and collaborative representation for fatty liver
                  disease diagnosis},
  journal      = {Expert Syst. Appl.},
  volume       = {89},
  pages        = {31--40},
  year         = {2017},
  url          = {https://doi.org/10.1016/j.eswa.2017.07.023},
  doi          = {10.1016/J.ESWA.2017.07.023},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/eswa/LiZZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/LiZLWZ17,
  author       = {Jinxing Li and
                  David Zhang and
                  Yongcheng Li and
                  Jian Wu and
                  Bob Zhang},
  title        = {Joint similar and specific learning for diabetes mellitus and impaired
                  glucose regulation detection},
  journal      = {Inf. Sci.},
  volume       = {384},
  pages        = {191--204},
  year         = {2017},
  url          = {https://doi.org/10.1016/j.ins.2016.09.031},
  doi          = {10.1016/J.INS.2016.09.031},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/isci/LiZLWZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/LiWZLZ17,
  author       = {Mu Li and
                  Qilong Wang and
                  David Zhang and
                  Peihua Li and
                  Wangmeng Zuo},
  title        = {Joint distance and similarity measure learning based on triplet-based
                  constraints},
  journal      = {Inf. Sci.},
  volume       = {406},
  pages        = {119--132},
  year         = {2017},
  url          = {https://doi.org/10.1016/j.ins.2017.04.027},
  doi          = {10.1016/J.INS.2017.04.027},
  timestamp    = {Tue, 22 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/isci/LiWZLZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/ZhangYZ17,
  author       = {Lei Zhang and
                  Jian Yang and
                  David Zhang},
  title        = {Domain class consistency based transfer learning for image classification
                  across domains},
  journal      = {Inf. Sci.},
  volume       = {418},
  pages        = {242--257},
  year         = {2017},
  url          = {https://doi.org/10.1016/j.ins.2017.08.034},
  doi          = {10.1016/J.INS.2017.08.034},
  timestamp    = {Mon, 22 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/isci/ZhangYZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ZhangHZZ17,
  author       = {Kunai Zhang and
                  Da Huang and
                  Bob Zhang and
                  David Zhang},
  title        = {Improving texture analysis performance in biometrics by adjusting
                  image sharpness},
  journal      = {Pattern Recognit.},
  volume       = {66},
  pages        = {16--25},
  year         = {2017},
  url          = {https://doi.org/10.1016/j.patcog.2016.11.025},
  doi          = {10.1016/J.PATCOG.2016.11.025},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/ZhangHZZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/ZhangHZ17,
  author       = {Kunai Zhang and
                  Da Huang and
                  David Zhang},
  title        = {An optimized palmprint recognition approach based on image sharpness},
  journal      = {Pattern Recognit. Lett.},
  volume       = {85},
  pages        = {65--71},
  year         = {2017},
  url          = {https://doi.org/10.1016/j.patrec.2016.11.014},
  doi          = {10.1016/J.PATREC.2016.11.014},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/prl/ZhangHZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/BaiGZZ17,
  author       = {Xuefei Bai and
                  Nan Gao and
                  Zonghua Zhang and
                  David Zhang},
  title        = {3D palmprint identification combining blocked {ST} and {PCA}},
  journal      = {Pattern Recognit. Lett.},
  volume       = {100},
  pages        = {89--95},
  year         = {2017},
  url          = {https://doi.org/10.1016/j.patrec.2017.10.008},
  doi          = {10.1016/J.PATREC.2017.10.008},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/prl/BaiGZZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/KouZL17,
  author       = {Lu Kou and
                  David Zhang and
                  Dongxu Liu},
  title        = {A Novel Medical E-Nose Signal Analysis System},
  journal      = {Sensors},
  volume       = {17},
  number       = {4},
  pages        = {402},
  year         = {2017},
  url          = {https://doi.org/10.3390/s17040402},
  doi          = {10.3390/S17040402},
  timestamp    = {Fri, 30 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/sensors/KouZL17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/LuLXLZY17,
  author       = {Yuwu Lu and
                  Zhihui Lai and
                  Yong Xu and
                  Xuelong Li and
                  David Zhang and
                  Chun Yuan},
  title        = {Nonnegative Discriminant Matrix Factorization},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {27},
  number       = {7},
  pages        = {1392--1405},
  year         = {2017},
  url          = {https://doi.org/10.1109/TCSVT.2016.2539779},
  doi          = {10.1109/TCSVT.2016.2539779},
  timestamp    = {Mon, 14 Feb 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcsv/LuLXLZY17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/LaiXYSZ17,
  author       = {Zhihui Lai and
                  Yong Xu and
                  Jian Yang and
                  Linlin Shen and
                  David Zhang},
  title        = {Rotational Invariant Dimensionality Reduction Algorithms},
  journal      = {{IEEE} Trans. Cybern.},
  volume       = {47},
  number       = {11},
  pages        = {3733--3746},
  year         = {2017},
  url          = {https://doi.org/10.1109/TCYB.2016.2578642},
  doi          = {10.1109/TCYB.2016.2578642},
  timestamp    = {Fri, 22 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcyb/LaiXYSZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/ZhangZ17,
  author       = {Lei Zhang and
                  David Zhang},
  title        = {Evolutionary Cost-Sensitive Discriminative Learning With Application
                  to Vision and Olfaction},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {66},
  number       = {2},
  pages        = {198--211},
  year         = {2017},
  url          = {https://doi.org/10.1109/TIM.2016.2631878},
  doi          = {10.1109/TIM.2016.2631878},
  timestamp    = {Mon, 08 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tim/ZhangZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/YanZX17,
  author       = {Ke Yan and
                  David Zhang and
                  Yong Xu},
  title        = {Correcting Instrumental Variation and Time-Varying Drift Using Parallel
                  and Serial Multitask Learning},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {66},
  number       = {9},
  pages        = {2306--2316},
  year         = {2017},
  url          = {https://doi.org/10.1109/TIM.2017.2707898},
  doi          = {10.1109/TIM.2017.2707898},
  timestamp    = {Mon, 08 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tim/YanZX17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/ZuoWZLHMZ17,
  author       = {Wangmeng Zuo and
                  Faqiang Wang and
                  David Zhang and
                  Liang Lin and
                  Yuchi Huang and
                  Deyu Meng and
                  Lei Zhang},
  title        = {Distance Metric Learning via Iterated Support Vector Machines},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {26},
  number       = {10},
  pages        = {4937--4950},
  year         = {2017},
  url          = {https://doi.org/10.1109/TIP.2017.2725578},
  doi          = {10.1109/TIP.2017.2725578},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/ZuoWZLHMZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/WangZL17,
  author       = {Dimin Wang and
                  David Zhang and
                  Guangming Lu},
  title        = {Generalized Feature Extraction for Wrist Pulse Analysis: From 1-D
                  Time Series to 2-D Matrix},
  journal      = {{IEEE} J. Biomed. Health Informatics},
  volume       = {21},
  number       = {4},
  pages        = {978--985},
  year         = {2017},
  url          = {https://doi.org/10.1109/JBHI.2016.2628238},
  doi          = {10.1109/JBHI.2016.2628238},
  timestamp    = {Fri, 13 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/titb/WangZL17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmm/LuYLLWZ17,
  author       = {Yuwu Lu and
                  Chun Yuan and
                  Zhihui Lai and
                  Xuelong Li and
                  Wai Keung Wong and
                  David Zhang},
  title        = {Nuclear Norm-Based 2DLPP for Image Classification},
  journal      = {{IEEE} Trans. Multim.},
  volume       = {19},
  number       = {11},
  pages        = {2391--2403},
  year         = {2017},
  url          = {https://doi.org/10.1109/TMM.2017.2703130},
  doi          = {10.1109/TMM.2017.2703130},
  timestamp    = {Mon, 14 Feb 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tmm/LuYLLWZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/LiLXYZ17,
  author       = {Zhengming Li and
                  Zhihui Lai and
                  Yong Xu and
                  Jian Yang and
                  David Zhang},
  title        = {A Locality-Constrained and Label Embedding Dictionary Learning Algorithm
                  for Image Classification},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {28},
  number       = {2},
  pages        = {278--293},
  year         = {2017},
  url          = {https://doi.org/10.1109/TNNLS.2015.2508025},
  doi          = {10.1109/TNNLS.2015.2508025},
  timestamp    = {Mon, 09 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tnn/LiLXYZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/XuZYYZ17,
  author       = {Yong Xu and
                  Zuofeng Zhong and
                  Jian Yang and
                  Jane You and
                  David Zhang},
  title        = {A New Discriminative Sparse Representation Method for Robust Face
                  Recognition via l\({}_{\mbox{2}}\) Regularization},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {28},
  number       = {10},
  pages        = {2233--2242},
  year         = {2017},
  url          = {https://doi.org/10.1109/TNNLS.2016.2580572},
  doi          = {10.1109/TNNLS.2016.2580572},
  timestamp    = {Mon, 09 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tnn/XuZYYZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/ZhangZ17,
  author       = {Lei Zhang and
                  David Zhang},
  title        = {Evolutionary Cost-Sensitive Extreme Learning Machine},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {28},
  number       = {12},
  pages        = {3045--3060},
  year         = {2017},
  url          = {https://doi.org/10.1109/TNNLS.2016.2607757},
  doi          = {10.1109/TNNLS.2016.2607757},
  timestamp    = {Mon, 09 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tnn/ZhangZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/QuZLG17,
  author       = {Xiaofeng Qu and
                  David Zhang and
                  Guangming Lu and
                  Zhenhua Guo},
  title        = {Door Knob Hand Recognition System},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Syst.},
  volume       = {47},
  number       = {11},
  pages        = {2870--2881},
  year         = {2017},
  url          = {https://doi.org/10.1109/TSMC.2016.2531675},
  doi          = {10.1109/TSMC.2016.2531675},
  timestamp    = {Wed, 20 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/QuZLG17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccbr/Chen0WD17,
  author       = {Fangmei Chen and
                  David Zhang and
                  Cunrui Wang and
                  Xiaodong Duan},
  editor       = {Jie Zhou and
                  Yunhong Wang and
                  Zhenan Sun and
                  Yong Xu and
                  Linlin Shen and
                  Jianjiang Feng and
                  Shiguang Shan and
                  Yu Qiao and
                  Zhenhua Guo and
                  Shiqi Yu},
  title        = {Comparison and Fusion of Multiple Types of Features for Image-Based
                  Facial Beauty Prediction},
  booktitle    = {Biometric Recognition - 12th Chinese Conference, {CCBR} 2017, Shenzhen,
                  China, October 28-29, 2017, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {10568},
  pages        = {23--30},
  publisher    = {Springer},
  year         = {2017},
  url          = {https://doi.org/10.1007/978-3-319-69923-3\_3},
  doi          = {10.1007/978-3-319-69923-3\_3},
  timestamp    = {Tue, 04 Oct 2022 18:09:04 +0200},
  biburl       = {https://dblp.org/rec/conf/ccbr/Chen0WD17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/XuZ0F17,
  author       = {Jun Xu and
                  Lei Zhang and
                  David Zhang and
                  Xiangchu Feng},
  title        = {Multi-channel Weighted Nuclear Norm Minimization for Real Color Image
                  Denoising},
  booktitle    = {{IEEE} International Conference on Computer Vision, {ICCV} 2017, Venice,
                  Italy, October 22-29, 2017},
  pages        = {1105--1113},
  publisher    = {{IEEE} Computer Society},
  year         = {2017},
  url          = {https://doi.org/10.1109/ICCV.2017.125},
  doi          = {10.1109/ICCV.2017.125},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iccv/XuZ0F17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccvw/KristanLMFPZVHL17,
  author       = {Matej Kristan and
                  Ales Leonardis and
                  Jiri Matas and
                  Michael Felsberg and
                  Roman P. Pflugfelder and
                  Luka Cehovin Zajc and
                  Tomas Vojir and
                  Gustav H{\"{a}}ger and
                  Alan Lukezic and
                  Abdelrahman Eldesokey and
                  Gustavo Fern{\'{a}}ndez and
                  {\'{A}}lvaro Garc{\'{\i}}a{-}Mart{\'{\i}}n and
                  Andrej Muhic and
                  Alfredo Petrosino and
                  Alireza Memarmoghadam and
                  Andrea Vedaldi and
                  Antoine Manzanera and
                  Antoine Tran and
                  A. Aydin Alatan and
                  Bogdan Mocanu and
                  Boyu Chen and
                  Chang Huang and
                  Changsheng Xu and
                  Chong Sun and
                  Dalong Du and
                  David Zhang and
                  Dawei Du and
                  Deepak Mishra and
                  Erhan Gundogdu and
                  Erik Velasco{-}Salido and
                  Fahad Shahbaz Khan and
                  Francesco Battistone and
                  Gorthi R. K. Sai Subrahmanyam and
                  Goutam Bhat and
                  Guan Huang and
                  Guilherme Sousa Bastos and
                  Guna Seetharaman and
                  Hongliang Zhang and
                  Houqiang Li and
                  Huchuan Lu and
                  Isabela Drummond and
                  Jack Valmadre and
                  Jae{-}chan Jeong and
                  Jaeil Cho and
                  Jae{-}Yeong Lee and
                  Jana Noskova and
                  Jianke Zhu and
                  Jin Gao and
                  Jingyu Liu and
                  Ji{-}Wan Kim and
                  Jo{\~{a}}o F. Henriques and
                  Jos{\'{e}} M. Mart{\'{\i}}nez and
                  Junfei Zhuang and
                  Junliang Xing and
                  Junyu Gao and
                  Kai Chen and
                  Kannappan Palaniappan and
                  Karel Lebeda and
                  Ke Gao and
                  Kris M. Kitani and
                  Lei Zhang and
                  Lijun Wang and
                  Lingxiao Yang and
                  Longyin Wen and
                  Luca Bertinetto and
                  Mahdieh Poostchi and
                  Martin Danelljan and
                  Matthias Mueller and
                  Mengdan Zhang and
                  Ming{-}Hsuan Yang and
                  Nianhao Xie and
                  Ning Wang and
                  Ondrej Miksik and
                  Payman Moallem and
                  Pallavi M. Venugopal and
                  Pedro Senna and
                  Philip H. S. Torr and
                  Qiang Wang and
                  Qifeng Yu and
                  Qingming Huang and
                  Rafael Martin Nieto and
                  Richard Bowden and
                  Risheng Liu and
                  Ruxandra Tapu and
                  Simon Hadfield and
                  Siwei Lyu and
                  Stuart Golodetz and
                  Sunglok Choi and
                  Tianzhu Zhang and
                  Titus B. Zaharia and
                  Vincenzo Santopietro and
                  Wei Zou and
                  Weiming Hu and
                  Wenbing Tao and
                  Wenbo Li and
                  Wengang Zhou and
                  Xianguo Yu and
                  Xiao Bian and
                  Yang Li and
                  Yifan Xing and
                  Yingruo Fan and
                  Zheng Zhu and
                  Zhipeng Zhang and
                  Zhiqun He},
  title        = {The Visual Object Tracking {VOT2017} Challenge Results},
  booktitle    = {2017 {IEEE} International Conference on Computer Vision Workshops,
                  {ICCV} Workshops 2017, Venice, Italy, October 22-29, 2017},
  pages        = {1949--1972},
  publisher    = {{IEEE} Computer Society},
  year         = {2017},
  url          = {https://doi.org/10.1109/ICCVW.2017.230},
  doi          = {10.1109/ICCVW.2017.230},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iccvw/KristanLMFPZVHL17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccvw/LiYLZZY17,
  author       = {Feng Li and
                  Yingjie Yao and
                  Peihua Li and
                  David Zhang and
                  Wangmeng Zuo and
                  Ming{-}Hsuan Yang},
  title        = {Integrating Boundary and Center Correlation Filters for Visual Tracking
                  with Aspect Ratio Variation},
  booktitle    = {2017 {IEEE} International Conference on Computer Vision Workshops,
                  {ICCV} Workshops 2017, Venice, Italy, October 22-29, 2017},
  pages        = {2001--2009},
  publisher    = {{IEEE} Computer Society},
  year         = {2017},
  url          = {https://doi.org/10.1109/ICCVW.2017.234},
  doi          = {10.1109/ICCVW.2017.234},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iccvw/LiYLZZY17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/YangXLZZ17,
  author       = {Lingxiao Yang and
                  Xiaohua Xie and
                  Peihua Li and
                  David Zhang and
                  Lei Zhang},
  title        = {Part-based convolutional neural network for visual recognition},
  booktitle    = {2017 {IEEE} International Conference on Image Processing, {ICIP} 2017,
                  Beijing, China, September 17-20, 2017},
  pages        = {1772--1776},
  publisher    = {{IEEE}},
  year         = {2017},
  url          = {https://doi.org/10.1109/ICIP.2017.8296586},
  doi          = {10.1109/ICIP.2017.8296586},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/icip/YangXLZZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmcs/ZhuYZZ17,
  author       = {Linnan Zhu and
                  Lingxiao Yang and
                  David Zhang and
                  Lei Zhang},
  title        = {Learning a real-time generic tracker using convolutional neural networks},
  booktitle    = {2017 {IEEE} International Conference on Multimedia and Expo, {ICME}
                  2017, Hong Kong, China, July 10-14, 2017},
  pages        = {1219--1224},
  publisher    = {{IEEE} Computer Society},
  year         = {2017},
  url          = {https://doi.org/10.1109/ICME.2017.8019381},
  doi          = {10.1109/ICME.2017.8019381},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icmcs/ZhuYZZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mm/YangL0Z17,
  author       = {Lingxiao Yang and
                  Risheng Liu and
                  David Zhang and
                  Lei Zhang},
  editor       = {Qiong Liu and
                  Rainer Lienhart and
                  Haohong Wang and
                  Sheng{-}Wei "Kuan{-}Ta" Chen and
                  Susanne Boll and
                  Yi{-}Ping Phoebe Chen and
                  Gerald Friedland and
                  Jia Li and
                  Shuicheng Yan},
  title        = {Deep Location-Specific Tracking},
  booktitle    = {Proceedings of the 2017 {ACM} on Multimedia Conference, {MM} 2017,
                  Mountain View, CA, USA, October 23-27, 2017},
  pages        = {1309--1317},
  publisher    = {{ACM}},
  year         = {2017},
  url          = {https://doi.org/10.1145/3123266.3123381},
  doi          = {10.1145/3123266.3123381},
  timestamp    = {Tue, 19 Feb 2019 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/mm/YangL0Z17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/psivt/WuCZZ17,
  author       = {Guangbin Wu and
                  Weishan Chen and
                  Wangmeng Zuo and
                  David Zhang},
  editor       = {Manoranjan Paul and
                  Carlos Hitoshi Morimoto and
                  Qingming Huang},
  title        = {Unsupervised Domain Adaptation with Robust Deep Logistic Regression},
  booktitle    = {Image and Video Technology - 8th Pacific-Rim Symposium, {PSIVT} 2017,
                  Wuhan, China, November 20-24, 2017, Revised Selected Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {10749},
  pages        = {199--211},
  publisher    = {Springer},
  year         = {2017},
  url          = {https://doi.org/10.1007/978-3-319-75786-5\_17},
  doi          = {10.1007/978-3-319-75786-5\_17},
  timestamp    = {Thu, 17 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/psivt/WuCZZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icbea/2017,
  editor       = {David Zhang and
                  Gautam Sethi and
                  Raymond N. J. Veldhuis and
                  Yasushi Yagi and
                  Andrew Beng Jin Teoh},
  title        = {Proceedings of the 2017 International Conference on Biometrics Engineering
                  and Application, {ICBEA} 2017, Hong Kong, Hong Kong, April 21-23,
                  2017},
  publisher    = {{ACM}},
  year         = {2017},
  url          = {https://doi.org/10.1145/3077829},
  doi          = {10.1145/3077829},
  isbn         = {978-1-4503-4871-3},
  timestamp    = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icbea/2017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/premi/2017,
  editor       = {B. Uma Shankar and
                  Kuntal Ghosh and
                  Deba Prasad Mandal and
                  Shubhra Sankar Ray and
                  David Zhang and
                  Sankar K. Pal},
  title        = {Pattern Recognition and Machine Intelligence - 7th International Conference,
                  PReMI 2017, Kolkata, India, December 5-8, 2017, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {10597},
  publisher    = {Springer},
  year         = {2017},
  url          = {https://doi.org/10.1007/978-3-319-69900-4},
  doi          = {10.1007/978-3-319-69900-4},
  isbn         = {978-3-319-69899-1},
  timestamp    = {Tue, 14 May 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/premi/2017.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/LiZGZZ17,
  author       = {Mu Li and
                  Wangmeng Zuo and
                  Shuhang Gu and
                  Debin Zhao and
                  David Zhang},
  title        = {Learning Convolutional Networks for Content-weighted Image Compression},
  journal      = {CoRR},
  volume       = {abs/1703.10553},
  year         = {2017},
  url          = {http://arxiv.org/abs/1703.10553},
  eprinttype    = {arXiv},
  eprint       = {1703.10553},
  timestamp    = {Tue, 22 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/LiZGZZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/XuZZ17,
  author       = {Jun Xu and
                  Lei Zhang and
                  David Zhang},
  title        = {External Prior Guided Internal Prior Learning for Real Noisy Image
                  Denoising},
  journal      = {CoRR},
  volume       = {abs/1705.04505},
  year         = {2017},
  url          = {http://arxiv.org/abs/1705.04505},
  eprinttype    = {arXiv},
  eprint       = {1705.04505},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/XuZZ17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/XuZZF17,
  author       = {Jun Xu and
                  Lei Zhang and
                  David Zhang and
                  Xiangchu Feng},
  title        = {Multi-channel Weighted Nuclear Norm Minimization for Real Color Image
                  Denoising},
  journal      = {CoRR},
  volume       = {abs/1705.09912},
  year         = {2017},
  url          = {http://arxiv.org/abs/1705.09912},
  eprinttype    = {arXiv},
  eprint       = {1705.09912},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/XuZZF17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1710-02039,
  author       = {Feng Li and
                  Yingjie Yao and
                  Peihua Li and
                  David Zhang and
                  Wangmeng Zuo and
                  Ming{-}Hsuan Yang},
  title        = {Integrating Boundary and Center Correlation Filters for Visual Tracking
                  with Aspect Ratio Variation},
  journal      = {CoRR},
  volume       = {abs/1710.02039},
  year         = {2017},
  url          = {http://arxiv.org/abs/1710.02039},
  eprinttype    = {arXiv},
  eprint       = {1710.02039},
  timestamp    = {Thu, 26 Nov 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1710-02039.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/sp/ZhangXZ16,
  author       = {David Zhang and
                  Yong Xu and
                  Wangmeng Zuo},
  title        = {Discriminative Learning in Biometrics},
  publisher    = {Springer},
  year         = {2016},
  url          = {https://doi.org/10.1007/978-981-10-2056-8},
  doi          = {10.1007/978-981-10-2056-8},
  isbn         = {978-981-10-2055-1},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/books/sp/ZhangXZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@book{DBLP:books/sp/ZhangCX16,
  author       = {David Zhang and
                  Fangmei Chen and
                  Yong Xu},
  title        = {Computer Models for Facial Beauty Analysis},
  publisher    = {Springer},
  year         = {2016},
  url          = {https://doi.org/10.1007/978-3-319-32598-9},
  doi          = {10.1007/978-3-319-32598-9},
  isbn         = {978-3-319-32596-5},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/books/sp/ZhangCX16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/bspc/WangZL16,
  author       = {Dimin Wang and
                  David Zhang and
                  Guangming Lu},
  title        = {A robust signal preprocessing framework for wrist pulse analysis},
  journal      = {Biomed. Signal Process. Control.},
  volume       = {23},
  pages        = {62--75},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.bspc.2015.08.002},
  doi          = {10.1016/J.BSPC.2015.08.002},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/bspc/WangZL16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejasp/DengRZZZW16,
  author       = {Hong Deng and
                  Dongwei Ren and
                  David Zhang and
                  Wangmeng Zuo and
                  Hongzhi Zhang and
                  Kuanquan Wang},
  title        = {Efficient non-uniform deblurring based on generalized additive convolution
                  model},
  journal      = {{EURASIP} J. Adv. Signal Process.},
  volume       = {2016},
  pages        = {22},
  year         = {2016},
  url          = {https://doi.org/10.1186/s13634-016-0318-2},
  doi          = {10.1186/S13634-016-0318-2},
  timestamp    = {Thu, 12 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ejasp/DengRZZZW16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/WuZL16,
  author       = {Kebin Wu and
                  David Zhang and
                  Guangming Lu},
  title        = {iPEEH: Improving pitch estimation by enhancing harmonics},
  journal      = {Expert Syst. Appl.},
  volume       = {64},
  pages        = {317--329},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.eswa.2016.08.018},
  doi          = {10.1016/J.ESWA.2016.08.018},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/eswa/WuZL16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/ChenZ16a,
  author       = {Fangmei Chen and
                  David Zhang},
  title        = {Combining a causal effect criterion for evaluation of facial attractiveness
                  models},
  journal      = {Neurocomputing},
  volume       = {177},
  pages        = {98--109},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.neucom.2015.11.010},
  doi          = {10.1016/J.NEUCOM.2015.11.010},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/ChenZ16a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/HuangZWZ16,
  author       = {Di Huang and
                  Xiangrong Zhu and
                  Yunhong Wang and
                  David Zhang},
  title        = {Dorsal hand vein recognition via hierarchical combination of texture
                  and shape clues},
  journal      = {Neurocomputing},
  volume       = {214},
  pages        = {815--828},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.neucom.2016.06.057},
  doi          = {10.1016/J.NEUCOM.2016.06.057},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/HuangZWZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/inffus/ZhangZ16,
  author       = {Lei Zhang and
                  David Zhang},
  title        = {MetricFusion: Generalized metric swarm learning for similarity measure},
  journal      = {Inf. Fusion},
  volume       = {30},
  pages        = {80--90},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.inffus.2015.12.004},
  doi          = {10.1016/J.INFFUS.2015.12.004},
  timestamp    = {Thu, 20 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/inffus/ZhangZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/FeiXTZ16,
  author       = {Lunke Fei and
                  Yong Xu and
                  Wenliang Tang and
                  David Zhang},
  title        = {Double-orientation code and nonlinear matching scheme for palmprint
                  recognition},
  journal      = {Pattern Recognit.},
  volume       = {49},
  pages        = {89--101},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.patcog.2015.08.001},
  doi          = {10.1016/J.PATCOG.2015.08.001},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/FeiXTZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/LiLZX16,
  author       = {Zuoyong Li and
                  Guanghai Liu and
                  David Zhang and
                  Yong Xu},
  title        = {Robust single-object image segmentation based on salient transition
                  region},
  journal      = {Pattern Recognit.},
  volume       = {52},
  pages        = {317--331},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.patcog.2015.10.009},
  doi          = {10.1016/J.PATCOG.2015.10.009},
  timestamp    = {Tue, 29 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/LiLZX16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/YanWCCZ16,
  author       = {Yan Yan and
                  Hanzi Wang and
                  Si Chen and
                  Xiaochun Cao and
                  David Zhang},
  title        = {Quadratic projection based feature extraction with its application
                  to biometric recognition},
  journal      = {Pattern Recognit.},
  volume       = {56},
  pages        = {40--49},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.patcog.2016.02.010},
  doi          = {10.1016/J.PATCOG.2016.02.010},
  timestamp    = {Tue, 15 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/YanWCCZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/FanXNFZ16,
  author       = {Zizhu Fan and
                  Yong Xu and
                  Ming Ni and
                  Xiaozhao Fang and
                  David Zhang},
  title        = {Individualized learning for improving kernel Fisher discriminant analysis},
  journal      = {Pattern Recognit.},
  volume       = {58},
  pages        = {100--109},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.patcog.2016.03.029},
  doi          = {10.1016/J.PATCOG.2016.03.029},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/FanXNFZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/LinCZZY16,
  author       = {Liang Lin and
                  Jason J. Corso and
                  Wangmeng Zuo and
                  David Zhang and
                  Benjamin Z. Yao},
  title        = {Compositional models and Structured learning for visual recognition},
  journal      = {Pattern Recognit.},
  volume       = {59},
  pages        = {1--4},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.patcog.2016.07.030},
  doi          = {10.1016/J.PATCOG.2016.07.030},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/LinCZZY16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/FeiXZ16,
  author       = {Lunke Fei and
                  Yong Xu and
                  David Zhang},
  title        = {Half-orientation extraction of palmprint features},
  journal      = {Pattern Recognit. Lett.},
  volume       = {69},
  pages        = {35--41},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.patrec.2015.10.003},
  doi          = {10.1016/J.PATREC.2015.10.003},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/prl/FeiXZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/ZhangZLZ16,
  author       = {Kaihua Zhang and
                  Lei Zhang and
                  Kin{-}Man Lam and
                  David Zhang},
  title        = {A Level Set Approach to Image Segmentation With Intensity Inhomogeneity},
  journal      = {{IEEE} Trans. Cybern.},
  volume       = {46},
  number       = {2},
  pages        = {546--557},
  year         = {2016},
  url          = {https://doi.org/10.1109/TCYB.2015.2409119},
  doi          = {10.1109/TCYB.2015.2409119},
  timestamp    = {Wed, 16 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcyb/ZhangZLZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/LuLXLZY16,
  author       = {Yuwu Lu and
                  Zhihui Lai and
                  Yong Xu and
                  Xuelong Li and
                  David Zhang and
                  Chun Yuan},
  title        = {Low-Rank Preserving Projections},
  journal      = {{IEEE} Trans. Cybern.},
  volume       = {46},
  number       = {8},
  pages        = {1900--1913},
  year         = {2016},
  url          = {https://doi.org/10.1109/TCYB.2015.2457611},
  doi          = {10.1109/TCYB.2015.2457611},
  timestamp    = {Mon, 14 Feb 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcyb/LuLXLZY16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/YanZ16,
  author       = {Ke Yan and
                  David Zhang},
  title        = {Correcting Instrumental Variation and Time-Varying Drift: {A} Transfer
                  Learning Approach With Autoencoders},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {65},
  number       = {9},
  pages        = {2012--2022},
  year         = {2016},
  url          = {https://doi.org/10.1109/TIM.2016.2573078},
  doi          = {10.1109/TIM.2016.2573078},
  timestamp    = {Mon, 08 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tim/YanZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/XuFWLZ16,
  author       = {Yong Xu and
                  Xiaozhao Fang and
                  Jian Wu and
                  Xuelong Li and
                  David Zhang},
  title        = {Discriminative Transfer Subspace Learning via Low-Rank and Sparse
                  Representation},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {25},
  number       = {2},
  pages        = {850--863},
  year         = {2016},
  url          = {https://doi.org/10.1109/TIP.2015.2510498},
  doi          = {10.1109/TIP.2015.2510498},
  timestamp    = {Mon, 14 Feb 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tip/XuFWLZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/ZhangZZ16,
  author       = {Lei Zhang and
                  Wangmeng Zuo and
                  David Zhang},
  title        = {{LSDT:} Latent Sparse Domain Transfer Learning for Visual Adaptation},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {25},
  number       = {3},
  pages        = {1177--1191},
  year         = {2016},
  url          = {https://doi.org/10.1109/TIP.2016.2516952},
  doi          = {10.1109/TIP.2016.2516952},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/ZhangZZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/ZuoRZG016,
  author       = {Wangmeng Zuo and
                  Dongwei Ren and
                  David Zhang and
                  Shuhang Gu and
                  Lei Zhang},
  title        = {Learning Iteration-wise Generalized Shrinkage-Thresholding Operators
                  for Blind Deconvolution},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {25},
  number       = {4},
  pages        = {1751--1764},
  year         = {2016},
  url          = {https://doi.org/10.1109/TIP.2016.2531905},
  doi          = {10.1109/TIP.2016.2531905},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tip/ZuoRZG016.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/JingWLHZ16,
  author       = {Xiao{-}Yuan Jing and
                  Fei Wu and
                  Zhiqiang Li and
                  Ruimin Hu and
                  David Zhang},
  title        = {Multi-Label Dictionary Learning for Image Annotation},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {25},
  number       = {6},
  pages        = {2712--2725},
  year         = {2016},
  url          = {https://doi.org/10.1109/TIP.2016.2549459},
  doi          = {10.1109/TIP.2016.2549459},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/JingWLHZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/ZhangZ16,
  author       = {Lei Zhang and
                  David Zhang},
  title        = {Robust Visual Knowledge Transfer via Extreme Learning Machine-Based
                  Domain Adaptation},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {25},
  number       = {10},
  pages        = {4959--4973},
  year         = {2016},
  url          = {https://doi.org/10.1109/TIP.2016.2598679},
  doi          = {10.1109/TIP.2016.2598679},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/ZhangZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/ZuoWZ16,
  author       = {Wangmeng Zuo and
                  Peng Wang and
                  David Zhang},
  title        = {Comparison of Three Different Types of Wrist Pulse Signals by Their
                  Physical Meanings and Diagnosis Performance},
  journal      = {{IEEE} J. Biomed. Health Informatics},
  volume       = {20},
  number       = {1},
  pages        = {119--127},
  year         = {2016},
  url          = {https://doi.org/10.1109/JBHI.2014.2369821},
  doi          = {10.1109/JBHI.2014.2369821},
  timestamp    = {Tue, 17 Nov 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/titb/ZuoWZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/WangZL16,
  author       = {Dimin Wang and
                  David Zhang and
                  Guangming Lu},
  title        = {An Optimal Pulse System Design by Multichannel Sensors Fusion},
  journal      = {{IEEE} J. Biomed. Health Informatics},
  volume       = {20},
  number       = {2},
  pages        = {450--459},
  year         = {2016},
  url          = {https://doi.org/10.1109/JBHI.2015.2392132},
  doi          = {10.1109/JBHI.2015.2392132},
  timestamp    = {Fri, 13 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/titb/WangZL16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmm/ZhangZ16,
  author       = {Lei Zhang and
                  David Zhang},
  title        = {Visual Understanding via Multi-Feature Shared Learning With Global
                  Consistency},
  journal      = {{IEEE} Trans. Multim.},
  volume       = {18},
  number       = {2},
  pages        = {247--259},
  year         = {2016},
  url          = {https://doi.org/10.1109/TMM.2015.2510509},
  doi          = {10.1109/TMM.2015.2510509},
  timestamp    = {Thu, 01 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tmm/ZhangZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/LaiWXYZ16,
  author       = {Zhihui Lai and
                  Wai Keung Wong and
                  Yong Xu and
                  Jian Yang and
                  David Zhang},
  title        = {Approximate Orthogonal Sparse Embedding for Dimensionality Reduction},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {27},
  number       = {4},
  pages        = {723--735},
  year         = {2016},
  url          = {https://doi.org/10.1109/TNNLS.2015.2422994},
  doi          = {10.1109/TNNLS.2015.2422994},
  timestamp    = {Mon, 09 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tnn/LaiWXYZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/QuZL16,
  author       = {Xiaofeng Qu and
                  David Zhang and
                  Guangming Lu},
  title        = {A Novel Line-Scan Palmprint Acquisition System},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Syst.},
  volume       = {46},
  number       = {11},
  pages        = {1481--1491},
  year         = {2016},
  url          = {https://doi.org/10.1109/TSMC.2015.2504036},
  doi          = {10.1109/TSMC.2015.2504036},
  timestamp    = {Wed, 20 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/QuZL16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/accv/XuRZZ16,
  author       = {Jun Xu and
                  Dongwei Ren and
                  Lei Zhang and
                  David Zhang},
  editor       = {Chu{-}Song Chen and
                  Jiwen Lu and
                  Kai{-}Kuang Ma},
  title        = {Patch Group Based Bayesian Learning for Blind Image Denoising},
  booktitle    = {Computer Vision - {ACCV} 2016 Workshops - {ACCV} 2016 International
                  Workshops, Taipei, Taiwan, November 20-24, 2016, Revised Selected
                  Papers, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {10116},
  pages        = {79--95},
  publisher    = {Springer},
  year         = {2016},
  url          = {https://doi.org/10.1007/978-3-319-54407-6\_6},
  doi          = {10.1007/978-3-319-54407-6\_6},
  timestamp    = {Tue, 14 May 2019 10:00:50 +0200},
  biburl       = {https://dblp.org/rec/conf/accv/XuRZZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/WangZLZZ16,
  author       = {Faqiang Wang and
                  Wangmeng Zuo and
                  Liang Lin and
                  David Zhang and
                  Lei Zhang},
  title        = {Joint Learning of Single-Image and Cross-Image Representations for
                  Person Re-identification},
  booktitle    = {2016 {IEEE} Conference on Computer Vision and Pattern Recognition,
                  {CVPR} 2016, Las Vegas, NV, USA, June 27-30, 2016},
  pages        = {1288--1296},
  publisher    = {{IEEE} Computer Society},
  year         = {2016},
  url          = {https://doi.org/10.1109/CVPR.2016.144},
  doi          = {10.1109/CVPR.2016.144},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/WangZLZZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ZhangXYLZ16,
  author       = {Zheng Zhang and
                  Yong Xu and
                  Jian Yang and
                  Xuelong Li and
                  David Zhang},
  title        = {A survey of sparse representation: algorithms and applications},
  journal      = {CoRR},
  volume       = {abs/1602.07017},
  year         = {2016},
  url          = {http://arxiv.org/abs/1602.07017},
  eprinttype    = {arXiv},
  eprint       = {1602.07017},
  timestamp    = {Wed, 16 Feb 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/ZhangXYLZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/YanKZ16,
  author       = {Ke Yan and
                  Lu Kou and
                  David Zhang},
  title        = {Domain Adaptation via Maximum Independence of Domain Features},
  journal      = {CoRR},
  volume       = {abs/1603.04535},
  year         = {2016},
  url          = {http://arxiv.org/abs/1603.04535},
  eprinttype    = {arXiv},
  eprint       = {1603.04535},
  timestamp    = {Thu, 17 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/YanKZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/YanWCCZ16,
  author       = {Yan Yan and
                  Hanzi Wang and
                  Si Chen and
                  Xiaochun Cao and
                  David Zhang},
  title        = {Quadratic Projection Based Feature Extraction with Its Application
                  to Biometric Recognition},
  journal      = {CoRR},
  volume       = {abs/1603.07797},
  year         = {2016},
  url          = {http://arxiv.org/abs/1603.07797},
  eprinttype    = {arXiv},
  eprint       = {1603.07797},
  timestamp    = {Tue, 15 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/YanWCCZ16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/LiZLW16,
  author       = {Jinxing Li and
                  David Zhang and
                  Yongcheng Li and
                  Jian Wu},
  title        = {Multi-modal Fusion for Diabetes Mellitus and Impaired Glucose Regulation
                  Detection},
  journal      = {CoRR},
  volume       = {abs/1604.03443},
  year         = {2016},
  url          = {http://arxiv.org/abs/1604.03443},
  eprinttype    = {arXiv},
  eprint       = {1604.03443},
  timestamp    = {Thu, 17 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/LiZLW16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/LiZZ16c,
  author       = {Mu Li and
                  Wangmeng Zuo and
                  David Zhang},
  title        = {Convolutional Network for Attribute-driven and Identity-preserving
                  Human Face Generation},
  journal      = {CoRR},
  volume       = {abs/1608.06434},
  year         = {2016},
  url          = {http://arxiv.org/abs/1608.06434},
  eprinttype    = {arXiv},
  eprint       = {1608.06434},
  timestamp    = {Tue, 22 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/LiZZ16c.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/LiZZ16e,
  author       = {Mu Li and
                  Wangmeng Zuo and
                  David Zhang},
  title        = {Deep Identity-aware Transfer of Facial Attributes},
  journal      = {CoRR},
  volume       = {abs/1610.05586},
  year         = {2016},
  url          = {http://arxiv.org/abs/1610.05586},
  eprinttype    = {arXiv},
  eprint       = {1610.05586},
  timestamp    = {Tue, 22 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/LiZZ16e.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/access/ZhangXYLZ15,
  author       = {Zheng Zhang and
                  Yong Xu and
                  Jian Yang and
                  Xuelong Li and
                  David Zhang},
  title        = {A Survey of Sparse Representation: Algorithms and Applications},
  journal      = {{IEEE} Access},
  volume       = {3},
  pages        = {490--530},
  year         = {2015},
  url          = {https://doi.org/10.1109/ACCESS.2015.2430359},
  doi          = {10.1109/ACCESS.2015.2430359},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/access/ZhangXYLZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/dsp/YinHHZWZ15,
  author       = {Xiao{-}Xia Yin and
                  Sillas Hadjiloucas and
                  Jing He and
                  Yanchun Zhang and
                  Y. Wang and
                  David Dapeng Zhang},
  title        = {Application of complex extreme learning machine to multiclass classification
                  problems with high dimensionality: {A} THz spectra classification
                  problem},
  journal      = {Digit. Signal Process.},
  volume       = {40},
  pages        = {40--52},
  year         = {2015},
  url          = {https://doi.org/10.1016/j.dsp.2015.01.007},
  doi          = {10.1016/J.DSP.2015.01.007},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/dsp/YinHHZWZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/ChenXZC15,
  author       = {Fangmei Chen and
                  Yong Xu and
                  David Zhang and
                  Kai Chen},
  title        = {2D facial landmark model design by combining key points and inserted
                  points},
  journal      = {Expert Syst. Appl.},
  volume       = {42},
  number       = {21},
  pages        = {7858--7868},
  year         = {2015},
  url          = {https://doi.org/10.1016/j.eswa.2015.06.015},
  doi          = {10.1016/J.ESWA.2015.06.015},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/eswa/ChenXZC15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/WuZ15,
  author       = {Kebin Wu and
                  David Zhang},
  title        = {Robust tongue segmentation by fusing region-based and edge-based approaches},
  journal      = {Expert Syst. Appl.},
  volume       = {42},
  number       = {21},
  pages        = {8027--8038},
  year         = {2015},
  url          = {https://doi.org/10.1016/j.eswa.2015.06.032},
  doi          = {10.1016/J.ESWA.2015.06.032},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/eswa/WuZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/LiCTXZ15,
  author       = {Zuoyong Li and
                  Yong Cheng and
                  Kezong Tang and
                  Yong Xu and
                  David Zhang},
  title        = {A salt {\&} pepper noise filter based on local and global image
                  information},
  journal      = {Neurocomputing},
  volume       = {159},
  pages        = {172--185},
  year         = {2015},
  url          = {https://doi.org/10.1016/j.neucom.2014.12.087},
  doi          = {10.1016/J.NEUCOM.2014.12.087},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/LiCTXZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/LiuZS15,
  author       = {Feng Liu and
                  David Zhang and
                  LinLin Shen},
  title        = {Study on novel Curvature Features for 3D fingerprint recognition},
  journal      = {Neurocomputing},
  volume       = {168},
  pages        = {599--608},
  year         = {2015},
  url          = {https://doi.org/10.1016/j.neucom.2015.05.065},
  doi          = {10.1016/J.NEUCOM.2015.05.065},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/LiuZS15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/RenZZZ15,
  author       = {Dongwei Ren and
                  Hongzhi Zhang and
                  David Zhang and
                  Wangmeng Zuo},
  title        = {Fast total-variation based image restoration based on derivative alternated
                  direction optimization methods},
  journal      = {Neurocomputing},
  volume       = {170},
  pages        = {201--212},
  year         = {2015},
  url          = {https://doi.org/10.1016/j.neucom.2014.08.101},
  doi          = {10.1016/J.NEUCOM.2014.08.101},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/RenZZZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/LiuZZ15,
  author       = {Yahui Liu and
                  Bob Zhang and
                  David Zhang},
  title        = {Ear-parotic face angle: {A} unique feature for 3D ear recognition},
  journal      = {Pattern Recognit. Lett.},
  volume       = {53},
  pages        = {9--15},
  year         = {2015},
  url          = {https://doi.org/10.1016/j.patrec.2014.10.014},
  doi          = {10.1016/J.PATREC.2014.10.014},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/prl/LiuZZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/ZhangZ15,
  author       = {Lei Zhang and
                  David Zhang},
  title        = {Domain Adaptation Extreme Learning Machines for Drift Compensation
                  in E-Nose Systems},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {64},
  number       = {7},
  pages        = {1790--1801},
  year         = {2015},
  url          = {https://doi.org/10.1109/TIM.2014.2367775},
  doi          = {10.1109/TIM.2014.2367775},
  timestamp    = {Mon, 08 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tim/ZhangZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/WangZL15,
  author       = {Dimin Wang and
                  David Zhang and
                  Guangming Lu},
  title        = {A Novel Multichannel Wrist Pulse System With Different Sensor Arrays},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {64},
  number       = {7},
  pages        = {2020--2034},
  year         = {2015},
  url          = {https://doi.org/10.1109/TIM.2014.2357599},
  doi          = {10.1109/TIM.2014.2357599},
  timestamp    = {Mon, 08 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tim/WangZL15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/XuFZ15,
  author       = {Yong Xu and
                  Lunke Fei and
                  David Zhang},
  title        = {Combining Left and Right Palmprint Images for More Accurate Personal
                  Identification},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {24},
  number       = {2},
  pages        = {549--559},
  year         = {2015},
  url          = {https://doi.org/10.1109/TIP.2014.2380171},
  doi          = {10.1109/TIP.2014.2380171},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/XuFZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/ShiGLYBZ15,
  author       = {Xiaoshuang Shi and
                  Zhenhua Guo and
                  Zhihui Lai and
                  Yujiu Yang and
                  Zhifeng Bao and
                  David Zhang},
  title        = {A Framework of Joint Graph Embedding and Sparse Regression for Dimensionality
                  Reduction},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {24},
  number       = {4},
  pages        = {1341--1355},
  year         = {2015},
  url          = {https://doi.org/10.1109/TIP.2015.2405474},
  doi          = {10.1109/TIP.2015.2405474},
  timestamp    = {Mon, 26 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tip/ShiGLYBZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/WangZ0MZ15,
  author       = {Faqiang Wang and
                  Wangmeng Zuo and
                  Lei Zhang and
                  Deyu Meng and
                  David Zhang},
  title        = {A Kernel Classification Framework for Metric Learning},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {26},
  number       = {9},
  pages        = {1950--1962},
  year         = {2015},
  url          = {https://doi.org/10.1109/TNNLS.2014.2361142},
  doi          = {10.1109/TNNLS.2014.2361142},
  timestamp    = {Mon, 09 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tnn/WangZ0MZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cccv/LiuSZ15,
  author       = {Feng Liu and
                  Linlin Shen and
                  David Zhang},
  editor       = {Hongbin Zha and
                  Xilin Chen and
                  Liang Wang and
                  Qiguang Miao},
  title        = {Feature-Based 3D Reconstruction Model for Close-Range Objects and
                  Its Application to Human Finger},
  booktitle    = {Computer Vision - {CCF} Chinese Conference, {CCCV} 2015, Xi'an, China,
                  September 18-20, 2015, Proceedings, Part {II}},
  series       = {Communications in Computer and Information Science},
  volume       = {547},
  pages        = {379--393},
  publisher    = {Springer},
  year         = {2015},
  url          = {https://doi.org/10.1007/978-3-662-48570-5\_37},
  doi          = {10.1007/978-3-662-48570-5\_37},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cccv/LiuSZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/XuZZZF15,
  author       = {Jun Xu and
                  Lei Zhang and
                  Wangmeng Zuo and
                  David Zhang and
                  Xiangchu Feng},
  title        = {Patch Group Based Nonlocal Self-Similarity Prior Learning for Image
                  Denoising},
  booktitle    = {2015 {IEEE} International Conference on Computer Vision, {ICCV} 2015,
                  Santiago, Chile, December 7-13, 2015},
  pages        = {244--252},
  publisher    = {{IEEE} Computer Society},
  year         = {2015},
  url          = {https://doi.org/10.1109/ICCV.2015.36},
  doi          = {10.1109/ICCV.2015.36},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iccv/XuZZZF15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icmlc/ZhuWXZZ15,
  author       = {Yuanyuan Zhu and
                  Xiaohe Wu and
                  Jun Xu and
                  David Zhang and
                  Wangmeng Zuo},
  title        = {Radius-margin based support vector machine with LogDet regularizaron},
  booktitle    = {2015 International Conference on Machine Learning and Cybernetics,
                  {ICMLC} 2015, Guangzhou, China, July 12-15, 2015},
  pages        = {277--282},
  publisher    = {{IEEE}},
  year         = {2015},
  url          = {https://doi.org/10.1109/ICMLC.2015.7340935},
  doi          = {10.1109/ICMLC.2015.7340935},
  timestamp    = {Wed, 16 Oct 2019 14:14:56 +0200},
  biburl       = {https://dblp.org/rec/conf/icmlc/ZhuWXZZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icycsee/LuoLZWZZ15,
  author       = {Changchun Luo and
                  Mu Li and
                  Hongzhi Zhang and
                  Faqiang Wang and
                  David Zhang and
                  Wangmeng Zuo},
  editor       = {Hongzhi Wang and
                  Haoliang Qi and
                  Wanxiang Che and
                  Zhaowen Qiu and
                  Leilei Kong and
                  Zhongyuan Han and
                  Junyu Lin and
                  Zeguang Lu},
  title        = {Metric Learning with Relative Distance Constraints: {A} Modified {SVM}
                  Approach},
  booktitle    = {Intelligent Computation in Big Data Era - International Conference
                  of Young Computer Scientists, Engineers and Educators, {ICYCSEE} 2015,
                  Harbin, China, January 10-12, 2015. Proceedings},
  series       = {Communications in Computer and Information Science},
  volume       = {503},
  pages        = {242--249},
  publisher    = {Springer},
  year         = {2015},
  url          = {https://doi.org/10.1007/978-3-662-46248-5\_30},
  doi          = {10.1007/978-3-662-46248-5\_30},
  timestamp    = {Wed, 06 Jan 2021 14:57:34 +0100},
  biburl       = {https://dblp.org/rec/conf/icycsee/LuoLZWZZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscide/WangZZZZ15,
  author       = {Weizhi Wang and
                  Hongzhi Zhang and
                  Pengfei Zhu and
                  David Zhang and
                  Wangmeng Zuo},
  editor       = {Xiaofei He and
                  Xinbo Gao and
                  Yanning Zhang and
                  Zhi{-}Hua Zhou and
                  Zhiyong Liu and
                  Baochuan Fu and
                  Fuyuan Hu and
                  Zhancheng Zhang},
  title        = {Non-convex Regularized Self-representation for Unsupervised Feature
                  Selection},
  booktitle    = {Intelligence Science and Big Data Engineering. Big Data and Machine
                  Learning Techniques - 5th International Conference, IScIDE 2015, Suzhou,
                  China, June 14-16, 2015, Revised Selected Papers, Part {II}},
  series       = {Lecture Notes in Computer Science},
  volume       = {9243},
  pages        = {55--65},
  publisher    = {Springer},
  year         = {2015},
  url          = {https://doi.org/10.1007/978-3-319-23862-3\_6},
  doi          = {10.1007/978-3-319-23862-3\_6},
  timestamp    = {Mon, 04 Dec 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iscide/WangZZZZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscide/HuangZZ15,
  author       = {Da Huang and
                  Kunai Zhang and
                  David Zhang},
  editor       = {Xiaofei He and
                  Xinbo Gao and
                  Yanning Zhang and
                  Zhi{-}Hua Zhou and
                  Zhiyong Liu and
                  Baochuan Fu and
                  Fuyuan Hu and
                  Zhancheng Zhang},
  title        = {Improvement on Gabor Texture Feature Based Biometric Analysis Using
                  Image Blurring},
  booktitle    = {Intelligence Science and Big Data Engineering. Image and Video Data
                  Engineering - 5th International Conference, IScIDE 2015, Suzhou, China,
                  June 14-16, 2015, Revised Selected Papers, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {9242},
  pages        = {420--430},
  publisher    = {Springer},
  year         = {2015},
  url          = {https://doi.org/10.1007/978-3-319-23989-7\_43},
  doi          = {10.1007/978-3-319-23989-7\_43},
  timestamp    = {Mon, 19 Apr 2021 14:35:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iscide/HuangZZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/bio/ZhangL15,
  author       = {David Zhang and
                  Laura Li Liu},
  editor       = {Stan Z. Li and
                  Anil K. Jain},
  title        = {Palmprint Features},
  booktitle    = {Encyclopedia of Biometrics, Second Edition},
  pages        = {1206--1213},
  publisher    = {Springer {US}},
  year         = {2015},
  url          = {https://doi.org/10.1007/978-1-4899-7488-4\_266},
  doi          = {10.1007/978-1-4899-7488-4\_266},
  timestamp    = {Fri, 27 Oct 2017 15:34:05 +0200},
  biburl       = {https://dblp.org/rec/reference/bio/ZhangL15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/bio/ZhangK15,
  author       = {David Zhang and
                  Vivek Kanhangad},
  editor       = {Stan Z. Li and
                  Anil K. Jain},
  title        = {Palmprint, 3D},
  booktitle    = {Encyclopedia of Biometrics, Second Edition},
  pages        = {1219--1226},
  publisher    = {Springer {US}},
  year         = {2015},
  url          = {https://doi.org/10.1007/978-1-4899-7488-4\_264},
  doi          = {10.1007/978-1-4899-7488-4\_264},
  timestamp    = {Mon, 18 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/reference/bio/ZhangK15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ZuoWZLHMZ15,
  author       = {Wangmeng Zuo and
                  Faqiang Wang and
                  David Zhang and
                  Liang Lin and
                  Yuchi Huang and
                  Deyu Meng and
                  Lei Zhang},
  title        = {Iterated Support Vector Machines for Distance Metric Learning},
  journal      = {CoRR},
  volume       = {abs/1502.00363},
  year         = {2015},
  url          = {http://arxiv.org/abs/1502.00363},
  eprinttype    = {arXiv},
  eprint       = {1502.00363},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/ZuoWZLHMZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ZhangZ15,
  author       = {Lei Zhang and
                  David Zhang},
  title        = {Evolutionary Cost-sensitive Extreme Learning Machine and Subspace
                  Extension},
  journal      = {CoRR},
  volume       = {abs/1505.04373},
  year         = {2015},
  url          = {http://arxiv.org/abs/1505.04373},
  eprinttype    = {arXiv},
  eprint       = {1505.04373},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/ZhangZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ZhangZ15a,
  author       = {Lei Zhang and
                  David Zhang},
  title        = {Robust Visual Knowledge Transfer via {EDA}},
  journal      = {CoRR},
  volume       = {abs/1505.04382},
  year         = {2015},
  url          = {http://arxiv.org/abs/1505.04382},
  eprinttype    = {arXiv},
  eprint       = {1505.04382},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/ZhangZ15a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ZhangZ15b,
  author       = {Lei Zhang and
                  David Zhang},
  title        = {Visual Understanding via Multi-Feature Jointly Sharing Learning},
  journal      = {CoRR},
  volume       = {abs/1505.05233},
  year         = {2015},
  url          = {http://arxiv.org/abs/1505.05233},
  eprinttype    = {arXiv},
  eprint       = {1505.05233},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/ZhangZ15b.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ZhangZ15c,
  author       = {Lei Zhang and
                  David Zhang},
  title        = {Domain Adaptation Extreme Learning Machines for Drift Compensation
                  in E-nose Systems},
  journal      = {CoRR},
  volume       = {abs/1505.06405},
  year         = {2015},
  url          = {http://arxiv.org/abs/1505.06405},
  eprinttype    = {arXiv},
  eprint       = {1505.06405},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/ZhangZ15c.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ZhangZ15d,
  author       = {Lei Zhang and
                  David Zhang},
  title        = {{SVM} and {ELM:} Who Wins? Object Recognition with Deep Convolutional
                  Features from ImageNet},
  journal      = {CoRR},
  volume       = {abs/1506.02509},
  year         = {2015},
  url          = {http://arxiv.org/abs/1506.02509},
  eprinttype    = {arXiv},
  eprint       = {1506.02509},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/ZhangZ15d.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/WangWZLZ15,
  author       = {Da{-}Han Wang and
                  Hanzi Wang and
                  Dong Zhang and
                  Jonathan Li and
                  David Zhang},
  title        = {Robust Scene Text Recognition Using Sparse Coding based Features},
  journal      = {CoRR},
  volume       = {abs/1512.08669},
  year         = {2015},
  url          = {http://arxiv.org/abs/1512.08669},
  eprinttype    = {arXiv},
  eprint       = {1512.08669},
  timestamp    = {Tue, 02 Mar 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/WangWZLZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcm/DengZZZ14,
  author       = {Hong Deng and
                  Wangmeng Zuo and
                  Hongzhi Zhang and
                  David Zhang},
  title        = {An additive convolution model for fast restoration of nonuniform blurred
                  images},
  journal      = {Int. J. Comput. Math.},
  volume       = {91},
  number       = {11},
  pages        = {2446--2466},
  year         = {2014},
  url          = {https://doi.org/10.1080/00207160.2013.811235},
  doi          = {10.1080/00207160.2013.811235},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijcm/DengZZZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijcv/YangZFZ14,
  author       = {Meng Yang and
                  Lei Zhang and
                  Xiangchu Feng and
                  David Zhang},
  title        = {Sparse Representation Based Fisher Discrimination Dictionary Learning
                  for Image Classification},
  journal      = {Int. J. Comput. Vis.},
  volume       = {109},
  number       = {3},
  pages        = {209--232},
  year         = {2014},
  url          = {https://doi.org/10.1007/s11263-014-0722-8},
  doi          = {10.1007/S11263-014-0722-8},
  timestamp    = {Fri, 13 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijcv/YangZFZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/XuLYZ14,
  author       = {Yong Xu and
                  Xuelong Li and
                  Jian Yang and
                  David Zhang},
  title        = {Integrate the original face image and its mirror image for face recognition},
  journal      = {Neurocomputing},
  volume       = {131},
  pages        = {191--199},
  year         = {2014},
  url          = {https://doi.org/10.1016/j.neucom.2013.10.025},
  doi          = {10.1016/J.NEUCOM.2013.10.025},
  timestamp    = {Mon, 14 Feb 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/XuLYZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/Zhang014,
  author       = {David Zhang and
                  Lei Zhang},
  title        = {Special issue on "New sensing and processing technologies for
                  hand-based biometrics authentication"},
  journal      = {Inf. Sci.},
  volume       = {268},
  pages        = {1--2},
  year         = {2014},
  url          = {https://doi.org/10.1016/j.ins.2014.03.001},
  doi          = {10.1016/J.INS.2014.03.001},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/isci/Zhang014.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/ZhangWCZWL14,
  author       = {Hongzhi Zhang and
                  Faqiang Wang and
                  Yan Chen and
                  David Dapeng Zhang and
                  Kuanquan Wang and
                  Jingdong Liu},
  title        = {Combination of linear regression classification and collaborative
                  representation classification},
  journal      = {Neural Comput. Appl.},
  volume       = {25},
  number       = {3-4},
  pages        = {833--838},
  year         = {2014},
  url          = {https://doi.org/10.1007/s00521-014-1564-6},
  doi          = {10.1007/S00521-014-1564-6},
  timestamp    = {Thu, 10 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nca/ZhangWCZWL14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/LiuZ14,
  author       = {Feng Liu and
                  David Zhang},
  title        = {3D fingerprint reconstruction system using feature correspondences
                  and prior estimated finger model},
  journal      = {Pattern Recognit.},
  volume       = {47},
  number       = {1},
  pages        = {178--193},
  year         = {2014},
  url          = {https://doi.org/10.1016/j.patcog.2013.06.009},
  doi          = {10.1016/J.PATCOG.2013.06.009},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/LiuZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tap/ChenXZ14,
  author       = {Fangmei Chen and
                  Yong Xu and
                  David Zhang},
  title        = {A New Hypothesis on Facial Beauty Perception},
  journal      = {{ACM} Trans. Appl. Percept.},
  volume       = {11},
  number       = {2},
  pages        = {8:1--8:20},
  year         = {2014},
  url          = {https://doi.org/10.1145/2622655},
  doi          = {10.1145/2622655},
  timestamp    = {Thu, 21 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tap/ChenXZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/ZhangKZ14,
  author       = {Bob Zhang and
                  B. V. K. Vijaya Kumar and
                  David Zhang},
  title        = {Detecting Diabetes Mellitus and Nonproliferative Diabetic Retinopathy
                  Using Tongue Color, Texture, and Geometry Features},
  journal      = {{IEEE} Trans. Biomed. Eng.},
  volume       = {61},
  number       = {2},
  pages        = {491--501},
  year         = {2014},
  url          = {https://doi.org/10.1109/TBME.2013.2282625},
  doi          = {10.1109/TBME.2013.2282625},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tbe/ZhangKZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/ZhangKZ14a,
  author       = {Bob Zhang and
                  B. V. K. Vijaya Kumar and
                  David Zhang},
  title        = {Noninvasive Diabetes Mellitus Detection Using Facial Block Color With
                  a Sparse Representation Classifier},
  journal      = {{IEEE} Trans. Biomed. Eng.},
  volume       = {61},
  number       = {4},
  pages        = {1027--1033},
  year         = {2014},
  url          = {https://doi.org/10.1109/TBME.2013.2292936},
  doi          = {10.1109/TBME.2013.2292936},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tbe/ZhangKZ14a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/YanZWWL14,
  author       = {Ke Yan and
                  David Zhang and
                  Darong Wu and
                  Hua Wei and
                  Guangming Lu},
  title        = {Design of a Breath Analysis System for Diabetes Screening and Blood
                  Glucose Level Prediction},
  journal      = {{IEEE} Trans. Biomed. Eng.},
  volume       = {61},
  number       = {11},
  pages        = {2787--2795},
  year         = {2014},
  url          = {https://doi.org/10.1109/TBME.2014.2329753},
  doi          = {10.1109/TBME.2014.2329753},
  timestamp    = {Wed, 02 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tbe/YanZWWL14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/LaiXJZ14,
  author       = {Zhihui Lai and
                  Yong Xu and
                  Zhong Jin and
                  David Zhang},
  title        = {Human Gait Recognition via Sparse Discriminant Projection Learning},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {24},
  number       = {10},
  pages        = {1651--1662},
  year         = {2014},
  url          = {https://doi.org/10.1109/TCSVT.2014.2305495},
  doi          = {10.1109/TCSVT.2014.2305495},
  timestamp    = {Tue, 25 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcsv/LaiXJZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcyb/XuLYLZ14,
  author       = {Yong Xu and
                  Xuelong Li and
                  Jian Yang and
                  Zhihui Lai and
                  David Zhang},
  title        = {Integrating Conventional and Inverse Representation for Face Recognition},
  journal      = {{IEEE} Trans. Cybern.},
  volume       = {44},
  number       = {10},
  pages        = {1738--1746},
  year         = {2014},
  url          = {https://doi.org/10.1109/TCYB.2013.2293391},
  doi          = {10.1109/TCYB.2013.2293391},
  timestamp    = {Mon, 14 Feb 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcyb/XuLYLZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/ZhuZZSZ14,
  author       = {Pengfei Zhu and
                  Wangmeng Zuo and
                  Lei Zhang and
                  Simon Chi{-}Keung Shiu and
                  David Zhang},
  title        = {Image Set-Based Collaborative Representation for Face Recognition},
  journal      = {{IEEE} Trans. Inf. Forensics Secur.},
  volume       = {9},
  number       = {7},
  pages        = {1120--1132},
  year         = {2014},
  url          = {https://doi.org/10.1109/TIFS.2014.2324277},
  doi          = {10.1109/TIFS.2014.2324277},
  timestamp    = {Mon, 04 Dec 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tifs/ZhuZZSZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/WangZZ14,
  author       = {Peng Wang and
                  Wangmeng Zuo and
                  David Zhang},
  title        = {A Compound Pressure Signal Acquisition System for Multichannel Wrist
                  Pulse Signal Analysis},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {63},
  number       = {6},
  pages        = {1556--1565},
  year         = {2014},
  url          = {https://doi.org/10.1109/TIM.2013.2267458},
  doi          = {10.1109/TIM.2013.2267458},
  timestamp    = {Tue, 17 Nov 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tim/WangZZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/Zuo0SZG14,
  author       = {Wangmeng Zuo and
                  Lei Zhang and
                  Chunwei Song and
                  David Zhang and
                  Huijun Gao},
  title        = {Gradient Histogram Estimation and Preservation for Texture Enhanced
                  Image Denoising},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {23},
  number       = {6},
  pages        = {2459--2472},
  year         = {2014},
  url          = {https://doi.org/10.1109/TIP.2014.2316423},
  doi          = {10.1109/TIP.2014.2316423},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/Zuo0SZG14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/FanXZYTLZ14,
  author       = {Zizhu Fan and
                  Yong Xu and
                  Wangmeng Zuo and
                  Jian Yang and
                  Jinhui Tang and
                  Zhihui Lai and
                  David Zhang},
  title        = {Modified Principal Component Analysis: An Integration of Multiple
                  Similarity Subspace Models},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {25},
  number       = {8},
  pages        = {1538--1552},
  year         = {2014},
  url          = {https://doi.org/10.1109/TNNLS.2013.2294492},
  doi          = {10.1109/TNNLS.2013.2294492},
  timestamp    = {Tue, 08 Mar 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tnn/FanXZYTLZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/LaiXCYZ14,
  author       = {Zhihui Lai and
                  Yong Xu and
                  Qingcai Chen and
                  Jian Yang and
                  David Zhang},
  title        = {Multilinear Sparse Principal Component Analysis},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {25},
  number       = {10},
  pages        = {1942--1950},
  year         = {2014},
  url          = {https://doi.org/10.1109/TNNLS.2013.2297381},
  doi          = {10.1109/TNNLS.2013.2297381},
  timestamp    = {Mon, 09 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tnn/LaiXCYZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/NappiPTZ14,
  author       = {Michele Nappi and
                  Vincenzo Piuri and
                  Tieniu Tan and
                  David Zhang},
  title        = {Introduction to the Special Section on Biometric Systems and Applications},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Syst.},
  volume       = {44},
  number       = {11},
  pages        = {1457--1460},
  year         = {2014},
  url          = {https://doi.org/10.1109/TSMC.2014.2337851},
  doi          = {10.1109/TSMC.2014.2337851},
  timestamp    = {Wed, 20 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/NappiPTZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccpr/ChenZRZZ14,
  author       = {Li Chen and
                  Hongzhi Zhang and
                  Dongwei Ren and
                  David Zhang and
                  Wangmeng Zuo},
  editor       = {Shutao Li and
                  Chenglin Liu and
                  Yaonan Wang},
  title        = {Fast Augmented Lagrangian Method for Image Smoothing with Hyper-Laplacian
                  Gradient Prior},
  booktitle    = {Pattern Recognition - 6th Chinese Conference, {CCPR} 2014, Changsha,
                  China, November 17-19, 2014. Proceedings, Part {II}},
  series       = {Communications in Computer and Information Science},
  volume       = {484},
  pages        = {12--21},
  publisher    = {Springer},
  year         = {2014},
  url          = {https://doi.org/10.1007/978-3-662-45643-9\_2},
  doi          = {10.1007/978-3-662-45643-9\_2},
  timestamp    = {Sat, 16 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ccpr/ChenZRZZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/ZhangZLZY14,
  author       = {Kaihua Zhang and
                  Lei Zhang and
                  Qingshan Liu and
                  David Zhang and
                  Ming{-}Hsuan Yang},
  editor       = {David J. Fleet and
                  Tom{\'{a}}s Pajdla and
                  Bernt Schiele and
                  Tinne Tuytelaars},
  title        = {Fast Visual Tracking via Dense Spatio-temporal Context Learning},
  booktitle    = {Computer Vision - {ECCV} 2014 - 13th European Conference, Zurich,
                  Switzerland, September 6-12, 2014, Proceedings, Part {V}},
  series       = {Lecture Notes in Computer Science},
  volume       = {8693},
  pages        = {127--141},
  publisher    = {Springer},
  year         = {2014},
  url          = {https://doi.org/10.1007/978-3-319-10602-1\_9},
  doi          = {10.1007/978-3-319-10602-1\_9},
  timestamp    = {Sat, 30 Sep 2023 09:39:19 +0200},
  biburl       = {https://dblp.org/rec/conf/eccv/ZhangZLZY14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/embc/YanZ14,
  author       = {Ke Yan and
                  David Zhang},
  title        = {Blood glucose prediction by breath analysis system with feature selection
                  and model fusion},
  booktitle    = {36th Annual International Conference of the {IEEE} Engineering in
                  Medicine and Biology Society, {EMBC} 2014, Chicago, IL, USA, August
                  26-30, 2014},
  pages        = {6406--6409},
  publisher    = {{IEEE}},
  year         = {2014},
  url          = {https://doi.org/10.1109/EMBC.2014.6945094},
  doi          = {10.1109/EMBC.2014.6945094},
  timestamp    = {Wed, 16 Oct 2019 14:14:50 +0200},
  biburl       = {https://dblp.org/rec/conf/embc/YanZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medbiometrics/MaHLLZ14,
  author       = {Lin Ma and
                  Ying He and
                  Haifeng Li and
                  Naimin Li and
                  David Zhang},
  title        = {A {CGA-MRF} Hybrid Method for Iris Texture Analysis and Modeling},
  booktitle    = {2014 International Conference on Medical Biometrics, Shenzhen, Guangdong,
                  China, May 30 - June 1, 2014},
  pages        = {1--6},
  publisher    = {{IEEE}},
  year         = {2014},
  url          = {https://doi.org/10.1109/ICMB.2014.8},
  doi          = {10.1109/ICMB.2014.8},
  timestamp    = {Wed, 16 Oct 2019 14:14:49 +0200},
  biburl       = {https://dblp.org/rec/conf/medbiometrics/MaHLLZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medbiometrics/WangHZZZ14,
  author       = {Peng Wang and
                  Shanpeng Hou and
                  Hongzhi Zhang and
                  Wangmeng Zuo and
                  David Zhang},
  title        = {Wrist Pulse Diagnosis Using Complex Network},
  booktitle    = {2014 International Conference on Medical Biometrics, Shenzhen, Guangdong,
                  China, May 30 - June 1, 2014},
  pages        = {15--20},
  publisher    = {{IEEE}},
  year         = {2014},
  url          = {https://doi.org/10.1109/ICMB.2014.10},
  doi          = {10.1109/ICMB.2014.10},
  timestamp    = {Tue, 17 Nov 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/medbiometrics/WangHZZZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medbiometrics/YanZ14,
  author       = {Ke Yan and
                  David Zhang},
  title        = {Sensor Evaluation in a Breath Analysis System},
  booktitle    = {2014 International Conference on Medical Biometrics, Shenzhen, Guangdong,
                  China, May 30 - June 1, 2014},
  pages        = {35--40},
  publisher    = {{IEEE}},
  year         = {2014},
  url          = {https://doi.org/10.1109/ICMB.2014.14},
  doi          = {10.1109/ICMB.2014.14},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/medbiometrics/YanZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medbiometrics/WangZC14,
  author       = {Dimin Wang and
                  David Zhang and
                  Juliana C. N. Chan},
  title        = {Feature Extraction of Radial Arterial Pulse},
  booktitle    = {2014 International Conference on Medical Biometrics, Shenzhen, Guangdong,
                  China, May 30 - June 1, 2014},
  pages        = {41--46},
  publisher    = {{IEEE}},
  year         = {2014},
  url          = {https://doi.org/10.1109/ICMB.2014.15},
  doi          = {10.1109/ICMB.2014.15},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/medbiometrics/WangZC14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medbiometrics/ChenZ14,
  author       = {Fangmei Chen and
                  David Zhang},
  title        = {Evaluation of the Putative Ratio Rules for Facial Beauty Indexing},
  booktitle    = {2014 International Conference on Medical Biometrics, Shenzhen, Guangdong,
                  China, May 30 - June 1, 2014},
  pages        = {181--188},
  publisher    = {{IEEE}},
  year         = {2014},
  url          = {https://doi.org/10.1109/ICMB.2014.38},
  doi          = {10.1109/ICMB.2014.38},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/medbiometrics/ChenZ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejasp/CuiZZLZ13,
  author       = {Zhenchao Cui and
                  Hongzhi Zhang and
                  David Zhang and
                  Naimin Li and
                  Wangmeng Zuo},
  title        = {Fast marching over the 2D Gabor magnitude domain for tongue body segmentation},
  journal      = {{EURASIP} J. Adv. Signal Process.},
  volume       = {2013},
  pages        = {190},
  year         = {2013},
  url          = {https://doi.org/10.1186/1687-6180-2013-190},
  doi          = {10.1186/1687-6180-2013-190},
  timestamp    = {Thu, 12 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ejasp/CuiZZLZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/WangZGZ13,
  author       = {Xingzheng Wang and
                  Bob Zhang and
                  Zhenhua Guo and
                  David Zhang},
  title        = {Facial image medical analysis system using quantitative chromatic
                  feature},
  journal      = {Expert Syst. Appl.},
  volume       = {40},
  number       = {9},
  pages        = {3738--3746},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.eswa.2012.12.079},
  doi          = {10.1016/J.ESWA.2012.12.079},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/eswa/WangZGZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/WangZ13,
  author       = {Xingzheng Wang and
                  David Zhang},
  title        = {A high quality color imaging system for computerized tongue image
                  analysis},
  journal      = {Expert Syst. Appl.},
  volume       = {40},
  number       = {15},
  pages        = {5854--5866},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.eswa.2013.04.031},
  doi          = {10.1016/J.ESWA.2013.04.031},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/eswa/WangZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/XuFQZY13,
  author       = {Yong Xu and
                  Zizhu Fan and
                  Minna Qiu and
                  David Zhang and
                  Jing{-}Yu Yang},
  title        = {A sparse representation method of bimodal biometrics and palmprint
                  recognition experiments},
  journal      = {Neurocomputing},
  volume       = {103},
  pages        = {164--171},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.neucom.2012.08.038},
  doi          = {10.1016/J.NEUCOM.2012.08.038},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijon/XuFQZY13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/GuoLZYZL13,
  author       = {Zhenhua Guo and
                  Qin Li and
                  Lin Zhang and
                  Jane You and
                  David Zhang and
                  Wenhuang Liu},
  title        = {Is local dominant orientation necessary for the classification of
                  rotation invariant texture?},
  journal      = {Neurocomputing},
  volume       = {116},
  pages        = {182--191},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.neucom.2011.11.038},
  doi          = {10.1016/J.NEUCOM.2011.11.038},
  timestamp    = {Fri, 30 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/GuoLZYZL13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/ZhangWKYZ13,
  author       = {Bob Zhang and
                  Xingzheng Wang and
                  Fakhri Karray and
                  Zhimin Yang and
                  David Zhang},
  title        = {Computerized facial diagnosis using both color and texture features},
  journal      = {Inf. Sci.},
  volume       = {221},
  pages        = {49--59},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.ins.2012.09.011},
  doi          = {10.1016/J.INS.2012.09.011},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/isci/ZhangWKYZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/XuZFZML13,
  author       = {Yong Xu and
                  Qi Zhu and
                  Zizhu Fan and
                  David Zhang and
                  Jian{-}Xun Mi and
                  Zhihui Lai},
  title        = {Using the idea of the sparse representation to perform coarse-to-fine
                  face recognition},
  journal      = {Inf. Sci.},
  volume       = {238},
  pages        = {138--148},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.ins.2013.02.051},
  doi          = {10.1016/J.INS.2013.02.051},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/isci/XuZFZML13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/PengZZ13,
  author       = {Bo Peng and
                  Lei Zhang and
                  David Zhang},
  title        = {A survey of graph theoretical approaches to image segmentation},
  journal      = {Pattern Recognit.},
  volume       = {46},
  number       = {3},
  pages        = {1020--1038},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.patcog.2012.09.015},
  doi          = {10.1016/J.PATCOG.2012.09.015},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/PengZZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ChenYZL13,
  author       = {Xiaobo Chen and
                  Jian Yang and
                  David Zhang and
                  Jun Liang},
  title        = {Complete large margin linear discriminant analysis using mathematical
                  programming approach},
  journal      = {Pattern Recognit.},
  volume       = {46},
  number       = {6},
  pages        = {1579--1594},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.patcog.2012.11.019},
  doi          = {10.1016/J.PATCOG.2012.11.019},
  timestamp    = {Wed, 26 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/ChenYZL13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/YangZSZ13,
  author       = {Meng Yang and
                  Lei Zhang and
                  Simon C. K. Shiu and
                  David Zhang},
  title        = {Gabor feature based robust representation and classification for face
                  recognition with Gabor occlusion dictionary},
  journal      = {Pattern Recognit.},
  volume       = {46},
  number       = {7},
  pages        = {1865--1878},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.patcog.2012.06.022},
  doi          = {10.1016/J.PATCOG.2012.06.022},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/YangZSZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/FengYZLZ13,
  author       = {Zhizhao Feng and
                  Meng Yang and
                  Lei Zhang and
                  Yan Liu and
                  David Zhang},
  title        = {Joint discriminative dimensionality reduction and dictionary learning
                  for face recognition},
  journal      = {Pattern Recognit.},
  volume       = {46},
  number       = {8},
  pages        = {2134--2143},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.patcog.2013.01.016},
  doi          = {10.1016/J.PATCOG.2013.01.016},
  timestamp    = {Fri, 16 Apr 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/FengYZLZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/RenZZLZ13,
  author       = {Dongwei Ren and
                  Wangmeng Zuo and
                  Xiaofei Zhao and
                  Zhouchen Lin and
                  David Zhang},
  title        = {Fast gradient vector flow computation based on augmented Lagrangian
                  method},
  journal      = {Pattern Recognit. Lett.},
  volume       = {34},
  number       = {2},
  pages        = {219--225},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.patrec.2012.09.017},
  doi          = {10.1016/J.PATREC.2012.09.017},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/prl/RenZZLZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/Ning0ZY13,
  author       = {Jifeng Ning and
                  Lei Zhang and
                  David Zhang and
                  Wei Yu},
  title        = {Joint Registration and Active Contour Segmentation for Object Tracking},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {23},
  number       = {9},
  pages        = {1589--1597},
  year         = {2013},
  url          = {https://doi.org/10.1109/TCSVT.2013.2254931},
  doi          = {10.1109/TCSVT.2013.2254931},
  timestamp    = {Tue, 25 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcsv/Ning0ZY13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/GongZSY13,
  author       = {Yazhuo Gong and
                  David Zhang and
                  Pengfei Shi and
                  Jingqi Yan},
  title        = {An Optimized Wavelength Band Selection for Heavily Pigmented Iris
                  Recognition},
  journal      = {{IEEE} Trans. Inf. Forensics Secur.},
  volume       = {8},
  number       = {1},
  pages        = {64--75},
  year         = {2013},
  url          = {https://doi.org/10.1109/TIFS.2012.2223682},
  doi          = {10.1109/TIFS.2012.2223682},
  timestamp    = {Thu, 06 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tifs/GongZSY13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/LiuZG13,
  author       = {Feng Liu and
                  David Zhang and
                  Zhenhua Guo},
  title        = {Distal-Interphalangeal-Crease-Based User Authentication System},
  journal      = {{IEEE} Trans. Inf. Forensics Secur.},
  volume       = {8},
  number       = {9},
  pages        = {1446--1455},
  year         = {2013},
  url          = {https://doi.org/10.1109/TIFS.2013.2272787},
  doi          = {10.1109/TIFS.2013.2272787},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tifs/LiuZG13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/LiuZSL13,
  author       = {Feng Liu and
                  David Zhang and
                  Changjiang Song and
                  Guangming Lu},
  title        = {Touchless Multiview Fingerprint Acquisition and Mosaicking},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {62},
  number       = {9},
  pages        = {2492--2502},
  year         = {2013},
  url          = {https://doi.org/10.1109/TIM.2013.2258248},
  doi          = {10.1109/TIM.2013.2258248},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tim/LiuZSL13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/ZhangZSZ13,
  author       = {Kaihua Zhang and
                  Lei Zhang and
                  Huihui Song and
                  David Zhang},
  title        = {Reinitialization-Free Level Set Evolution via Reaction Diffusion},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {22},
  number       = {1},
  pages        = {258--271},
  year         = {2013},
  url          = {https://doi.org/10.1109/TIP.2012.2214046},
  doi          = {10.1109/TIP.2012.2214046},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/ZhangZSZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/YangZYZ13,
  author       = {Meng Yang and
                  Lei Zhang and
                  Jian Yang and
                  David Zhang},
  title        = {Regularized Robust Coding for Face Recognition},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {22},
  number       = {5},
  pages        = {1753--1766},
  year         = {2013},
  url          = {https://doi.org/10.1109/TIP.2012.2235849},
  doi          = {10.1109/TIP.2012.2235849},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/YangZYZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/LaiXYTZ13,
  author       = {Zhihui Lai and
                  Yong Xu and
                  Jian Yang and
                  Jinhui Tang and
                  David Zhang},
  title        = {Sparse Tensor Discriminant Analysis},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {22},
  number       = {10},
  pages        = {3904--3915},
  year         = {2013},
  url          = {https://doi.org/10.1109/TIP.2013.2264678},
  doi          = {10.1109/TIP.2013.2264678},
  timestamp    = {Tue, 08 Mar 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tip/LaiXYTZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/GaoZYZZ13,
  author       = {Guangwei Gao and
                  Lei Zhang and
                  Jian Yang and
                  Lin Zhang and
                  David Zhang},
  title        = {Reconstruction Based Finger-Knuckle-Print Verification With Score
                  Level Adaptive Binary Fusion},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {22},
  number       = {12},
  pages        = {5050--5062},
  year         = {2013},
  url          = {https://doi.org/10.1109/TIP.2013.2281429},
  doi          = {10.1109/TIP.2013.2281429},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/GaoZYZZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/WangZYWZ13,
  author       = {Xingzheng Wang and
                  Bob Zhang and
                  Zhimin Yang and
                  Haoqian Wang and
                  David Zhang},
  title        = {Statistical Analysis of Tongue Images for Feature Extraction and Diagnostics},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {22},
  number       = {12},
  pages        = {5336--5347},
  year         = {2013},
  url          = {https://doi.org/10.1109/TIP.2013.2284070},
  doi          = {10.1109/TIP.2013.2284070},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/WangZYWZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/MaZLCZW13,
  author       = {Lin Ma and
                  David Zhang and
                  Naimin Li and
                  Yan Cai and
                  Wangmeng Zuo and
                  Kuanquan Wang},
  title        = {Iris-Based Medical Analysis by Geometric Deformation Features},
  journal      = {{IEEE} J. Biomed. Health Informatics},
  volume       = {17},
  number       = {1},
  pages        = {223--231},
  year         = {2013},
  url          = {https://doi.org/10.1109/TITB.2012.2222655},
  doi          = {10.1109/TITB.2012.2222655},
  timestamp    = {Fri, 24 Feb 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/titb/MaZLCZW13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/WangZ13,
  author       = {Xingzheng Wang and
                  David Zhang},
  title        = {A New Tongue Colorchecker Design by Space Representation for Precise
                  Correction},
  journal      = {{IEEE} J. Biomed. Health Informatics},
  volume       = {17},
  number       = {2},
  pages        = {381--391},
  year         = {2013},
  url          = {https://doi.org/10.1109/TITB.2012.2226736},
  doi          = {10.1109/TITB.2012.2226736},
  timestamp    = {Fri, 13 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/titb/WangZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/YangZSZ13,
  author       = {Meng Yang and
                  Lei Zhang and
                  Simon Chi{-}Keung Shiu and
                  David Zhang},
  title        = {Robust Kernel Representation With Statistical Local Features for Face
                  Recognition},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {24},
  number       = {6},
  pages        = {900--912},
  year         = {2013},
  url          = {https://doi.org/10.1109/TNNLS.2013.2245340},
  doi          = {10.1109/TNNLS.2013.2245340},
  timestamp    = {Mon, 09 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tnn/YangZSZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/Zhang0QZ13,
  author       = {Bob Zhang and
                  Wei Li and
                  Pei Qing and
                  David Zhang},
  title        = {Palm-Print Classification by Global Features},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Syst.},
  volume       = {43},
  number       = {2},
  pages        = {370--378},
  year         = {2013},
  url          = {https://doi.org/10.1109/TSMCA.2012.2201465},
  doi          = {10.1109/TSMCA.2012.2201465},
  timestamp    = {Sun, 13 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/Zhang0QZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/GongZSY13,
  author       = {Yazhuo Gong and
                  David Zhang and
                  Pengfei Shi and
                  Jingqi Yan},
  title        = {Handheld System Design for Dual-Eye Multispectral Iris Capture With
                  One Camera},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Syst.},
  volume       = {43},
  number       = {5},
  pages        = {1154--1166},
  year         = {2013},
  url          = {https://doi.org/10.1109/TSMCA.2012.2227958},
  doi          = {10.1109/TSMCA.2012.2227958},
  timestamp    = {Wed, 20 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/GongZSY13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmei/WangZZZW13,
  author       = {Peng Wang and
                  Hongzhi Zhang and
                  Wangmeng Zuo and
                  David Zhang and
                  Qiufeng Wu},
  editor       = {Jean X. Gao and
                  Dongrong Xu and
                  Xiaoyan Sun and
                  Yingfei Wu},
  title        = {A comparison of three types of pulse signals: Physical meaning and
                  diagnosis performance},
  booktitle    = {6th International Conference on Biomedical Engineering and Informatics,
                  {BMEI} 2013, Hangzhou, China, December 16-18, 2013},
  pages        = {352--357},
  publisher    = {{IEEE}},
  year         = {2013},
  url          = {https://doi.org/10.1109/BMEI.2013.6746962},
  doi          = {10.1109/BMEI.2013.6746962},
  timestamp    = {Tue, 17 Nov 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/bmei/WangZZZW13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ZuoZSZ13,
  author       = {Wangmeng Zuo and
                  Lei Zhang and
                  Chunwei Song and
                  David Zhang},
  title        = {Texture Enhanced Image Denoising via Gradient Histogram Preservation},
  booktitle    = {2013 {IEEE} Conference on Computer Vision and Pattern Recognition,
                  Portland, OR, USA, June 23-28, 2013},
  pages        = {1203--1210},
  publisher    = {{IEEE} Computer Society},
  year         = {2013},
  url          = {https://doi.org/10.1109/CVPR.2013.159},
  doi          = {10.1109/CVPR.2013.159},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/ZuoZSZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/ZuoM0FZ13,
  author       = {Wangmeng Zuo and
                  Deyu Meng and
                  Lei Zhang and
                  Xiangchu Feng and
                  David Zhang},
  title        = {A Generalized Iterated Shrinkage Algorithm for Non-convex Sparse Coding},
  booktitle    = {{IEEE} International Conference on Computer Vision, {ICCV} 2013, Sydney,
                  Australia, December 1-8, 2013},
  pages        = {217--224},
  publisher    = {{IEEE} Computer Society},
  year         = {2013},
  url          = {https://doi.org/10.1109/ICCV.2013.34},
  doi          = {10.1109/ICCV.2013.34},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iccv/ZuoM0FZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/ZhuZZZ13,
  author       = {Pengfei Zhu and
                  Lei Zhang and
                  Wangmeng Zuo and
                  David Zhang},
  title        = {From Point to Set: Extend the Learning of Distance Metrics},
  booktitle    = {{IEEE} International Conference on Computer Vision, {ICCV} 2013, Sydney,
                  Australia, December 1-8, 2013},
  pages        = {2664--2671},
  publisher    = {{IEEE} Computer Society},
  year         = {2013},
  url          = {https://doi.org/10.1109/ICCV.2013.331},
  doi          = {10.1109/ICCV.2013.331},
  timestamp    = {Mon, 04 Dec 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iccv/ZhuZZZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscide/RenZZZ13,
  author       = {Dongwei Ren and
                  Wangmeng Zuo and
                  Hongzhi Zhang and
                  David Zhang},
  editor       = {Changyin Sun and
                  Fang Fang and
                  Zhi{-}Hua Zhou and
                  Wankou Yang and
                  Zhiyong Liu},
  title        = {A Derivative Augmented Lagrangian Method for Fast Total Variation
                  Based Image Restoration},
  booktitle    = {Intelligence Science and Big Data Engineering - 4th International
                  Conference, IScIDE 2013, Beijing, China, July 31 - August 2, 2013,
                  Revised Selected Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {8261},
  pages        = {287--294},
  publisher    = {Springer},
  year         = {2013},
  url          = {https://doi.org/10.1007/978-3-642-42057-3\_37},
  doi          = {10.1007/978-3-642-42057-3\_37},
  timestamp    = {Tue, 14 May 2019 10:00:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iscide/RenZZZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscide/CuiZZZ13,
  author       = {Zhenchao Cui and
                  Wangmeng Zuo and
                  Hongzhi Zhang and
                  David Zhang},
  editor       = {Changyin Sun and
                  Fang Fang and
                  Zhi{-}Hua Zhou and
                  Wankou Yang and
                  Zhiyong Liu},
  title        = {Automated Tongue Segmentation Based on 2D Gabor Filters and Fast Marching},
  booktitle    = {Intelligence Science and Big Data Engineering - 4th International
                  Conference, IScIDE 2013, Beijing, China, July 31 - August 2, 2013,
                  Revised Selected Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {8261},
  pages        = {328--335},
  publisher    = {Springer},
  year         = {2013},
  url          = {https://doi.org/10.1007/978-3-642-42057-3\_42},
  doi          = {10.1007/978-3-642-42057-3\_42},
  timestamp    = {Sat, 16 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iscide/CuiZZZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigmod/QiaoSDQSGCSZABBGGIJLPRSSSSTTWZ13,
  author       = {Lin Qiao and
                  Kapil Surlaker and
                  Shirshanka Das and
                  Tom Quiggle and
                  Bob Schulman and
                  Bhaskar Ghosh and
                  Antony Curtis and
                  Oliver Seeliger and
                  Zhen Zhang and
                  Aditya Auradkar and
                  Chris Beaver and
                  Gregory Brandt and
                  Mihir Gandhi and
                  Kishore Gopalakrishna and
                  Wai Ip and
                  Swaroop Jagadish and
                  Shi Lu and
                  Alexander Pachev and
                  Aditya Ramesh and
                  Abraham Sebastian and
                  Rupa Shanbhag and
                  Subbu Subramaniam and
                  Yun Sun and
                  Sajid Topiwala and
                  Cuong Tran and
                  Jemiah Westerman and
                  David Zhang},
  editor       = {Kenneth A. Ross and
                  Divesh Srivastava and
                  Dimitris Papadias},
  title        = {On brewing fresh espresso: LinkedIn's distributed data serving platform},
  booktitle    = {Proceedings of the {ACM} {SIGMOD} International Conference on Management
                  of Data, {SIGMOD} 2013, New York, NY, USA, June 22-27, 2013},
  pages        = {1135--1146},
  publisher    = {{ACM}},
  year         = {2013},
  url          = {https://doi.org/10.1145/2463676.2465298},
  doi          = {10.1145/2463676.2465298},
  timestamp    = {Wed, 28 Sep 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/sigmod/QiaoSDQSGCSZABBGGIJLPRSSSSTTWZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/acvpr/KongZK13,
  author       = {Adams Wai{-}Kin Kong and
                  David Zhang and
                  Mohamed Kamel},
  editor       = {Mark James Burge and
                  Kevin W. Bowyer},
  title        = {An Introduction to the IrisCode Theory},
  booktitle    = {Handbook of Iris Recognition},
  series       = {Advances in Computer Vision and Pattern Recognition},
  pages        = {321--336},
  publisher    = {Springer},
  year         = {2013},
  url          = {https://doi.org/10.1007/978-1-4471-4402-1\_16},
  doi          = {10.1007/978-1-4471-4402-1\_16},
  timestamp    = {Fri, 10 Jul 2020 09:25:44 +0200},
  biburl       = {https://dblp.org/rec/series/acvpr/KongZK13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1305-7053,
  author       = {Kaihua Zhang and
                  Lei Zhang and
                  Kin{-}Man Lam and
                  David Zhang},
  title        = {A Local Active Contour Model for Image Segmentation with Intensity
                  Inhomogeneity},
  journal      = {CoRR},
  volume       = {abs/1305.7053},
  year         = {2013},
  url          = {http://arxiv.org/abs/1305.7053},
  eprinttype    = {arXiv},
  eprint       = {1305.7053},
  timestamp    = {Wed, 16 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1305-7053.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ZhuZ0SZ13,
  author       = {Pengfei Zhu and
                  Wangmeng Zuo and
                  Lei Zhang and
                  Simon C. K. Shiu and
                  David Zhang},
  title        = {Image Set based Collaborative Representation for Face Recognition},
  journal      = {CoRR},
  volume       = {abs/1308.6687},
  year         = {2013},
  url          = {http://arxiv.org/abs/1308.6687},
  eprinttype    = {arXiv},
  eprint       = {1308.6687},
  timestamp    = {Mon, 04 Dec 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/ZhuZ0SZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/WangZZMZ13,
  author       = {Faqiang Wang and
                  Wangmeng Zuo and
                  Lei Zhang and
                  Deyu Meng and
                  David Zhang},
  title        = {A Kernel Classification Framework for Metric Learning},
  journal      = {CoRR},
  volume       = {abs/1309.5823},
  year         = {2013},
  url          = {http://arxiv.org/abs/1309.5823},
  eprinttype    = {arXiv},
  eprint       = {1309.5823},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/WangZZMZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/ZhangZYZ13,
  author       = {Kaihua Zhang and
                  Lei Zhang and
                  Ming{-}Hsuan Yang and
                  David Zhang},
  title        = {Fast Tracking via Spatio-Temporal Context Learning},
  journal      = {CoRR},
  volume       = {abs/1311.1939},
  year         = {2013},
  url          = {http://arxiv.org/abs/1311.1939},
  eprinttype    = {arXiv},
  eprint       = {1311.1939},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/ZhangZYZ13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/csur/ZhangZY12,
  author       = {David Zhang and
                  Wangmeng Zuo and
                  Feng Yue},
  title        = {A Comparative Study of Palmprint Recognition Algorithms},
  journal      = {{ACM} Comput. Surv.},
  volume       = {44},
  number       = {1},
  pages        = {2:1--2:37},
  year         = {2012},
  url          = {https://doi.org/10.1145/2071389.2071391},
  doi          = {10.1145/2071389.2071391},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/csur/ZhangZY12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/LiYZ12,
  author       = {Qin Li and
                  Jane You and
                  David Zhang},
  title        = {Vessel segmentation and width estimation in retinal images using multiscale
                  production of matched filter responses},
  journal      = {Expert Syst. Appl.},
  volume       = {39},
  number       = {9},
  pages        = {7600--7610},
  year         = {2012},
  url          = {https://doi.org/10.1016/j.eswa.2011.12.046},
  doi          = {10.1016/J.ESWA.2011.12.046},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/eswa/LiYZ12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieicet/LiuLJGZY12,
  author       = {Qian Liu and
                  Chao Lan and
                  Xiao{-}Yuan Jing and
                  Shi{-}Qiang Gao and
                  David Zhang and
                  Jing{-}Yu Yang},
  title        = {Sparsity Preserving Embedding with Manifold Learning and Discriminant
                  Analysis},
  journal      = {{IEICE} Trans. Inf. Syst.},
  volume       = {95-D},
  number       = {1},
  pages        = {271--274},
  year         = {2012},
  url          = {https://doi.org/10.1587/transinf.E95.D.271},
  doi          = {10.1587/TRANSINF.E95.D.271},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ieicet/LiuLJGZY12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijprai/SongYZX12,
  author       = {Fengxi Song and
                  Jane You and
                  David Zhang and
                  Yong Xu},
  title        = {Impact of Full Rank Principal Component Analysis on Classification
                  Algorithms for Face Recognition},
  journal      = {Int. J. Pattern Recognit. Artif. Intell.},
  volume       = {26},
  number       = {3},
  year         = {2012},
  url          = {https://doi.org/10.1142/S0218001412560058},
  doi          = {10.1142/S0218001412560058},
  timestamp    = {Mon, 11 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijprai/SongYZX12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/NingZWY12,
  author       = {Jifeng Ning and
                  David Zhang and
                  Chengke Wu and
                  Feng Yue},
  title        = {Automatic tongue image segmentation based on gradient vector flow
                  and region merging},
  journal      = {Neural Comput. Appl.},
  volume       = {21},
  number       = {8},
  pages        = {1819--1826},
  year         = {2012},
  url          = {https://doi.org/10.1007/s00521-010-0484-3},
  doi          = {10.1007/S00521-010-0484-3},
  timestamp    = {Thu, 10 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nca/NingZWY12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/GuoLYZL12,
  author       = {Zhenhua Guo and
                  Qin Li and
                  Jane You and
                  David Zhang and
                  Wenhuang Liu},
  title        = {Local directional derivative pattern for rotation invariant texture
                  classification},
  journal      = {Neural Comput. Appl.},
  volume       = {21},
  number       = {8},
  pages        = {1893--1904},
  year         = {2012},
  url          = {https://doi.org/10.1007/s00521-011-0586-6},
  doi          = {10.1007/S00521-011-0586-6},
  timestamp    = {Thu, 10 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nca/GuoLYZL12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ZhangZZG12,
  author       = {Lin Zhang and
                  Lei Zhang and
                  David Zhang and
                  Zhenhua Guo},
  title        = {Phase congruency induced local features for finger-knuckle-print recognition},
  journal      = {Pattern Recognit.},
  volume       = {45},
  number       = {7},
  pages        = {2522--2531},
  year         = {2012},
  url          = {https://doi.org/10.1016/j.patcog.2012.01.017},
  doi          = {10.1016/J.PATCOG.2012.01.017},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/ZhangZZG12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/HuJZGS12,
  author       = {Rong{-}Xiang Hu and
                  Wei Jia and
                  David Zhang and
                  Jie Gui and
                  Liang{-}Tu Song},
  title        = {Hand shape recognition based on coherent distance shape contexts},
  journal      = {Pattern Recognit.},
  volume       = {45},
  number       = {9},
  pages        = {3348--3359},
  year         = {2012},
  url          = {https://doi.org/10.1016/j.patcog.2012.02.018},
  doi          = {10.1016/J.PATCOG.2012.02.018},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/HuJZGS12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/JingLZLY12,
  author       = {Xiao{-}Yuan Jing and
                  Sheng Li and
                  David Zhang and
                  Chao Lan and
                  Jingyu Yang},
  title        = {Optimal subset-division based discrimination and its kernelization
                  for face and palmprint recognition},
  journal      = {Pattern Recognit.},
  volume       = {45},
  number       = {10},
  pages        = {3590--3602},
  year         = {2012},
  url          = {https://doi.org/10.1016/j.patcog.2012.04.001},
  doi          = {10.1016/J.PATCOG.2012.04.001},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/JingLZLY12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/JingLZYLLZ12,
  author       = {Xiao{-}Yuan Jing and
                  Chao Lan and
                  David Zhang and
                  Jing{-}Yu Yang and
                  Min Li and
                  Sheng Li and
                  Songhao Zhu},
  title        = {Face feature extraction and recognition based on discriminant subclass-center
                  manifold preserving projection},
  journal      = {Pattern Recognit. Lett.},
  volume       = {33},
  number       = {6},
  pages        = {709--717},
  year         = {2012},
  url          = {https://doi.org/10.1016/j.patrec.2012.01.001},
  doi          = {10.1016/J.PATREC.2012.01.001},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/prl/JingLZYLLZ12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sensors/Xie0YZQ12,
  author       = {Jin Xie and
                  Lei Zhang and
                  Jane You and
                  David Zhang and
                  Xiaofeng Qu},
  title        = {A Study of Hand Back Skin Texture Patterns for Personal Identification
                  and Gender Classification},
  journal      = {Sensors},
  volume       = {12},
  number       = {7},
  pages        = {8691--8709},
  year         = {2012},
  url          = {https://doi.org/10.3390/s120708691},
  doi          = {10.3390/S120708691},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/sensors/Xie0YZQ12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/JingLZYY12,
  author       = {Xiao{-}Yuan Jing and
                  Sheng Li and
                  David Zhang and
                  Jian Yang and
                  Jing{-}Yu Yang},
  title        = {Supervised and Unsupervised Parallel Subspace Learning for Large-Scale
                  Image Recognition},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {22},
  number       = {10},
  pages        = {1497--1511},
  year         = {2012},
  url          = {https://doi.org/10.1109/TCSVT.2012.2202079},
  doi          = {10.1109/TCSVT.2012.2202079},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcsv/JingLZYY12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tfs/HuPZZSGY12,
  author       = {Qinghua Hu and
                  Weiwei Pan and
                  Lei Zhang and
                  David Zhang and
                  Yanping Song and
                  Maozu Guo and
                  Daren Yu},
  title        = {Feature Selection for Monotonic Classification},
  journal      = {{IEEE} Trans. Fuzzy Syst.},
  volume       = {20},
  number       = {1},
  pages        = {69--81},
  year         = {2012},
  url          = {https://doi.org/10.1109/TFUZZ.2011.2167235},
  doi          = {10.1109/TFUZZ.2011.2167235},
  timestamp    = {Thu, 12 Nov 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tfs/HuPZZSGY12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tfs/HuZAZY12,
  author       = {Qinghua Hu and
                  Lei Zhang and
                  Shuang An and
                  David Zhang and
                  Daren Yu},
  title        = {On Robust Fuzzy Rough Set Models},
  journal      = {{IEEE} Trans. Fuzzy Syst.},
  volume       = {20},
  number       = {4},
  pages        = {636--651},
  year         = {2012},
  url          = {https://doi.org/10.1109/TFUZZ.2011.2181180},
  doi          = {10.1109/TFUZZ.2011.2181180},
  timestamp    = {Tue, 12 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tfs/HuZAZY12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/GuoZZL12,
  author       = {Zhenhua Guo and
                  David Zhang and
                  Lei Zhang and
                  Wenhuang Liu},
  title        = {Feature Band Selection for Online Multispectral Palmprint Recognition},
  journal      = {{IEEE} Trans. Inf. Forensics Secur.},
  volume       = {7},
  number       = {3},
  pages        = {1094--1099},
  year         = {2012},
  url          = {https://doi.org/10.1109/TIFS.2012.2189206},
  doi          = {10.1109/TIFS.2012.2189206},
  timestamp    = {Thu, 06 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tifs/GuoZZL12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/YangZSZ12,
  author       = {Meng Yang and
                  Lei Zhang and
                  Simon Chi{-}Keung Shiu and
                  David Zhang},
  title        = {Monogenic Binary Coding: An Efficient Local Feature Extraction Approach
                  to Face Recognition},
  journal      = {{IEEE} Trans. Inf. Forensics Secur.},
  volume       = {7},
  number       = {6},
  pages        = {1738--1751},
  year         = {2012},
  url          = {https://doi.org/10.1109/TIFS.2012.2217332},
  doi          = {10.1109/TIFS.2012.2217332},
  timestamp    = {Thu, 06 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tifs/YangZSZ12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/GongZSY12,
  author       = {Yazhuo Gong and
                  David Zhang and
                  Pengfei Shi and
                  Jingqi Yan},
  title        = {High-Speed Multispectral Iris Capture System Design},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {61},
  number       = {7},
  pages        = {1966--1978},
  year         = {2012},
  url          = {https://doi.org/10.1109/TIM.2012.2183036},
  doi          = {10.1109/TIM.2012.2183036},
  timestamp    = {Mon, 08 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tim/GongZSY12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/LianZZ12,
  author       = {Wei Lian and
                  Lei Zhang and
                  David Zhang},
  title        = {Rotation-Invariant Nonrigid Point Set Matching in Cluttered Scenes},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {21},
  number       = {5},
  pages        = {2786--2797},
  year         = {2012},
  url          = {https://doi.org/10.1109/TIP.2012.2186309},
  doi          = {10.1109/TIP.2012.2186309},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/LianZZ12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/LiuZZLZ12,
  author       = {Lei Liu and
                  Wangmeng Zuo and
                  David Zhang and
                  Naimin Li and
                  Hongzhi Zhang},
  title        = {Combination of Heterogeneous Features for Wrist Pulse Blood Flow Signal
                  Diagnosis via Multiple Kernel Learning},
  journal      = {{IEEE} Trans. Inf. Technol. Biomed.},
  volume       = {16},
  number       = {4},
  pages        = {598--606},
  year         = {2012},
  url          = {https://doi.org/10.1109/TITB.2012.2195188},
  doi          = {10.1109/TITB.2012.2195188},
  timestamp    = {Wed, 13 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/titb/LiuZZLZ12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tkde/HuCZZGY12,
  author       = {Qinghua Hu and
                  Xunjian Che and
                  Lei Zhang and
                  David Zhang and
                  Maozu Guo and
                  Daren Yu},
  title        = {Rank Entropy-Based Decision Trees for Monotonic Classification},
  journal      = {{IEEE} Trans. Knowl. Data Eng.},
  volume       = {24},
  number       = {11},
  pages        = {2052--2064},
  year         = {2012},
  url          = {https://doi.org/10.1109/TKDE.2011.149},
  doi          = {10.1109/TKDE.2011.149},
  timestamp    = {Thu, 12 Nov 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tkde/HuCZZGY12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/LiZLL12,
  author       = {Wei Li and
                  David Zhang and
                  Guangming Lu and
                  Nan Luo},
  title        = {A Novel 3-D Palmprint Acquisition System},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {A}},
  volume       = {42},
  number       = {2},
  pages        = {443--452},
  year         = {2012},
  url          = {https://doi.org/10.1109/TSMCA.2011.2164066},
  doi          = {10.1109/TSMCA.2011.2164066},
  timestamp    = {Mon, 25 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/LiZLL12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmei/WangZZZ12,
  author       = {Peng Wang and
                  Wangmeng Zuo and
                  Hongzhi Zhang and
                  David Zhang},
  editor       = {Tianqi Zhang},
  title        = {Design and implementation of a multi-channel pulse signal acquisition
                  system},
  booktitle    = {5th International Conference on BioMedical Engineering and Informatics,
                  {BMEI} 2012, Chongqing, China, October 16-18, 2012},
  pages        = {1063--1067},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://doi.org/10.1109/BMEI.2012.6512884},
  doi          = {10.1109/BMEI.2012.6512884},
  timestamp    = {Tue, 17 Nov 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/bmei/WangZZZ12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ccpr/RenZZZZ12,
  author       = {Dongwei Ren and
                  Wangmeng Zuo and
                  Xiaofei Zhao and
                  Hongzhi Zhang and
                  David Zhang},
  editor       = {Cheng{-}Lin Liu and
                  Changshui Zhang and
                  Liang Wang},
  title        = {An Algorithm Based on Augmented Lagrangian Method for Generalized
                  Gradient Vector Flow Computation},
  booktitle    = {Pattern Recognition - Chinese Conference, {CCPR} 2012, Beijing, China,
                  September 24-26, 2012. Proceedings},
  series       = {Communications in Computer and Information Science},
  volume       = {321},
  pages        = {170--177},
  publisher    = {Springer},
  year         = {2012},
  url          = {https://doi.org/10.1007/978-3-642-33506-8\_22},
  doi          = {10.1007/978-3-642-33506-8\_22},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ccpr/RenZZZZ12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cloud/DasBSGVNZGWGSTPSS12,
  author       = {Shirshanka Das and
                  Chavdar Botev and
                  Kapil Surlaker and
                  Bhaskar Ghosh and
                  Balaji Varadarajan and
                  Sunil Nagaraj and
                  David Zhang and
                  Lei Gao and
                  Jemiah Westerman and
                  Phanindra Ganti and
                  Boris Shkolnik and
                  Sajid Topiwala and
                  Alexander Pachev and
                  Naveen Somasundaram and
                  Subbu Subramaniam},
  editor       = {Michael J. Carey and
                  Steven Hand},
  title        = {All aboard the Databus!: Linkedin's scalable consistent change data
                  capture platform},
  booktitle    = {{ACM} Symposium on Cloud Computing, {SOCC} '12, San Jose, CA, USA,
                  October 14-17, 2012},
  pages        = {18},
  publisher    = {{ACM}},
  year         = {2012},
  url          = {https://doi.org/10.1145/2391229.2391247},
  doi          = {10.1145/2391229.2391247},
  timestamp    = {Mon, 20 Feb 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cloud/DasBSGVNZGWGSTPSS12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/YangZZW12,
  author       = {Meng Yang and
                  Lei Zhang and
                  David Zhang and
                  Shenlong Wang},
  title        = {Relaxed collaborative representation for pattern classification},
  booktitle    = {2012 {IEEE} Conference on Computer Vision and Pattern Recognition,
                  Providence, RI, USA, June 16-21, 2012},
  pages        = {2224--2231},
  publisher    = {{IEEE} Computer Society},
  year         = {2012},
  url          = {https://doi.org/10.1109/CVPR.2012.6247931},
  doi          = {10.1109/CVPR.2012.6247931},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/YangZZW12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/YangZZ12,
  author       = {Meng Yang and
                  Lei Zhang and
                  David Zhang},
  editor       = {Andrew W. Fitzgibbon and
                  Svetlana Lazebnik and
                  Pietro Perona and
                  Yoichi Sato and
                  Cordelia Schmid},
  title        = {Efficient Misalignment-Robust Representation for Real-Time Face Recognition},
  booktitle    = {Computer Vision - {ECCV} 2012 - 12th European Conference on Computer
                  Vision, Florence, Italy, October 7-13, 2012, Proceedings, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {7572},
  pages        = {850--863},
  publisher    = {Springer},
  year         = {2012},
  url          = {https://doi.org/10.1007/978-3-642-33718-5\_61},
  doi          = {10.1007/978-3-642-33718-5\_61},
  timestamp    = {Thu, 27 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/eccv/YangZZ12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icch/YanZ12,
  author       = {Ke Yan and
                  David Zhang},
  title        = {A novel breath analysis system for diabetes diagnosis},
  booktitle    = {International Conference on Computerized Healthcare, {ICCH} 2012,
                  Hong Kong, China, December 17-18, 2012},
  pages        = {166--170},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://doi.org/10.1109/ICCH.2012.6724490},
  doi          = {10.1109/ICCH.2012.6724490},
  timestamp    = {Wed, 16 Oct 2019 14:14:48 +0200},
  biburl       = {https://dblp.org/rec/conf/icch/YanZ12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icch/WangZ12,
  author       = {Dimin Wang and
                  David Zhang},
  title        = {Analysis of pulse waveforms preprocessing},
  booktitle    = {International Conference on Computerized Healthcare, {ICCH} 2012,
                  Hong Kong, China, December 17-18, 2012},
  pages        = {175--180},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://doi.org/10.1109/ICCH.2012.6724492},
  doi          = {10.1109/ICCH.2012.6724492},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icch/WangZ12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icde/AuradkarBDMFGGGGHKKKLNNPPQQRSSSSSSSSTTVWWZZ12,
  author       = {Aditya Auradkar and
                  Chavdar Botev and
                  Shirshanka Das and
                  Dave De Maagd and
                  Alex Feinberg and
                  Phanindra Ganti and
                  Lei Gao and
                  Bhaskar Ghosh and
                  Kishore Gopalakrishna and
                  Brendan Harris and
                  Joel Koshy and
                  Kevin Krawez and
                  Jay Kreps and
                  Shi Lu and
                  Sunil Nagaraj and
                  Neha Narkhede and
                  Sasha Pachev and
                  Igor Perisic and
                  Lin Qiao and
                  Tom Quiggle and
                  Jun Rao and
                  Bob Schulman and
                  Abraham Sebastian and
                  Oliver Seeliger and
                  Adam Silberstein and
                  Boris Shkolnik and
                  Chinmay Soman and
                  Roshan Sumbaly and
                  Kapil Surlaker and
                  Sajid Topiwala and
                  Cuong Tran and
                  Balaji Varadarajan and
                  Jemiah Westerman and
                  Zach White and
                  David Zhang and
                  Jason Zhang},
  editor       = {Anastasios Kementsietsidis and
                  Marcos Antonio Vaz Salles},
  title        = {Data Infrastructure at LinkedIn},
  booktitle    = {{IEEE} 28th International Conference on Data Engineering {(ICDE} 2012),
                  Washington, DC, {USA} (Arlington, Virginia), 1-5 April, 2012},
  pages        = {1370--1381},
  publisher    = {{IEEE} Computer Society},
  year         = {2012},
  url          = {https://doi.org/10.1109/ICDE.2012.147},
  doi          = {10.1109/ICDE.2012.147},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icde/AuradkarBDMFGGGGHKKKLNNPPQQRSSSSSSSSTTVWWZZ12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/ZhangZMZ12,
  author       = {Lin Zhang and
                  Lei Zhang and
                  Xuanqin Mou and
                  David Zhang},
  title        = {A comprehensive evaluation of full reference image quality assessment
                  algorithms},
  booktitle    = {19th {IEEE} International Conference on Image Processing, {ICIP} 2012,
                  Lake Buena Vista, Orlando, FL, USA, September 30 - October 3, 2012},
  pages        = {1477--1480},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://doi.org/10.1109/ICIP.2012.6467150},
  doi          = {10.1109/ICIP.2012.6467150},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/icip/ZhangZMZ12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip12/ZhangL12,
  author       = {David Dapeng Zhang and
                  Xi Liu},
  editor       = {Zhongzhi Shi and
                  David B. Leake and
                  Sunil Vadera},
  title        = {Ensemble of k-Labelset Classifiers for Multi-label Image Classification},
  booktitle    = {Intelligent Information Processing {VI} - 7th {IFIP} {TC} 12 International
                  Conference, {IIP} 2012, Guilin, China, October 12-15, 2012. Proceedings},
  series       = {{IFIP} Advances in Information and Communication Technology},
  volume       = {385},
  pages        = {364--371},
  publisher    = {Springer},
  year         = {2012},
  url          = {https://doi.org/10.1007/978-3-642-32891-6\_45},
  doi          = {10.1007/978-3-642-32891-6\_45},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/ifip12/ZhangL12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscide/LiuLZZZ12,
  author       = {Lei Liu and
                  Naimin Li and
                  Wangmeng Zuo and
                  David Zhang and
                  Hongzhi Zhang},
  editor       = {Jian Yang and
                  Fang Fang and
                  Changyin Sun},
  title        = {Multiscale Sample Entropy Analysis of Wrist Pulse Blood Flow Signal
                  for Disease Diagnosis},
  booktitle    = {Intelligent Science and Intelligent Data Engineering - Third Sino-foreign-interchange
                  Workshop, IScIDE 2012, Nanjing, China, October 15-17, 2012. Revised
                  Selected Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {7751},
  pages        = {475--482},
  publisher    = {Springer},
  year         = {2012},
  url          = {https://doi.org/10.1007/978-3-642-36669-7\_58},
  doi          = {10.1007/978-3-642-36669-7\_58},
  timestamp    = {Tue, 14 May 2019 10:00:39 +0200},
  biburl       = {https://dblp.org/rec/conf/iscide/LiuLZZZ12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1202-4207,
  author       = {Meng Yang and
                  Lei Zhang and
                  Jian Yang and
                  David Zhang},
  title        = {Regularized Robust Coding for Face Recognition},
  journal      = {CoRR},
  volume       = {abs/1202.4207},
  year         = {2012},
  url          = {http://arxiv.org/abs/1202.4207},
  eprinttype    = {arXiv},
  eprint       = {1202.4207},
  timestamp    = {Wed, 15 Jan 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1202-4207.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1204-2358,
  author       = {Lei Zhang and
                  Meng Yang and
                  Xiangchu Feng and
                  Yi Ma and
                  David Zhang},
  title        = {Collaborative Representation based Classification for Face Recognition},
  journal      = {CoRR},
  volume       = {abs/1204.2358},
  year         = {2012},
  url          = {http://arxiv.org/abs/1204.2358},
  eprinttype    = {arXiv},
  eprint       = {1204.2358},
  timestamp    = {Wed, 15 Jan 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1204-2358.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/asc/LiZXL11,
  author       = {Zuoyong Li and
                  David Zhang and
                  Yong Xu and
                  Chuancai Liu},
  title        = {Modified local entropy-based transition region extraction and thresholding},
  journal      = {Appl. Soft Comput.},
  volume       = {11},
  number       = {8},
  pages        = {5630--5638},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.asoc.2011.04.001},
  doi          = {10.1016/J.ASOC.2011.04.001},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/asc/LiZXL11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/ZhangGLZLZ11,
  author       = {David Zhang and
                  Zhenhua Guo and
                  Guangming Lu and
                  Lei Zhang and
                  Yahui Liu and
                  Wangmeng Zuo},
  title        = {Online joint palmprint and palmvein verification},
  journal      = {Expert Syst. Appl.},
  volume       = {38},
  number       = {3},
  pages        = {2621--2631},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.eswa.2010.08.052},
  doi          = {10.1016/J.ESWA.2010.08.052},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/eswa/ZhangGLZLZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/HuZZPAP11,
  author       = {Qinghua Hu and
                  Lei Zhang and
                  David Zhang and
                  Wei Pan and
                  Shuang An and
                  Witold Pedrycz},
  title        = {Measuring relevance between discrete and continuous features based
                  on neighborhood mutual information},
  journal      = {Expert Syst. Appl.},
  volume       = {38},
  number       = {9},
  pages        = {10737--10750},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.eswa.2011.01.023},
  doi          = {10.1016/J.ESWA.2011.01.023},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/eswa/HuZZPAP11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijitdm/YongZYZY11,
  author       = {Xu Yong and
                  David Zhang and
                  Jian Yang and
                  Jin Zhong and
                  Jingyu Yang},
  title        = {Evaluate Dissimilarity of Samples in Feature Space for Improving {KPCA}},
  journal      = {Int. J. Inf. Technol. Decis. Mak.},
  volume       = {10},
  number       = {3},
  pages        = {479--495},
  year         = {2011},
  url          = {https://doi.org/10.1142/S0219622011004415},
  doi          = {10.1142/S0219622011004415},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijitdm/YongZYZY11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/XuZZ11,
  author       = {Yong Xu and
                  Qi Zhu and
                  David Zhang},
  title        = {Combine crossing matching scores with conventional matching scores
                  for bimodal biometrics and face and palmprint recognition experiments},
  journal      = {Neurocomputing},
  volume       = {74},
  number       = {18},
  pages        = {3946--3952},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.neucom.2011.08.011},
  doi          = {10.1016/J.NEUCOM.2011.08.011},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/XuZZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/ChenZZZ11,
  author       = {Yinghui Chen and
                  Lei Zhang and
                  David Zhang and
                  Dongyu Zhang},
  title        = {Computerized Wrist Pulse Signal Diagnosis Using Modified Auto-Regressive
                  Models},
  journal      = {J. Medical Syst.},
  volume       = {35},
  number       = {3},
  pages        = {321--328},
  year         = {2011},
  url          = {https://doi.org/10.1007/s10916-009-9368-4},
  doi          = {10.1007/S10916-009-9368-4},
  timestamp    = {Mon, 08 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jms/ChenZZZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/nca/XuZ11,
  author       = {Yong Xu and
                  David Zhang},
  title        = {Accelerating the kernel-method-based feature extraction procedure
                  from the viewpoint of numerical approximation},
  journal      = {Neural Comput. Appl.},
  volume       = {20},
  number       = {7},
  pages        = {1087--1096},
  year         = {2011},
  url          = {https://doi.org/10.1007/s00521-011-0534-5},
  doi          = {10.1007/S00521-011-0534-5},
  timestamp    = {Thu, 10 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/nca/XuZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/XiaoZZS11,
  author       = {Rui Xiao and
                  Qijun Zhao and
                  David Zhang and
                  Pengfei Shi},
  title        = {Facial expression recognition on multiple manifolds},
  journal      = {Pattern Recognit.},
  volume       = {44},
  number       = {1},
  pages        = {107--116},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.patcog.2010.07.017},
  doi          = {10.1016/J.PATCOG.2010.07.017},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/XiaoZZS11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ZhangZC11,
  author       = {David Zhang and
                  Qijun Zhao and
                  Fangmei Chen},
  title        = {Quantitative analysis of human facial beauty using geometric features},
  journal      = {Pattern Recognit.},
  volume       = {44},
  number       = {4},
  pages        = {940--950},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.patcog.2010.10.013},
  doi          = {10.1016/J.PATCOG.2010.10.013},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/ZhangZC11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ZuoYZ11,
  author       = {Wangmeng Zuo and
                  Feng Yue and
                  David Zhang},
  title        = {On accurate orientation extraction and appropriate distance measure
                  for low-resolution palmprint recognition},
  journal      = {Pattern Recognit.},
  volume       = {44},
  number       = {4},
  pages        = {964--972},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.patcog.2010.09.017},
  doi          = {10.1016/J.PATCOG.2010.09.017},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/ZuoYZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/YangZYZ11,
  author       = {Jian Yang and
                  Lei Zhang and
                  Jing{-}Yu Yang and
                  David Zhang},
  title        = {From classifiers to discriminators: {A} nearest neighbor rule induced
                  discriminant analysis},
  journal      = {Pattern Recognit.},
  volume       = {44},
  number       = {7},
  pages        = {1387--1402},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.patcog.2011.01.009},
  doi          = {10.1016/J.PATCOG.2011.01.009},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/YangZYZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/LiuZZ11,
  author       = {Feng Liu and
                  Qijun Zhao and
                  David Zhang},
  title        = {A novel hierarchical fingerprint matching approach},
  journal      = {Pattern Recognit.},
  volume       = {44},
  number       = {8},
  pages        = {1604--1613},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.patcog.2011.02.010},
  doi          = {10.1016/J.PATCOG.2011.02.010},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/LiuZZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ZhangZZZ11,
  author       = {Lin Zhang and
                  Lei Zhang and
                  David Zhang and
                  Hailong Zhu},
  title        = {Ensemble of local and global information for finger-knuckle-print
                  recognition},
  journal      = {Pattern Recognit.},
  volume       = {44},
  number       = {9},
  pages        = {1990--1998},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.patcog.2010.06.007},
  doi          = {10.1016/J.PATCOG.2010.06.007},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/ZhangZZZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/PengZZY11,
  author       = {Bo Peng and
                  Lei Zhang and
                  David Zhang and
                  Jian Yang},
  title        = {Image segmentation by iterated region merging with localized graph
                  cuts},
  journal      = {Pattern Recognit.},
  volume       = {44},
  number       = {10-11},
  pages        = {2527--2538},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.patcog.2011.03.024},
  doi          = {10.1016/J.PATCOG.2011.03.024},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/PengZZY11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/GuoZZZL11,
  author       = {Zhenhua Guo and
                  David Zhang and
                  Lei Zhang and
                  Wangmeng Zuo and
                  Guangming Lu},
  title        = {Empirical study of light source selection for palmprint recognition},
  journal      = {Pattern Recognit. Lett.},
  volume       = {32},
  number       = {2},
  pages        = {120--126},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.patrec.2010.09.026},
  doi          = {10.1016/J.PATREC.2010.09.026},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/prl/GuoZZZL11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/YueZZL11,
  author       = {Feng Yue and
                  Wangmeng Zuo and
                  David Zhang and
                  Bin Li},
  title        = {Fast palmprint identification with multiple templates per subject},
  journal      = {Pattern Recognit. Lett.},
  volume       = {32},
  number       = {8},
  pages        = {1108--1118},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.patrec.2011.02.019},
  doi          = {10.1016/J.PATREC.2011.02.019},
  timestamp    = {Tue, 25 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/prl/YueZZL11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigpro/JingLLZYL11,
  author       = {Xiao{-}Yuan Jing and
                  Sheng Li and
                  Chao Lan and
                  David Zhang and
                  Jingyu Yang and
                  Qian Liu},
  title        = {Color image canonical correlation analysis for face feature extraction
                  and recognition},
  journal      = {Signal Process.},
  volume       = {91},
  number       = {8},
  pages        = {2132--2140},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.sigpro.2011.02.016},
  doi          = {10.1016/J.SIGPRO.2011.02.016},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sigpro/JingLLZYL11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/XuZYY11,
  author       = {Yong Xu and
                  David Zhang and
                  Jian Yang and
                  Jing{-}Yu Yang},
  title        = {A Two-Phase Test Sample Sparse Representation Method for Use With
                  Face Recognition},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {21},
  number       = {9},
  pages        = {1255--1262},
  year         = {2011},
  url          = {https://doi.org/10.1109/TCSVT.2011.2138790},
  doi          = {10.1109/TCSVT.2011.2138790},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcsv/XuZYY11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/KanhangadKZ11,
  author       = {Vivek Kanhangad and
                  Ajay Kumar and
                  David Zhang},
  title        = {A Unified Framework for Contactless Hand Verification},
  journal      = {{IEEE} Trans. Inf. Forensics Secur.},
  volume       = {6},
  number       = {3-2},
  pages        = {1014--1027},
  year         = {2011},
  url          = {https://doi.org/10.1109/TIFS.2011.2121062},
  doi          = {10.1109/TIFS.2011.2121062},
  timestamp    = {Thu, 06 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tifs/KanhangadKZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/ZhangLZLL11,
  author       = {David Zhang and
                  Feng Liu and
                  Qijun Zhao and
                  Guangming Lu and
                  Nan Luo},
  title        = {Selecting a Reference High Resolution for Fingerprint Recognition
                  Using Minutiae and Pores},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {60},
  number       = {3},
  pages        = {863--871},
  year         = {2011},
  url          = {https://doi.org/10.1109/TIM.2010.2062610},
  doi          = {10.1109/TIM.2010.2062610},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tim/ZhangLZLL11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/KanhangadKZ11,
  author       = {Vivek Kanhangad and
                  Ajay Kumar and
                  David Zhang},
  title        = {Contactless and Pose Invariant Biometric Identification Using Hand
                  Surface},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {20},
  number       = {5},
  pages        = {1415--1424},
  year         = {2011},
  url          = {https://doi.org/10.1109/TIP.2010.2090888},
  doi          = {10.1109/TIP.2010.2090888},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/KanhangadKZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/ZhangZMZ11,
  author       = {Lin Zhang and
                  Lei Zhang and
                  Xuanqin Mou and
                  David Zhang},
  title        = {{FSIM:} {A} Feature Similarity Index for Image Quality Assessment},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {20},
  number       = {8},
  pages        = {2378--2386},
  year         = {2011},
  url          = {https://doi.org/10.1109/TIP.2011.2109730},
  doi          = {10.1109/TIP.2011.2109730},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/ZhangZMZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/PengZZ11,
  author       = {Bo Peng and
                  Lei Zhang and
                  David Zhang},
  title        = {Automatic Image Segmentation by Dynamic Region Merging},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {20},
  number       = {12},
  pages        = {3592--3605},
  year         = {2011},
  url          = {https://doi.org/10.1109/TIP.2011.2157512},
  doi          = {10.1109/TIP.2011.2157512},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/PengZZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/FanXZ11,
  author       = {Zizhu Fan and
                  Yong Xu and
                  David Dapeng Zhang},
  title        = {Local Linear Discriminant Analysis Framework Using Sample Neighbors},
  journal      = {{IEEE} Trans. Neural Networks},
  volume       = {22},
  number       = {7},
  pages        = {1119--1132},
  year         = {2011},
  url          = {https://doi.org/10.1109/TNN.2011.2152852},
  doi          = {10.1109/TNN.2011.2152852},
  timestamp    = {Tue, 13 Sep 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tnn/FanXZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/LiZZLY11,
  author       = {Wei Li and
                  David Zhang and
                  Lei Zhang and
                  Guangming Lu and
                  Jingqi Yan},
  title        = {3-D Palmprint Recognition With Joint Line and Orientation Features},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {C}},
  volume       = {41},
  number       = {2},
  pages        = {274--279},
  year         = {2011},
  url          = {https://doi.org/10.1109/TSMCC.2010.2055849},
  doi          = {10.1109/TSMCC.2010.2055849},
  timestamp    = {Thu, 21 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/LiZZLY11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acpr/SunZY11,
  author       = {Mingming Sun and
                  David Zhang and
                  Jingyu Yang},
  title        = {Face attractiveness improvement using beauty prototypes and decision},
  booktitle    = {First Asian Conference on Pattern Recognition, {ACPR} 2011, Beijing,
                  China, 28-28 November, 2011},
  pages        = {283--287},
  publisher    = {{IEEE}},
  year         = {2011},
  url          = {https://doi.org/10.1109/ACPR.2011.6166544},
  doi          = {10.1109/ACPR.2011.6166544},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/acpr/SunZY11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acpr/YanCZ11,
  author       = {Ke Yan and
                  Youbin Chen and
                  David Zhang},
  title        = {Gabor Surface Feature for face recognition},
  booktitle    = {First Asian Conference on Pattern Recognition, {ACPR} 2011, Beijing,
                  China, 28-28 November, 2011},
  pages        = {288--292},
  publisher    = {{IEEE}},
  year         = {2011},
  url          = {https://doi.org/10.1109/ACPR.2011.6166553},
  doi          = {10.1109/ACPR.2011.6166553},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/acpr/YanCZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acpr/JingLLYZY11,
  author       = {Xiao{-}Yuan Jing and
                  Chao Lan and
                  Min Li and
                  Yong{-}Fang Yao and
                  David Zhang and
                  Jingyu Yang},
  title        = {Class-imbalance learning based discriminant analysis},
  booktitle    = {First Asian Conference on Pattern Recognition, {ACPR} 2011, Beijing,
                  China, 28-28 November, 2011},
  pages        = {545--549},
  publisher    = {{IEEE}},
  year         = {2011},
  url          = {https://doi.org/10.1109/ACPR.2011.6166659},
  doi          = {10.1109/ACPR.2011.6166659},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/acpr/JingLLYZY11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/YangZYZ11,
  author       = {Meng Yang and
                  Lei Zhang and
                  Jian Yang and
                  David Zhang},
  title        = {Robust sparse coding for face recognition},
  booktitle    = {The 24th {IEEE} Conference on Computer Vision and Pattern Recognition,
                  {CVPR} 2011, Colorado Springs, CO, USA, 20-25 June 2011},
  pages        = {625--632},
  publisher    = {{IEEE} Computer Society},
  year         = {2011},
  url          = {https://doi.org/10.1109/CVPR.2011.5995393},
  doi          = {10.1109/CVPR.2011.5995393},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/YangZYZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/YangZFZ11,
  author       = {Meng Yang and
                  Lei Zhang and
                  Xiangchu Feng and
                  David Zhang},
  editor       = {Dimitris N. Metaxas and
                  Long Quan and
                  Alberto Sanfeliu and
                  Luc Van Gool},
  title        = {Fisher Discrimination Dictionary Learning for sparse representation},
  booktitle    = {{IEEE} International Conference on Computer Vision, {ICCV} 2011, Barcelona,
                  Spain, November 6-13, 2011},
  pages        = {543--550},
  publisher    = {{IEEE} Computer Society},
  year         = {2011},
  url          = {https://doi.org/10.1109/ICCV.2011.6126286},
  doi          = {10.1109/ICCV.2011.6126286},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iccv/YangZFZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/ZhangZHZ11,
  author       = {Lei Zhang and
                  Pengfei Zhu and
                  Qinghua Hu and
                  David Zhang},
  editor       = {Dimitris N. Metaxas and
                  Long Quan and
                  Alberto Sanfeliu and
                  Luc Van Gool},
  title        = {A linear subspace learning approach via sparse coding},
  booktitle    = {{IEEE} International Conference on Computer Vision, {ICCV} 2011, Barcelona,
                  Spain, November 6-13, 2011},
  pages        = {755--761},
  publisher    = {{IEEE} Computer Society},
  year         = {2011},
  url          = {https://doi.org/10.1109/ICCV.2011.6126313},
  doi          = {10.1109/ICCV.2011.6126313},
  timestamp    = {Mon, 04 Dec 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iccv/ZhangZHZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icic/YangZLLZ11,
  author       = {Shixin Yang and
                  Wangmeng Zuo and
                  Lei Liu and
                  Yanlai Li and
                  David Zhang},
  editor       = {De{-}Shuang Huang and
                  Yong Gan and
                  Vitoantonio Bevilacqua and
                  Juan Carlos Figueroa Garc{\'{\i}}a},
  title        = {Adaptive Weighted Fusion of Local Kernel Classifiers for Effective
                  Pattern Classification},
  booktitle    = {Advanced Intelligent Computing - 7th International Conference, {ICIC}
                  2011, Zhengzhou, China, August 11-14, 2011. Revised Selected Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {6838},
  pages        = {63--70},
  publisher    = {Springer},
  year         = {2011},
  url          = {https://doi.org/10.1007/978-3-642-24728-6\_9},
  doi          = {10.1007/978-3-642-24728-6\_9},
  timestamp    = {Tue, 14 May 2019 10:00:53 +0200},
  biburl       = {https://dblp.org/rec/conf/icic/YangZLLZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/LuZZZ11,
  author       = {Jianfeng Lu and
                  Wangmeng Zuo and
                  Xiaofei Zhao and
                  David Zhang},
  editor       = {Beno{\^{\i}}t Macq and
                  Peter Schelkens},
  title        = {An augmented Lagrangian method for fast gradient vector flow computation},
  booktitle    = {18th {IEEE} International Conference on Image Processing, {ICIP} 2011,
                  Brussels, Belgium, September 11-14, 2011},
  pages        = {1525--1528},
  publisher    = {{IEEE}},
  year         = {2011},
  url          = {https://doi.org/10.1109/ICIP.2011.6115735},
  doi          = {10.1109/ICIP.2011.6115735},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/icip/LuZZZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/ManJZL11,
  author       = {Jiang{-}Yue Man and
                  Xiao{-}Yuan Jing and
                  David Zhang and
                  Chao Lan},
  editor       = {Beno{\^{\i}}t Macq and
                  Peter Schelkens},
  title        = {Sparse cost-sensitive classifier with application to face recognition},
  booktitle    = {18th {IEEE} International Conference on Image Processing, {ICIP} 2011,
                  Brussels, Belgium, September 11-14, 2011},
  pages        = {1773--1776},
  publisher    = {{IEEE}},
  year         = {2011},
  url          = {https://doi.org/10.1109/ICIP.2011.6115804},
  doi          = {10.1109/ICIP.2011.6115804},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icip/ManJZL11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/LiJZYB11,
  author       = {Sheng Li and
                  Xiao{-}Yuan Jing and
                  David Zhang and
                  Yong{-}Fang Yao and
                  Lu{-}Sha Bian},
  editor       = {Beno{\^{\i}}t Macq and
                  Peter Schelkens},
  title        = {A novel kernel discriminant feature extraction framework based on
                  mapped virtual samples for face recognition},
  booktitle    = {18th {IEEE} International Conference on Image Processing, {ICIP} 2011,
                  Brussels, Belgium, September 11-14, 2011},
  pages        = {3005--3008},
  publisher    = {{IEEE}},
  year         = {2011},
  url          = {https://doi.org/10.1109/ICIP.2011.6116295},
  doi          = {10.1109/ICIP.2011.6116295},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icip/LiJZYB11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/LanJZGY11,
  author       = {Chao Lan and
                  Xiao{-}Yuan Jing and
                  David Zhang and
                  Shi{-}Qiang Gao and
                  Jingyu Yang},
  editor       = {Beno{\^{\i}}t Macq and
                  Peter Schelkens},
  title        = {Discriminant subclass-center manifold preserving projection for face
                  feature extraction},
  booktitle    = {18th {IEEE} International Conference on Image Processing, {ICIP} 2011,
                  Brussels, Belgium, September 11-14, 2011},
  pages        = {3013--3016},
  publisher    = {{IEEE}},
  year         = {2011},
  url          = {https://doi.org/10.1109/ICIP.2011.6116297},
  doi          = {10.1109/ICIP.2011.6116297},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icip/LanJZGY11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/JingLZY11,
  author       = {Xiao{-}Yuan Jing and
                  Sheng Li and
                  David Zhang and
                  Jingyu Yang},
  editor       = {Beno{\^{\i}}t Macq and
                  Peter Schelkens},
  title        = {Face recognition based on local uncorrelated and weighted global uncorrelated
                  discriminant transforms},
  booktitle    = {18th {IEEE} International Conference on Image Processing, {ICIP} 2011,
                  Brussels, Belgium, September 11-14, 2011},
  pages        = {3049--3052},
  publisher    = {{IEEE}},
  year         = {2011},
  url          = {https://doi.org/10.1109/ICIP.2011.6116307},
  doi          = {10.1109/ICIP.2011.6116307},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icip/JingLZY11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/crypt/ZhangK11,
  author       = {David Zhang and
                  Vivek Kanhangad},
  editor       = {Henk C. A. van Tilborg and
                  Sushil Jajodia},
  title        = {Hand Geometry Recognition},
  booktitle    = {Encyclopedia of Cryptography and Security, 2nd Ed},
  pages        = {529--531},
  publisher    = {Springer},
  year         = {2011},
  url          = {https://doi.org/10.1007/978-1-4419-5906-5\_878},
  doi          = {10.1007/978-1-4419-5906-5\_878},
  timestamp    = {Mon, 18 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/reference/crypt/ZhangK11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/crypt/ZhangYZ11,
  author       = {David Zhang and
                  Feng Yue and
                  Wangmeng Zuo},
  editor       = {Henk C. A. van Tilborg and
                  Sushil Jajodia},
  title        = {Palmprint Recognition},
  booktitle    = {Encyclopedia of Cryptography and Security, 2nd Ed},
  pages        = {909--913},
  publisher    = {Springer},
  year         = {2011},
  url          = {https://doi.org/10.1007/978-1-4419-5906-5\_744},
  doi          = {10.1007/978-1-4419-5906-5\_744},
  timestamp    = {Sat, 16 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/reference/crypt/ZhangYZ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1112-1496,
  author       = {Kaihua Zhang and
                  Lei Zhang and
                  Huihui Song and
                  David Zhang},
  title        = {Re-initialization Free Level Set Evolution via Reaction Diffusion},
  journal      = {CoRR},
  volume       = {abs/1112.1496},
  year         = {2011},
  url          = {http://arxiv.org/abs/1112.1496},
  eprinttype    = {arXiv},
  eprint       = {1112.1496},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1112-1496.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chinaf/LiuZL10,
  author       = {Zhiyong Liu and
                  David Zhang and
                  Yugang Li},
  title        = {Fast and convergence-guaranteed algorithm for linear separation},
  journal      = {Sci. China Inf. Sci.},
  volume       = {53},
  number       = {4},
  pages        = {729--737},
  year         = {2010},
  url          = {https://doi.org/10.1007/s11432-010-0037-5},
  doi          = {10.1007/S11432-010-0037-5},
  timestamp    = {Mon, 02 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/chinaf/LiuZL10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejasp/ZhangZZZL10,
  author       = {Dongyu Zhang and
                  Wangmeng Zuo and
                  David Zhang and
                  Hongzhi Zhang and
                  Naimin Li},
  title        = {Classification of Pulse Waveforms Using Edit Distance with Real Penalty},
  journal      = {{EURASIP} J. Adv. Signal Process.},
  volume       = {2010},
  year         = {2010},
  url          = {https://doi.org/10.1155/2010/303140},
  doi          = {10.1155/2010/303140},
  timestamp    = {Thu, 12 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ejasp/ZhangZZZL10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/GuoZZZ10,
  author       = {Zhenhua Guo and
                  Wangmeng Zuo and
                  Lei Zhang and
                  David Zhang},
  title        = {A unified distance measurement for orientation coding in palmprint
                  verification},
  journal      = {Neurocomputing},
  volume       = {73},
  number       = {4-6},
  pages        = {944--950},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.neucom.2009.09.009},
  doi          = {10.1016/J.NEUCOM.2009.09.009},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/GuoZZZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/WangXZY10,
  author       = {Jinghua Wang and
                  Yong Xu and
                  David Zhang and
                  Jane You},
  title        = {An efficient method for computing orthogonal discriminant vectors},
  journal      = {Neurocomputing},
  volume       = {73},
  number       = {10-12},
  pages        = {2168--2176},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.neucom.2010.02.009},
  doi          = {10.1016/J.NEUCOM.2010.02.009},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/WangXZY10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/HuangWZL10,
  author       = {Bo Huang and
                  Jinsong Wu and
                  David Zhang and
                  Naimin Li},
  title        = {Tongue shape classification by geometric features},
  journal      = {Inf. Sci.},
  volume       = {180},
  number       = {2},
  pages        = {312--324},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.ins.2009.09.016},
  doi          = {10.1016/J.INS.2009.09.016},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/isci/HuangWZL10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ZhangKLK10,
  author       = {David Zhang and
                  Vivek Kanhangad and
                  Nan Luo and
                  Ajay Kumar},
  title        = {Robust palmprint verification using 2D and 3D features},
  journal      = {Pattern Recognit.},
  volume       = {43},
  number       = {1},
  pages        = {358--368},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.patcog.2009.04.026},
  doi          = {10.1016/J.PATCOG.2009.04.026},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/ZhangKLK10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/NingZZW10,
  author       = {Jifeng Ning and
                  Lei Zhang and
                  David Zhang and
                  Chengke Wu},
  title        = {Interactive image segmentation by maximal similarity based region
                  merging},
  journal      = {Pattern Recognit.},
  volume       = {43},
  number       = {2},
  pages        = {445--456},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.patcog.2009.03.004},
  doi          = {10.1016/J.PATCOG.2009.03.004},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/NingZZW10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/GuoZZ10,
  author       = {Zhenhua Guo and
                  Lei Zhang and
                  David Zhang},
  title        = {Rotation invariant texture classification using {LBP} variance {(LBPV)}
                  with global matching},
  journal      = {Pattern Recognit.},
  volume       = {43},
  number       = {3},
  pages        = {706--719},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.patcog.2009.08.017},
  doi          = {10.1016/J.PATCOG.2009.08.017},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/GuoZZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ZhaoZZL10,
  author       = {Qijun Zhao and
                  David Zhang and
                  Lei Zhang and
                  Nan Luo},
  title        = {High resolution partial fingerprint alignment using pore-valley descriptors},
  journal      = {Pattern Recognit.},
  volume       = {43},
  number       = {3},
  pages        = {1050--1061},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.patcog.2009.08.004},
  doi          = {10.1016/J.PATCOG.2009.08.004},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/ZhaoZZL10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ZhangLY10,
  author       = {David Zhang and
                  Zhi Liu and
                  Jingqi Yan},
  title        = {Dynamic tongueprint: {A} novel biometric identifier},
  journal      = {Pattern Recognit.},
  volume       = {43},
  number       = {3},
  pages        = {1071--1082},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.patcog.2009.09.002},
  doi          = {10.1016/J.PATCOG.2009.09.002},
  timestamp    = {Mon, 22 Jan 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/ZhangLY10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/XuZY10,
  author       = {Yong Xu and
                  David Zhang and
                  Jing{-}Yu Yang},
  title        = {A feature extraction method for use with bimodal biometrics},
  journal      = {Pattern Recognit.},
  volume       = {43},
  number       = {3},
  pages        = {1106--1115},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.patcog.2009.09.013},
  doi          = {10.1016/J.PATCOG.2009.09.013},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/XuZY10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ZhangDZS10,
  author       = {Lei Zhang and
                  Weisheng Dong and
                  David Zhang and
                  Guangming Shi},
  title        = {Two-stage image denoising by principal component analysis with local
                  pixel grouping},
  journal      = {Pattern Recognit.},
  volume       = {43},
  number       = {4},
  pages        = {1531--1549},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.patcog.2009.09.023},
  doi          = {10.1016/J.PATCOG.2009.09.023},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/ZhangDZS10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ZhangZZZ10,
  author       = {Lin Zhang and
                  Lei Zhang and
                  David Zhang and
                  Hailong Zhu},
  title        = {Online finger-knuckle-print verification for personal authentication},
  journal      = {Pattern Recognit.},
  volume       = {43},
  number       = {7},
  pages        = {2560--2571},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.patcog.2010.01.020},
  doi          = {10.1016/J.PATCOG.2010.01.020},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/ZhangZZZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ZhaoZZL10a,
  author       = {Qijun Zhao and
                  David Zhang and
                  Lei Zhang and
                  Nan Luo},
  title        = {Adaptive fingerprint pore modeling and extraction},
  journal      = {Pattern Recognit.},
  volume       = {43},
  number       = {8},
  pages        = {2833--2844},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.patcog.2010.02.016},
  doi          = {10.1016/J.PATCOG.2010.02.016},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/ZhaoZZL10a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/XuZYZ10,
  author       = {Yong Xu and
                  Aini Zhong and
                  Jian Yang and
                  David Zhang},
  title        = {{LPP} solution schemes for use with face recognition},
  journal      = {Pattern Recognit.},
  volume       = {43},
  number       = {12},
  pages        = {4165--4176},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.patcog.2010.06.016},
  doi          = {10.1016/J.PATCOG.2010.06.016},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/XuZYZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/GaoZZX10,
  author       = {Quanxue Gao and
                  Lei Zhang and
                  David Zhang and
                  Hui Xu},
  title        = {Independent components extraction from image matrix},
  journal      = {Pattern Recognit. Lett.},
  volume       = {31},
  number       = {3},
  pages        = {171--178},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.patrec.2009.10.014},
  doi          = {10.1016/J.PATREC.2009.10.014},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/prl/GaoZZX10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/ZhangZZS10,
  author       = {Baochang Zhang and
                  Lei Zhang and
                  David Zhang and
                  LinLin Shen},
  title        = {Directional binary code with application to PolyU near-infrared face
                  database},
  journal      = {Pattern Recognit. Lett.},
  volume       = {31},
  number       = {14},
  pages        = {2337--2344},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.patrec.2010.07.006},
  doi          = {10.1016/J.PATREC.2010.07.006},
  timestamp    = {Thu, 27 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/prl/ZhangZZS10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigpro/ZuoZZW10,
  author       = {Wangmeng Zuo and
                  Hongzhi Zhang and
                  David Zhang and
                  Kuanquan Wang},
  title        = {Post-processed {LDA} for face and palmprint recognition: What is the
                  rationale},
  journal      = {Signal Process.},
  volume       = {90},
  number       = {8},
  pages        = {2344--2352},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.sigpro.2009.06.004},
  doi          = {10.1016/J.SIGPRO.2009.06.004},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/sigpro/ZuoZZW10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/GuoZLZY10,
  author       = {Dongmin Guo and
                  David Zhang and
                  Naimin Li and
                  Lei Zhang and
                  Jianhua Yang},
  title        = {A Novel Breath Analysis System Based on Electronic Olfaction},
  journal      = {{IEEE} Trans. Biomed. Eng.},
  volume       = {57},
  number       = {11},
  pages        = {2753--2763},
  year         = {2010},
  url          = {https://doi.org/10.1109/TBME.2010.2055864},
  doi          = {10.1109/TBME.2010.2055864},
  timestamp    = {Wed, 02 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tbe/GuoZLZY10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/KumarKZ10,
  author       = {Ajay Kumar and
                  Vivek Kanhangad and
                  David Zhang},
  title        = {A new framework for adaptive multimodal biometrics management},
  journal      = {{IEEE} Trans. Inf. Forensics Secur.},
  volume       = {5},
  number       = {1},
  pages        = {92--102},
  year         = {2010},
  url          = {https://doi.org/10.1109/TIFS.2009.2031892},
  doi          = {10.1109/TIFS.2009.2031892},
  timestamp    = {Thu, 06 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tifs/KumarKZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/ZhangGLZZ10,
  author       = {David Zhang and
                  Zhenhua Guo and
                  Guangming Lu and
                  Lei Zhang and
                  Wangmeng Zuo},
  title        = {An Online System of Multispectral Palmprint Verification},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {59},
  number       = {2},
  pages        = {480--490},
  year         = {2010},
  url          = {https://doi.org/10.1109/TIM.2009.2028772},
  doi          = {10.1109/TIM.2009.2028772},
  timestamp    = {Mon, 08 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tim/ZhangGLZZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/KumarZ10,
  author       = {Ajay Kumar and
                  David Zhang},
  title        = {Improving Biometric Authentication Performance From the User Quality},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {59},
  number       = {3},
  pages        = {730--735},
  year         = {2010},
  url          = {https://doi.org/10.1109/TIM.2009.2028773},
  doi          = {10.1109/TIM.2009.2028773},
  timestamp    = {Mon, 08 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tim/KumarZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tim/ScottiZ10,
  author       = {Fabio Scotti and
                  David Zhang},
  title        = {Special Section in {IEEE} Transactions on Instrumentation and Measurement
                  on Biometric Instrumentation and Measurement},
  journal      = {{IEEE} Trans. Instrum. Meas.},
  volume       = {59},
  number       = {4},
  pages        = {750--751},
  year         = {2010},
  url          = {https://doi.org/10.1109/TIM.2010.2043980},
  doi          = {10.1109/TIM.2010.2043980},
  timestamp    = {Mon, 08 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tim/ScottiZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/KongZK10,
  author       = {Adams Wai{-}Kin Kong and
                  David Zhang and
                  Mohamed S. Kamel},
  title        = {An Analysis of IrisCode},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {19},
  number       = {2},
  pages        = {522--532},
  year         = {2010},
  url          = {https://doi.org/10.1109/TIP.2009.2033427},
  doi          = {10.1109/TIP.2009.2033427},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/KongZK10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/GuoZZ10,
  author       = {Zhenhua Guo and
                  Lei Zhang and
                  David Zhang},
  title        = {A Completed Modeling of Local Binary Pattern Operator for Texture
                  Classification},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {19},
  number       = {6},
  pages        = {1657--1663},
  year         = {2010},
  url          = {https://doi.org/10.1109/TIP.2010.2044957},
  doi          = {10.1109/TIP.2010.2044957},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/GuoZZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/WangZ10,
  author       = {Xingzheng Wang and
                  David Dapeng Zhang},
  title        = {An Optimized Tongue Image Color Correction Scheme},
  journal      = {{IEEE} Trans. Inf. Technol. Biomed.},
  volume       = {14},
  number       = {6},
  pages        = {1355--1364},
  year         = {2010},
  url          = {https://doi.org/10.1109/TITB.2010.2076378},
  doi          = {10.1109/TITB.2010.2076378},
  timestamp    = {Wed, 13 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/titb/WangZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/DiZZP10,
  author       = {Wei Di and
                  Lei Zhang and
                  David Zhang and
                  Quan Pan},
  title        = {Studies on Hyperspectral Face Recognition in Visible Spectrum With
                  Feature Band Selection},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {A}},
  volume       = {40},
  number       = {6},
  pages        = {1354--1361},
  year         = {2010},
  url          = {https://doi.org/10.1109/TSMCA.2010.2052603},
  doi          = {10.1109/TSMCA.2010.2052603},
  timestamp    = {Tue, 11 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/DiZZP10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ais2/ChenZZZ10,
  author       = {Chao Chen and
                  David Zhang and
                  Lei Zhang and
                  Yongqiang Zhao},
  title        = {Segmentation of fingerprint image by using polarimetric feature},
  booktitle    = {Autonomous and Intelligent Systems - First International Conference,
                  {AIS} 2010, Povoa de Varzim, Portugal, June 21-23, 2010. Proceedings},
  pages        = {1--4},
  publisher    = {{IEEE}},
  year         = {2010},
  url          = {https://doi.org/10.1109/AIS.2010.5547039},
  doi          = {10.1109/AIS.2010.5547039},
  timestamp    = {Fri, 03 May 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ais2/ChenZZZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bibm/Zhang10,
  author       = {David Zhang},
  title        = {Medical Biometrics-Computerized {TCM} Diagnosis},
  booktitle    = {2010 {IEEE} International Conference on Bioinformatics and Biomedicine
                  Workshops, {BIBMW} 2010, Hong Kong, December 18, 2010},
  pages        = {4},
  publisher    = {{IEEE}},
  year         = {2010},
  url          = {https://doi.org/10.1109/BIBMW.2010.5703764},
  doi          = {10.1109/BIBMW.2010.5703764},
  timestamp    = {Wed, 16 Mar 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/bibm/Zhang10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/KanhangadKZ10,
  author       = {Vivek Kanhangad and
                  Ajay Kumar and
                  David Zhang},
  title        = {Human hand identification with 3D hand pose variations},
  booktitle    = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR}
                  Workshops 2010, San Francisco, CA, USA, 13-18 June, 2010},
  pages        = {17--21},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://doi.org/10.1109/CVPRW.2010.5543236},
  doi          = {10.1109/CVPRW.2010.5543236},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/KanhangadKZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/LiZZLY10,
  author       = {Wei Li and
                  Lei Zhang and
                  David Zhang and
                  Guangming Lu and
                  Jingqi Yan},
  title        = {Efficient joint 2D and 3D palmprint matching with alignment refinement},
  booktitle    = {The Twenty-Third {IEEE} Conference on Computer Vision and Pattern
                  Recognition, {CVPR} 2010, San Francisco, CA, USA, 13-18 June 2010},
  pages        = {795--801},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://doi.org/10.1109/CVPR.2010.5540134},
  doi          = {10.1109/CVPR.2010.5540134},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/LiZZLY10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ZuoLGZ10,
  author       = {Wangmeng Zuo and
                  Zhouchen Lin and
                  Zhenhua Guo and
                  David Zhang},
  title        = {The multiscale competitive code via sparse representation for palmprint
                  verification},
  booktitle    = {The Twenty-Third {IEEE} Conference on Computer Vision and Pattern
                  Recognition, {CVPR} 2010, San Francisco, CA, USA, 13-18 June 2010},
  pages        = {2265--2272},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://doi.org/10.1109/CVPR.2010.5539909},
  doi          = {10.1109/CVPR.2010.5539909},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/ZuoLGZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/YuanZLZ10,
  author       = {Yin Yuan and
                  Haomian Zheng and
                  Zhu Li and
                  David Zhang},
  title        = {Video action recognition with spatio-temporal graph embedding and
                  spline modeling},
  booktitle    = {Proceedings of the {IEEE} International Conference on Acoustics, Speech,
                  and Signal Processing, {ICASSP} 2010, 14-19 March 2010, Sheraton Dallas
                  Hotel, Dallas, Texas, {USA}},
  pages        = {2422--2425},
  publisher    = {{IEEE}},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICASSP.2010.5496275},
  doi          = {10.1109/ICASSP.2010.5496275},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icassp/YuanZLZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/GuoZZZ10,
  author       = {Zhenhua Guo and
                  Lei Zhang and
                  David Zhang and
                  Su Zhang},
  title        = {Rotation invariant texture classification using adaptive {LBP} with
                  directional statistical features},
  booktitle    = {Proceedings of the International Conference on Image Processing, {ICIP}
                  2010, September 26-29, Hong Kong, China},
  pages        = {285--288},
  publisher    = {{IEEE}},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICIP.2010.5652209},
  doi          = {10.1109/ICIP.2010.5652209},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/icip/GuoZZZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/YangZYZ10,
  author       = {Meng Yang and
                  Lei Zhang and
                  Jian Yang and
                  David Zhang},
  title        = {Metaface learning for sparse representation based face recognition},
  booktitle    = {Proceedings of the International Conference on Image Processing, {ICIP}
                  2010, September 26-29, Hong Kong, China},
  pages        = {1601--1604},
  publisher    = {{IEEE}},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICIP.2010.5652363},
  doi          = {10.1109/ICIP.2010.5652363},
  timestamp    = {Wed, 15 Jan 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icip/YangZYZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/ZhangZGZ10,
  author       = {Lin Zhang and
                  Lei Zhang and
                  Zhenhua Guo and
                  David Zhang},
  title        = {Monogenic-LBP: {A} new approach for rotation invariant texture classification},
  booktitle    = {Proceedings of the International Conference on Image Processing, {ICIP}
                  2010, September 26-29, Hong Kong, China},
  pages        = {2677--2680},
  publisher    = {{IEEE}},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICIP.2010.5651885},
  doi          = {10.1109/ICIP.2010.5651885},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icip/ZhangZGZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/XieZYZ10,
  author       = {Jin Xie and
                  Lei Zhang and
                  Jane You and
                  David Zhang},
  title        = {Texture classification via patch-based sparse texton learning},
  booktitle    = {Proceedings of the International Conference on Image Processing, {ICIP}
                  2010, September 26-29, Hong Kong, China},
  pages        = {2737--2740},
  publisher    = {{IEEE}},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICIP.2010.5651387},
  doi          = {10.1109/ICIP.2010.5651387},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icip/XieZYZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/YueZZ10,
  author       = {Feng Yue and
                  Wangmeng Zuo and
                  David Zhang},
  title        = {{ICP} registration using principal line and orientation features for
                  palmprint alignment},
  booktitle    = {Proceedings of the International Conference on Image Processing, {ICIP}
                  2010, September 26-29, Hong Kong, China},
  pages        = {3069--3072},
  publisher    = {{IEEE}},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICIP.2010.5649887},
  doi          = {10.1109/ICIP.2010.5649887},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icip/YueZZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/ZhaoLZZ10,
  author       = {Qijun Zhao and
                  Feng Liu and
                  Lei Zhang and
                  David Zhang},
  title        = {A comparative study on quality assessment of high resolution fingerprint
                  images},
  booktitle    = {Proceedings of the International Conference on Image Processing, {ICIP}
                  2010, September 26-29, Hong Kong, China},
  pages        = {3089--3092},
  publisher    = {{IEEE}},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICIP.2010.5648800},
  doi          = {10.1109/ICIP.2010.5648800},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icip/ZhaoLZZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/JingLLMLZ10,
  author       = {Xiao{-}Yuan Jing and
                  Qian Liu and
                  Chao Lan and
                  Jiang{-}Yue Man and
                  Sheng Li and
                  David Zhang},
  title        = {Holistic orthogonal analysis of discriminant transforms for color
                  face recognition},
  booktitle    = {Proceedings of the International Conference on Image Processing, {ICIP}
                  2010, September 26-29, Hong Kong, China},
  pages        = {3841--3844},
  publisher    = {{IEEE}},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICIP.2010.5654099},
  doi          = {10.1109/ICIP.2010.5654099},
  timestamp    = {Tue, 04 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icip/JingLLMLZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/GuoZZM10,
  author       = {Zhenhua Guo and
                  Lei Zhang and
                  David Zhang and
                  Xuanqin Mou},
  title        = {Hierarchical multiscale {LBP} for face and palmprint recognition},
  booktitle    = {Proceedings of the International Conference on Image Processing, {ICIP}
                  2010, September 26-29, Hong Kong, China},
  pages        = {4521--4524},
  publisher    = {{IEEE}},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICIP.2010.5653119},
  doi          = {10.1109/ICIP.2010.5653119},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icip/GuoZZM10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/ZhangZZZ10,
  author       = {Dongyu Zhang and
                  Wangmeng Zuo and
                  David Zhang and
                  Hongzhi Zhang},
  title        = {Time Series Classification Using Support Vector Machine with Gaussian
                  Elastic Metric Kernel},
  booktitle    = {20th International Conference on Pattern Recognition, {ICPR} 2010,
                  Istanbul, Turkey, 23-26 August 2010},
  pages        = {29--32},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICPR.2010.16},
  doi          = {10.1109/ICPR.2010.16},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/ZhangZZZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/ZhaoLZZ10,
  author       = {Qijun Zhao and
                  Feng Liu and
                  Lei Zhang and
                  David Zhang},
  title        = {Parallel versus Hierarchical Fusion of Extended Fingerprint Features},
  booktitle    = {20th International Conference on Pattern Recognition, {ICPR} 2010,
                  Istanbul, Turkey, 23-26 August 2010},
  pages        = {1132--1135},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICPR.2010.283},
  doi          = {10.1109/ICPR.2010.283},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/ZhaoLZZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/GuoZZ10,
  author       = {Zhenhua Guo and
                  Lei Zhang and
                  David Zhang},
  title        = {Feature Band Selection for Multispectral Palmprint Recognition},
  booktitle    = {20th International Conference on Pattern Recognition, {ICPR} 2010,
                  Istanbul, Turkey, 23-26 August 2010},
  pages        = {1136--1139},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICPR.2010.284},
  doi          = {10.1109/ICPR.2010.284},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/GuoZZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/ZhangYFZ10,
  author       = {Lei Zhang and
                  Meng Yang and
                  Zhizhao Feng and
                  David Zhang},
  title        = {On the Dimensionality Reduction for Sparse Representation Based Face
                  Recognition},
  booktitle    = {20th International Conference on Pattern Recognition, {ICPR} 2010,
                  Istanbul, Turkey, 23-26 August 2010},
  pages        = {1237--1240},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICPR.2010.308},
  doi          = {10.1109/ICPR.2010.308},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/ZhangYFZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/LiuZZZ10,
  author       = {Feng Liu and
                  Qijun Zhao and
                  Lei Zhang and
                  David Zhang},
  title        = {Fingerprint Pore Matching Based on Sparse Representation},
  booktitle    = {20th International Conference on Pattern Recognition, {ICPR} 2010,
                  Istanbul, Turkey, 23-26 August 2010},
  pages        = {1630--1633},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICPR.2010.403},
  doi          = {10.1109/ICPR.2010.403},
  timestamp    = {Sun, 12 Nov 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/LiuZZZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/YangZZZ10,
  author       = {Meng Yang and
                  Lei Zhang and
                  Lin Zhang and
                  David Zhang},
  title        = {Monogenic Binary Pattern {(MBP):} {A} Novel Feature Extraction and
                  Representation Model for Face Recognition},
  booktitle    = {20th International Conference on Pattern Recognition, {ICPR} 2010,
                  Istanbul, Turkey, 23-26 August 2010},
  pages        = {2680--2683},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICPR.2010.657},
  doi          = {10.1109/ICPR.2010.657},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/YangZZZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/ZhangZZLL10,
  author       = {Dongyu Zhang and
                  Wangmeng Zuo and
                  David Zhang and
                  Yanlai Li and
                  Naimin Li},
  title        = {Gaussian {ERP} Kernel Classifier for Pulse Waveforms Classification},
  booktitle    = {20th International Conference on Pattern Recognition, {ICPR} 2010,
                  Istanbul, Turkey, 23-26 August 2010},
  pages        = {2736--2739},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICPR.2010.670},
  doi          = {10.1109/ICPR.2010.670},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/ZhangZZLL10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/XiaoZZS10,
  author       = {Rui Xiao and
                  Qijun Zhao and
                  David Zhang and
                  Pengfei Shi},
  title        = {Data Classification on Multiple Manifolds},
  booktitle    = {20th International Conference on Pattern Recognition, {ICPR} 2010,
                  Istanbul, Turkey, 23-26 August 2010},
  pages        = {3898--3901},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://doi.org/10.1109/ICPR.2010.949},
  doi          = {10.1109/ICPR.2010.949},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/XiaoZZS10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medbiometrics/ChenZ10,
  author       = {Fangmei Chen and
                  David Zhang},
  editor       = {David Zhang and
                  Milan Sonka},
  title        = {A Benchmark for Geometric Facial Beauty Study},
  booktitle    = {Medical Biometrics, Second International Conference, {ICMB} 2010,
                  Hong Kong, China, June 28-30, 2010. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {6165},
  pages        = {21--32},
  publisher    = {Springer},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-13923-9\_3},
  doi          = {10.1007/978-3-642-13923-9\_3},
  timestamp    = {Thu, 17 Oct 2019 12:39:20 +0200},
  biburl       = {https://dblp.org/rec/conf/medbiometrics/ChenZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medbiometrics/ChenLGZ10,
  author       = {Haifen Chen and
                  Guangming Lu and
                  Dongmin Guo and
                  David Zhang},
  editor       = {David Zhang and
                  Milan Sonka},
  title        = {An Effective Feature Extraction Method Used in Breath Analysis},
  booktitle    = {Medical Biometrics, Second International Conference, {ICMB} 2010,
                  Hong Kong, China, June 28-30, 2010. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {6165},
  pages        = {33--41},
  publisher    = {Springer},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-13923-9\_4},
  doi          = {10.1007/978-3-642-13923-9\_4},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/medbiometrics/ChenLGZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medbiometrics/GuoZLZY10,
  author       = {Dongmin Guo and
                  David Zhang and
                  Naimin Li and
                  Lei Zhang and
                  Jianhua Yang},
  editor       = {David Zhang and
                  Milan Sonka},
  title        = {Diabetes Identification and Classification by Means of a Breath Analysis
                  System},
  booktitle    = {Medical Biometrics, Second International Conference, {ICMB} 2010,
                  Hong Kong, China, June 28-30, 2010. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {6165},
  pages        = {52--63},
  publisher    = {Springer},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-13923-9\_6},
  doi          = {10.1007/978-3-642-13923-9\_6},
  timestamp    = {Tue, 08 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/medbiometrics/GuoZLZY10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medbiometrics/WangZ10,
  author       = {Xingzheng Wang and
                  David Zhang},
  editor       = {David Zhang and
                  Milan Sonka},
  title        = {A Comparative Study of Color Correction Algorithms for Tongue Image
                  Inspection},
  booktitle    = {Medical Biometrics, Second International Conference, {ICMB} 2010,
                  Hong Kong, China, June 28-30, 2010. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {6165},
  pages        = {392--402},
  publisher    = {Springer},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-13923-9\_42},
  doi          = {10.1007/978-3-642-13923-9\_42},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/medbiometrics/WangZ10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pricai/ZhangLSH10,
  author       = {David Dapeng Zhang and
                  Fen Lin and
                  Zhongzhi Shi and
                  Heqing Huang},
  editor       = {Byoung{-}Tak Zhang and
                  Mehmet A. Orgun},
  title        = {Mining Hot Clusters of Similar Anomalies for System Management},
  booktitle    = {{PRICAI} 2010: Trends in Artificial Intelligence, 11th Pacific Rim
                  International Conference on Artificial Intelligence, Daegu, Korea,
                  August 30-September 2, 2010. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {6230},
  pages        = {359--371},
  publisher    = {Springer},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-15246-7\_34},
  doi          = {10.1007/978-3-642-15246-7\_34},
  timestamp    = {Tue, 14 May 2019 10:00:46 +0200},
  biburl       = {https://dblp.org/rec/conf/pricai/ZhangLSH10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wcnc/YangWZC10,
  author       = {Xu Yang and
                  Yapeng Wang and
                  David Dapeng Zhang and
                  Laurie G. Cuthbert},
  title        = {Resource Allocation in {LTE} {OFDMA} Systems Using Genetic Algorithm
                  and Semi-Smart Antennas},
  booktitle    = {2010 {IEEE} Wireless Communications and Networking Conference, {WCNC}
                  2010, Proceedings, Sydney, Australia, 18-21 April 2010},
  pages        = {1--6},
  publisher    = {{IEEE}},
  year         = {2010},
  url          = {https://doi.org/10.1109/WCNC.2010.5506423},
  doi          = {10.1109/WCNC.2010.5506423},
  timestamp    = {Sat, 19 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/wcnc/YangWZC10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iceb2/2010,
  editor       = {Ajay Kumar and
                  David Zhang},
  title        = {Ethics and Policy of Biometrics - Third International Conference on
                  Ethics and Policy of Biometrics and International Data Sharing, {ICEB}
                  2010, Hong Kong, January 4-5, 2010. Revised Papers},
  series       = {Lecture Notes in Computer Science},
  volume       = {6005},
  publisher    = {Springer},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-12595-9},
  doi          = {10.1007/978-3-642-12595-9},
  isbn         = {978-3-642-12594-2},
  timestamp    = {Tue, 14 May 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iceb2/2010.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/medbiometrics/2010,
  editor       = {David Zhang and
                  Milan Sonka},
  title        = {Medical Biometrics, Second International Conference, {ICMB} 2010,
                  Hong Kong, China, June 28-30, 2010. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {6165},
  publisher    = {Springer},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-13923-9},
  doi          = {10.1007/978-3-642-13923-9},
  isbn         = {978-3-642-13922-2},
  timestamp    = {Thu, 17 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/medbiometrics/2010.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1012-1193,
  author       = {Bo Peng and
                  Lei Zhang and
                  David Zhang},
  title        = {Automatic Image Segmentation by Dynamic Region Merging},
  journal      = {CoRR},
  volume       = {abs/1012.1193},
  year         = {2010},
  url          = {http://arxiv.org/abs/1012.1193},
  eprinttype    = {arXiv},
  eprint       = {1012.1193},
  timestamp    = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1012-1193.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cma/MaWZ09,
  author       = {Lin Ma and
                  Kuanquan Wang and
                  David Zhang},
  title        = {A universal texture segmentation and representation scheme based on
                  ant colony optimization for iris image processing},
  journal      = {Comput. Math. Appl.},
  volume       = {57},
  number       = {11-12},
  pages        = {1862--1868},
  year         = {2009},
  url          = {https://doi.org/10.1016/j.camwa.2008.10.012},
  doi          = {10.1016/J.CAMWA.2008.10.012},
  timestamp    = {Thu, 11 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cma/MaWZ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cviu/ZhaoZZP09,
  author       = {Y. Zhao and
                  Lei Zhang and
                  David Zhang and
                  Quan Pan},
  title        = {Object separation by polarimetric and spectral imagery fusion},
  journal      = {Comput. Vis. Image Underst.},
  volume       = {113},
  number       = {8},
  pages        = {855--866},
  year         = {2009},
  url          = {https://doi.org/10.1016/j.cviu.2009.03.002},
  doi          = {10.1016/J.CVIU.2009.03.002},
  timestamp    = {Tue, 11 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cviu/ZhaoZZP09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejasp/ZhaoZZL09,
  author       = {Qijun Zhao and
                  David Zhang and
                  Lei Zhang and
                  Hongtao Lu},
  title        = {Evolutionary Discriminant Feature Extraction with Application to Face
                  Recognition},
  journal      = {{EURASIP} J. Adv. Signal Process.},
  volume       = {2009},
  year         = {2009},
  url          = {https://doi.org/10.1155/2009/465193},
  doi          = {10.1155/2009/465193},
  timestamp    = {Thu, 12 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ejasp/ZhaoZZL09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/XuYZY09,
  author       = {Yong Xu and
                  Lu Yao and
                  David Zhang and
                  Jing{-}Yu Yang},
  title        = {Improving the interest operator for face recognition},
  journal      = {Expert Syst. Appl.},
  volume       = {36},
  number       = {6},
  pages        = {9719--9728},
  year         = {2009},
  url          = {https://doi.org/10.1016/j.eswa.2009.02.032},
  doi          = {10.1016/J.ESWA.2009.02.032},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/eswa/XuYZY09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ieicet/LiYJCGZY09,
  author       = {Sheng Li and
                  Yong{-}Fang Yao and
                  Xiao{-}Yuan Jing and
                  Heng Chang and
                  Shi{-}Qiang Gao and
                  David Zhang and
                  Jing{-}Yu Yang},
  title        = {Face Recognition Based on Nonlinear {DCT} Discriminant Feature Extraction
                  Using Improved Kernel {DCV}},
  journal      = {{IEICE} Trans. Inf. Syst.},
  volume       = {92-D},
  number       = {12},
  pages        = {2527--2530},
  year         = {2009},
  url          = {https://doi.org/10.1587/transinf.E92.D.2527},
  doi          = {10.1587/TRANSINF.E92.D.2527},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ieicet/LiYJCGZY09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijig/KumarZ09,
  author       = {Ajay Kumar and
                  David Zhang},
  title        = {User Authentication Using Fusion of Face and Palmprint},
  journal      = {Int. J. Image Graph.},
  volume       = {9},
  number       = {2},
  pages        = {251--270},
  year         = {2009},
  url          = {https://doi.org/10.1142/S0219467809003423},
  doi          = {10.1142/S0219467809003423},
  timestamp    = {Tue, 24 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijig/KumarZ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/GaoZZ09,
  author       = {Quanxue Gao and
                  Lei Zhang and
                  David Zhang},
  title        = {Sequential row-column independent component analysis for face recognition},
  journal      = {Neurocomputing},
  volume       = {72},
  number       = {4-6},
  pages        = {1152--1159},
  year         = {2009},
  url          = {https://doi.org/10.1016/j.neucom.2008.02.007},
  doi          = {10.1016/J.NEUCOM.2008.02.007},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/GaoZZ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijprai/NingZZW09,
  author       = {Jifeng Ning and
                  Lei Zhang and
                  David Zhang and
                  Chengke Wu},
  title        = {Robust Object Tracking Using Joint Color-Texture Histogram},
  journal      = {Int. J. Pattern Recognit. Artif. Intell.},
  volume       = {23},
  number       = {7},
  pages        = {1245--1263},
  year         = {2009},
  url          = {https://doi.org/10.1142/S0218001409007624},
  doi          = {10.1142/S0218001409007624},
  timestamp    = {Mon, 11 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijprai/NingZZW09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/KongZK09,
  author       = {Adams Wai{-}Kin Kong and
                  David Dapeng Zhang and
                  Mohamed S. Kamel},
  title        = {A survey of palmprint recognition},
  journal      = {Pattern Recognit.},
  volume       = {42},
  number       = {7},
  pages        = {1408--1418},
  year         = {2009},
  url          = {https://doi.org/10.1016/j.patcog.2009.01.018},
  doi          = {10.1016/J.PATCOG.2009.01.018},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/KongZK09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/YueZZW09,
  author       = {Feng Yue and
                  Wangmeng Zuo and
                  David Zhang and
                  Kuanquan Wang},
  title        = {Orientation selection using modified {FCM} for competitive code-based
                  palmprint recognition},
  journal      = {Pattern Recognit.},
  volume       = {42},
  number       = {11},
  pages        = {2841--2849},
  year         = {2009},
  url          = {https://doi.org/10.1016/j.patcog.2009.03.015},
  doi          = {10.1016/J.PATCOG.2009.03.015},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/YueZZW09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/GuoZZZ09,
  author       = {Zhenhua Guo and
                  David Zhang and
                  Lei Zhang and
                  Wangmeng Zuo},
  title        = {Palmprint verification using binary orientation co-occurrence vector},
  journal      = {Pattern Recognit. Lett.},
  volume       = {30},
  number       = {13},
  pages        = {1219--1227},
  year         = {2009},
  url          = {https://doi.org/10.1016/j.patrec.2009.05.010},
  doi          = {10.1016/J.PATREC.2009.05.010},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/prl/GuoZZZ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/ZhangLWZ09,
  author       = {Lei Zhang and
                  Rastislav Lukac and
                  Xiaolin Wu and
                  David Zhang},
  title        = {PCA-Based Spatially Adaptive Denoising of {CFA} Images for Single-Sensor
                  Digital Cameras},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {18},
  number       = {4},
  pages        = {797--812},
  year         = {2009},
  url          = {https://doi.org/10.1109/TIP.2008.2011384},
  doi          = {10.1109/TIP.2008.2011384},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/ZhangLWZ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/titb/ZhangLYZ09,
  author       = {Lei Zhang and
                  Qin Li and
                  Jane You and
                  David Zhang},
  title        = {A Modified Matched Filter With Double-Sided Thresholding for Screening
                  Proliferative Diabetic Retinopathy},
  journal      = {{IEEE} Trans. Inf. Technol. Biomed.},
  volume       = {13},
  number       = {4},
  pages        = {528--534},
  year         = {2009},
  url          = {https://doi.org/10.1109/TITB.2008.2007201},
  doi          = {10.1109/TITB.2008.2007201},
  timestamp    = {Wed, 13 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/titb/ZhangLYZ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/ZhangLLZL09,
  author       = {David Zhang and
                  Guangming Lu and
                  Wei Li and
                  Lei Zhang and
                  Nan Luo},
  title        = {Palmprint Recognition Using 3-D Information},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {C}},
  volume       = {39},
  number       = {5},
  pages        = {505--519},
  year         = {2009},
  url          = {https://doi.org/10.1109/TSMCC.2009.2020790},
  doi          = {10.1109/TSMCC.2009.2020790},
  timestamp    = {Thu, 21 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/ZhangLLZL09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/accv/ZhangZZ09,
  author       = {Lin Zhang and
                  Lei Zhang and
                  David Zhang},
  editor       = {Hongbin Zha and
                  Rin{-}Ichiro Taniguchi and
                  Stephen J. Maybank},
  title        = {A Multi-scale Bilateral Structure Tensor Based Corner Detector},
  booktitle    = {Computer Vision - {ACCV} 2009, 9th Asian Conference on Computer Vision,
                  Xi'an, China, September 23-27, 2009, Revised Selected Papers, Part
                  {II}},
  series       = {Lecture Notes in Computer Science},
  volume       = {5995},
  pages        = {618--627},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-12304-7\_58},
  doi          = {10.1007/978-3-642-12304-7\_58},
  timestamp    = {Wed, 17 Feb 2021 15:51:19 +0100},
  biburl       = {https://dblp.org/rec/conf/accv/ZhangZZ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caip/GuoZZ09,
  author       = {Zhenhua Guo and
                  David Zhang and
                  Lei Zhang},
  editor       = {Xiaoyi Jiang and
                  Nicolai Petkov},
  title        = {Is White Light the Best Illumination for Palmprint Recognition?},
  booktitle    = {Computer Analysis of Images and Patterns, 13th International Conference,
                  {CAIP} 2009, M{\"{u}}nster, Germany, September 2-4, 2009. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {5702},
  pages        = {50--57},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-03767-2\_6},
  doi          = {10.1007/978-3-642-03767-2\_6},
  timestamp    = {Tue, 14 May 2019 10:00:53 +0200},
  biburl       = {https://dblp.org/rec/conf/caip/GuoZZ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caip/LiTLZ09,
  author       = {Rongfeng Li and
                  Darun Tang and
                  Wenxin Li and
                  David Zhang},
  editor       = {Xiaoyi Jiang and
                  Nicolai Petkov},
  title        = {Second-Level Partition for Estimating {FAR} Confidence Intervals in
                  Biometric Systems},
  booktitle    = {Computer Analysis of Images and Patterns, 13th International Conference,
                  {CAIP} 2009, M{\"{u}}nster, Germany, September 2-4, 2009. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {5702},
  pages        = {58--65},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-03767-2\_7},
  doi          = {10.1007/978-3-642-03767-2\_7},
  timestamp    = {Thu, 15 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/caip/LiTLZ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caip/WuWXZ09,
  author       = {Xiangqian Wu and
                  Kuanquan Wang and
                  Yong Xu and
                  David Zhang},
  editor       = {Xiaoyi Jiang and
                  Nicolai Petkov},
  title        = {Differential Feature Analysis for Palmprint Authentication},
  booktitle    = {Computer Analysis of Images and Patterns, 13th International Conference,
                  {CAIP} 2009, M{\"{u}}nster, Germany, September 2-4, 2009. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {5702},
  pages        = {125--132},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-03767-2\_15},
  doi          = {10.1007/978-3-642-03767-2\_15},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/caip/WuWXZ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caip/ZhangZZ09,
  author       = {Lin Zhang and
                  Lei Zhang and
                  David Zhang},
  editor       = {Xiaoyi Jiang and
                  Nicolai Petkov},
  title        = {Finger-Knuckle-Print Verification Based on Band-Limited Phase-Only
                  Correlation},
  booktitle    = {Computer Analysis of Images and Patterns, 13th International Conference,
                  {CAIP} 2009, M{\"{u}}nster, Germany, September 2-4, 2009. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {5702},
  pages        = {141--148},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-03767-2\_17},
  doi          = {10.1007/978-3-642-03767-2\_17},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/caip/ZhangZZ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caip/GuoZZ09a,
  author       = {Zhenhua Guo and
                  Lei Zhang and
                  David Zhang},
  editor       = {Xiaoyi Jiang and
                  Nicolai Petkov},
  title        = {Rotation Invariant Texture Classification Using Binary Filter Response
                  Pattern {(BFRP)}},
  booktitle    = {Computer Analysis of Images and Patterns, 13th International Conference,
                  {CAIP} 2009, M{\"{u}}nster, Germany, September 2-4, 2009. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {5702},
  pages        = {1130--1137},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-03767-2\_137},
  doi          = {10.1007/978-3-642-03767-2\_137},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/caip/GuoZZ09a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/KanhangadKZ09,
  author       = {Vivek Kanhangad and
                  Ajay Kumar and
                  David Zhang},
  title        = {Combining 2D and 3D hand geometry features for biometric verification},
  booktitle    = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR}
                  Workshops 2009, Miami, FL, USA, 20-25 June, 2009},
  pages        = {39--44},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://doi.org/10.1109/CVPRW.2009.5204306},
  doi          = {10.1109/CVPRW.2009.5204306},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/KanhangadKZ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ZhaoZZHB09,
  author       = {Qijun Zhao and
                  Lei Zhang and
                  David Zhang and
                  Wenyi Huang and
                  Jian Bai},
  title        = {Curvature and singularity driven diffusion for oriented pattern enhancement
                  with singular points},
  booktitle    = {2009 {IEEE} Computer Society Conference on Computer Vision and Pattern
                  Recognition {(CVPR} 2009), 20-25 June 2009, Miami, Florida, {USA}},
  pages        = {2129--2135},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://doi.org/10.1109/CVPR.2009.5206490},
  doi          = {10.1109/CVPR.2009.5206490},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/ZhaoZZHB09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/ZhaoZZL09,
  author       = {Qijun Zhao and
                  Lei Zhang and
                  David Zhang and
                  Nan Luo},
  editor       = {Massimo Tistarelli and
                  Mark S. Nixon},
  title        = {Direct Pore Matching for Fingerprint Recognition},
  booktitle    = {Advances in Biometrics, Third International Conference, {ICB} 2009,
                  Alghero, Italy, June 2-5, 2009. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {5558},
  pages        = {597--606},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-01793-3\_61},
  doi          = {10.1007/978-3-642-01793-3\_61},
  timestamp    = {Tue, 14 May 2019 10:00:35 +0200},
  biburl       = {https://dblp.org/rec/conf/icb/ZhaoZZL09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icic/LiuZZ09,
  author       = {Heng Liu and
                  David Zhang and
                  Zhiyuan Zhang},
  editor       = {De{-}Shuang Huang and
                  Kang{-}Hyun Jo and
                  Hong{-}Hee Lee and
                  Hee{-}Jun Kang and
                  Vitoantonio Bevilacqua},
  title        = {Multi-view Ear Recognition Based on Moving Least Square Pose Interpolation},
  booktitle    = {Emerging Intelligent Computing Technology and Applications. With Aspects
                  of Artificial Intelligence, 5th International Conference on Intelligent
                  Computing, {ICIC} 2009, Ulsan, South Korea, September 16-19, 2009,
                  Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {5755},
  pages        = {1085--1095},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-04020-7\_116},
  doi          = {10.1007/978-3-642-04020-7\_116},
  timestamp    = {Wed, 13 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icic/LiuZZ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/LiZZY09,
  author       = {Wei Li and
                  Lei Zhang and
                  David Zhang and
                  Jingqi Yan},
  title        = {Principal line based {ICP} alignment for palmprint verification},
  booktitle    = {Proceedings of the International Conference on Image Processing, {ICIP}
                  2009, 7-10 November 2009, Cairo, Egypt},
  pages        = {1961--1964},
  publisher    = {{IEEE}},
  year         = {2009},
  url          = {https://doi.org/10.1109/ICIP.2009.5413459},
  doi          = {10.1109/ICIP.2009.5413459},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/icip/LiZZY09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/ZhangZZ09,
  author       = {Lin Zhang and
                  Lei Zhang and
                  David Zhang},
  title        = {Finger-knuckle-print: {A} new biometric identifier},
  booktitle    = {Proceedings of the International Conference on Image Processing, {ICIP}
                  2009, 7-10 November 2009, Cairo, Egypt},
  pages        = {1981--1984},
  publisher    = {{IEEE}},
  year         = {2009},
  url          = {https://doi.org/10.1109/ICIP.2009.5413734},
  doi          = {10.1109/ICIP.2009.5413734},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icip/ZhangZZ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/GuoZZZ09,
  author       = {Zhenhua Guo and
                  Wangmeng Zuo and
                  Lei Zhang and
                  David Zhang},
  title        = {Palmprint verification using consistent orientation coding},
  booktitle    = {Proceedings of the International Conference on Image Processing, {ICIP}
                  2009, 7-10 November 2009, Cairo, Egypt},
  pages        = {1985--1988},
  publisher    = {{IEEE}},
  year         = {2009},
  url          = {https://doi.org/10.1109/ICIP.2009.5413728},
  doi          = {10.1109/ICIP.2009.5413728},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icip/GuoZZZ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iscid/SongZ09,
  author       = {Fengxi Song and
                  David Zhang},
  editor       = {Yongchuan Tang and
                  Jonathan Lawry},
  title        = {The Negative Effects of Whitening Transformation in Face Recognition},
  booktitle    = {2009 Second International Symposium on Computational Intelligence
                  and Design, {ISCID} 2009, Changsha, Hunan, China, 12-14 December 2009,
                  2 Volumes},
  pages        = {437--440},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://doi.org/10.1109/ISCID.2009.255},
  doi          = {10.1109/ISCID.2009.255},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iscid/SongZ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isnn/ZuoLWZ09,
  author       = {Wangmeng Zuo and
                  Lei Liu and
                  Kuanquan Wang and
                  David Zhang},
  editor       = {Wen Yu and
                  Haibo He and
                  Nian Zhang},
  title        = {Spatially Smooth Subspace Face Recognition Using {LOG} and {DOG} Penalties},
  booktitle    = {Advances in Neural Networks - {ISNN} 2009, 6th International Symposium
                  on Neural Networks, {ISNN} 2009, Wuhan, China, May 26-29, 2009, Proceedings,
                  Part {III}},
  series       = {Lecture Notes in Computer Science},
  volume       = {5553},
  pages        = {439--448},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-01513-7\_48},
  doi          = {10.1007/978-3-642-01513-7\_48},
  timestamp    = {Tue, 14 May 2019 10:00:36 +0200},
  biburl       = {https://dblp.org/rec/conf/isnn/ZuoLWZ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/WeiZZ09,
  author       = {Li Wei and
                  Lei Zhang and
                  David Zhang},
  title        = {Three Dimensional Palmprint Recognition},
  booktitle    = {Proceedings of the {IEEE} International Conference on Systems, Man
                  and Cybernetics, San Antonio, TX, USA, 11-14 October 2009},
  pages        = {4847--4852},
  publisher    = {{IEEE}},
  year         = {2009},
  url          = {https://doi.org/10.1109/ICSMC.2009.5346053},
  doi          = {10.1109/ICSMC.2009.5346053},
  timestamp    = {Wed, 16 Oct 2019 14:14:51 +0200},
  biburl       = {https://dblp.org/rec/conf/smc/WeiZZ09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/bio/ZhangK09,
  author       = {David Zhang and
                  Vivek Kanhangad},
  editor       = {Stan Z. Li and
                  Anil K. Jain},
  title        = {Palmprint, 3D},
  booktitle    = {Encyclopedia of Biometrics},
  pages        = {1037--1042},
  publisher    = {Springer {US}},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-0-387-73003-5\_264},
  doi          = {10.1007/978-0-387-73003-5\_264},
  timestamp    = {Fri, 27 Oct 2017 15:34:05 +0200},
  biburl       = {https://dblp.org/rec/reference/bio/ZhangK09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/bio/ZhangL09,
  author       = {David Zhang and
                  Laura Li Liu},
  editor       = {Stan Z. Li and
                  Anil K. Jain},
  title        = {Palmprint Features},
  booktitle    = {Encyclopedia of Biometrics},
  pages        = {1043--1049},
  publisher    = {Springer {US}},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-0-387-73003-5\_266},
  doi          = {10.1007/978-0-387-73003-5\_266},
  timestamp    = {Thu, 21 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/reference/bio/ZhangL09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/amc/GaoZZ08,
  author       = {Quanxue Gao and
                  Lei Zhang and
                  David Zhang},
  title        = {Face recognition using {FLDA} with single training image per person},
  journal      = {Appl. Math. Comput.},
  volume       = {205},
  number       = {2},
  pages        = {726--734},
  year         = {2008},
  url          = {https://doi.org/10.1016/j.amc.2008.05.019},
  doi          = {10.1016/J.AMC.2008.05.019},
  timestamp    = {Fri, 21 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/amc/GaoZZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/appml/ShaoYZ08,
  author       = {Zhendong Shao and
                  Roger K. Yeh and
                  David Zhang},
  title        = {The L(2, 1)-labeling on graphs and the frequency assignment problem},
  journal      = {Appl. Math. Lett.},
  volume       = {21},
  number       = {1},
  pages        = {37--41},
  year         = {2008},
  url          = {https://doi.org/10.1016/j.aml.2006.08.029},
  doi          = {10.1016/J.AML.2006.08.029},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/appml/ShaoYZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/appml/ShaoZ08,
  author       = {Zhendong Shao and
                  David Zhang},
  title        = {The L(2, 1)-labeling on Cartesian sum of graphs},
  journal      = {Appl. Math. Lett.},
  volume       = {21},
  number       = {8},
  pages        = {843--848},
  year         = {2008},
  url          = {https://doi.org/10.1016/j.aml.2007.08.010},
  doi          = {10.1016/J.AML.2007.08.010},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/appml/ShaoZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fcsc/YangYZ08,
  author       = {Jian Yang and
                  Jing{-}Yu Yang and
                  David Zhang},
  title        = {Median Fisher Discriminator: a robust feature extraction method with
                  applications to biometrics},
  journal      = {Frontiers Comput. Sci. China},
  volume       = {2},
  number       = {3},
  pages        = {295--305},
  year         = {2008},
  url          = {https://doi.org/10.1007/s11704-008-0029-4},
  doi          = {10.1007/S11704-008-0029-4},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/fcsc/YangYZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijig/FengZYH08,
  author       = {Guiyu Feng and
                  David Zhang and
                  Jian Yang and
                  Dewen Hu},
  title        = {A Theoretical Framework for Matrix-Based Feature Extraction Algorithms
                  with its Application to Image Recognition},
  journal      = {Int. J. Image Graph.},
  volume       = {8},
  number       = {1},
  pages        = {1--23},
  year         = {2008},
  url          = {https://doi.org/10.1142/S0219467808002940},
  doi          = {10.1142/S0219467808002940},
  timestamp    = {Tue, 24 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijig/FengZYH08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/XuZYY08,
  author       = {Yong Xu and
                  David Zhang and
                  Jian Yang and
                  Jing{-}Yu Yang},
  title        = {An approach for directly extracting features from matrix data and
                  its application in face recognition},
  journal      = {Neurocomputing},
  volume       = {71},
  number       = {10-12},
  pages        = {1857--1865},
  year         = {2008},
  url          = {https://doi.org/10.1016/j.neucom.2007.09.021},
  doi          = {10.1016/J.NEUCOM.2007.09.021},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijon/XuZYY08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/SongLZY08,
  author       = {Fengxi Song and
                  Hang Liu and
                  David Zhang and
                  Jing{-}Yu Yang},
  title        = {A highly scalable incremental facial feature extraction method},
  journal      = {Neurocomputing},
  volume       = {71},
  number       = {10-12},
  pages        = {1883--1888},
  year         = {2008},
  url          = {https://doi.org/10.1016/j.neucom.2007.09.022},
  doi          = {10.1016/J.NEUCOM.2007.09.022},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijon/SongLZY08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/JingYYZ08,
  author       = {Xiao{-}Yuan Jing and
                  Yong{-}Fang Yao and
                  Jing{-}Yu Yang and
                  David Zhang},
  title        = {A novel face recognition approach based on kernel discriminative common
                  vectors {(KDCV)} feature extraction and {RBF} neural network},
  journal      = {Neurocomputing},
  volume       = {71},
  number       = {13-15},
  pages        = {3044--3048},
  year         = {2008},
  url          = {https://doi.org/10.1016/j.neucom.2007.08.027},
  doi          = {10.1016/J.NEUCOM.2007.08.027},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijon/JingYYZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/paa/ZuoZW08,
  author       = {Wangmeng Zuo and
                  David Zhang and
                  Kuanquan Wang},
  title        = {On kernel difference-weighted \emph{k}-nearest neighbor classification},
  journal      = {Pattern Anal. Appl.},
  volume       = {11},
  number       = {3-4},
  pages        = {247--257},
  year         = {2008},
  url          = {https://doi.org/10.1007/s10044-007-0100-z},
  doi          = {10.1007/S10044-007-0100-Z},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/paa/ZuoZW08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/HuangJZ08,
  author       = {De{-}Shuang Huang and
                  Wei Jia and
                  David Zhang},
  title        = {Palmprint verification based on principal lines},
  journal      = {Pattern Recognit.},
  volume       = {41},
  number       = {4},
  pages        = {1316--1328},
  year         = {2008},
  url          = {https://doi.org/10.1016/j.patcog.2007.08.016},
  doi          = {10.1016/J.PATCOG.2007.08.016},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/HuangJZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/KongZK08,
  author       = {Adams Wai{-}Kin Kong and
                  David Zhang and
                  Mohamed Kamel},
  title        = {Three measures for secure palmprint identification},
  journal      = {Pattern Recognit.},
  volume       = {41},
  number       = {4},
  pages        = {1329--1337},
  year         = {2008},
  url          = {https://doi.org/10.1016/j.patcog.2007.09.002},
  doi          = {10.1016/J.PATCOG.2007.09.002},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/KongZK08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/JiaHZ08,
  author       = {Wei Jia and
                  De{-}Shuang Huang and
                  David Zhang},
  title        = {Palmprint verification based on robust line orientation code},
  journal      = {Pattern Recognit.},
  volume       = {41},
  number       = {5},
  pages        = {1504--1513},
  year         = {2008},
  url          = {https://doi.org/10.1016/j.patcog.2007.10.011},
  doi          = {10.1016/J.PATCOG.2007.10.011},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/JiaHZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/ZhaoLZZ08,
  author       = {Tuo Zhao and
                  Zhizheng Liang and
                  David Zhang and
                  Quan Zou},
  title        = {Interest filter vs. interest operator: Face recognition using Fisher
                  linear discriminant based on interest filter representation},
  journal      = {Pattern Recognit. Lett.},
  volume       = {29},
  number       = {13},
  pages        = {1849--1857},
  year         = {2008},
  url          = {https://doi.org/10.1016/j.patrec.2008.05.023},
  doi          = {10.1016/J.PATREC.2008.05.023},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/prl/ZhaoLZZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigarch/ZhangLRA08,
  author       = {David Zhang and
                  Qiuyuan J. Li and
                  Rodric M. Rabbah and
                  Saman P. Amarasinghe},
  title        = {A lightweight streaming layer for multicore execution},
  journal      = {{SIGARCH} Comput. Archit. News},
  volume       = {36},
  number       = {2},
  pages        = {18--27},
  year         = {2008},
  url          = {https://doi.org/10.1145/1399972.1399978},
  doi          = {10.1145/1399972.1399978},
  timestamp    = {Sun, 02 Oct 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/sigarch/ZhangLRA08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/ShaoKSZ08,
  author       = {Zhendong Shao and
                  Sandi Klavzar and
                  Wai Chee Shiu and
                  David Zhang},
  title        = {Improved Bounds on the L(2, 1)-Number of Direct and Strong Products
                  of Graphs},
  journal      = {{IEEE} Trans. Circuits Syst. {II} Express Briefs},
  volume       = {55-II},
  number       = {7},
  pages        = {685--689},
  year         = {2008},
  url          = {https://doi.org/10.1109/TCSII.2008.921411},
  doi          = {10.1109/TCSII.2008.921411},
  timestamp    = {Wed, 27 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcas/ShaoKSZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcas/ShiuSPZ08,
  author       = {Wai Chee Shiu and
                  Zhendong Shao and
                  Kin Keung Poon and
                  David Zhang},
  title        = {A New Approach to the L(2, 1) -Labeling of Some Products of Graphs},
  journal      = {{IEEE} Trans. Circuits Syst. {II} Express Briefs},
  volume       = {55-II},
  number       = {8},
  pages        = {802--805},
  year         = {2008},
  url          = {https://doi.org/10.1109/TCSII.2008.922450},
  doi          = {10.1109/TCSII.2008.922450},
  timestamp    = {Wed, 27 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcas/ShiuSPZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcs/ShaoZ08,
  author       = {Zhendong Shao and
                  David Zhang},
  title        = {Improved upper bounds on the L(2, 1) -labeling of the skew and converse
                  skew product graphs},
  journal      = {Theor. Comput. Sci.},
  volume       = {400},
  number       = {1-3},
  pages        = {230--233},
  year         = {2008},
  url          = {https://doi.org/10.1016/j.tcs.2008.02.048},
  doi          = {10.1016/J.TCS.2008.02.048},
  timestamp    = {Wed, 17 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tcs/ShaoZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/KanhangadKZ08,
  author       = {Vivek Kanhangad and
                  Ajay Kumar and
                  David Zhang},
  title        = {Comments on "An Adaptive Multimodal Biometric Management Algorithm"},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {C}},
  volume       = {38},
  number       = {6},
  pages        = {841--843},
  year         = {2008},
  url          = {https://doi.org/10.1109/TSMCC.2008.2001570},
  doi          = {10.1109/TSMCC.2008.2001570},
  timestamp    = {Thu, 21 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/KanhangadKZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bmei/ZhangZZZ08,
  author       = {Dongyu Zhang and
                  Lei Zhang and
                  David Zhang and
                  Yongping Zheng},
  title        = {Wavelet Based Analysis of Doppler Ultrasonic Wrist-pulse Signals},
  booktitle    = {Proceedings of the 2008 International Conference on BioMedical Engineering
                  and Informatics, {BMEI} 2008, May 28-30, 2008, Sanya, Hainan, China
                  - Volume 2},
  pages        = {539--543},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/BMEI.2008.326},
  doi          = {10.1109/BMEI.2008.326},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/bmei/ZhangZZZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ZhangGZ08,
  author       = {Lei Zhang and
                  Quanxue Gao and
                  David Zhang},
  title        = {Directional independent component analysis with tensor representation},
  booktitle    = {2008 {IEEE} Computer Society Conference on Computer Vision and Pattern
                  Recognition {(CVPR} 2008), 24-26 June 2008, Anchorage, Alaska, {USA}},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/CVPR.2008.4587667},
  doi          = {10.1109/CVPR.2008.4587667},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/ZhangGZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icarcv/KumarZ08,
  author       = {Ajay Kumar and
                  David Zhang},
  title        = {Incorporating user quality for performance improvement in hand identification},
  booktitle    = {10th International Conference on Control, Automation, Robotics and
                  Vision, {ICARCV} 2008, Hanoi, Vietnam, 17-20 December 2008, Proceedings},
  pages        = {1133--1136},
  publisher    = {{IEEE}},
  year         = {2008},
  url          = {https://doi.org/10.1109/ICARCV.2008.4795680},
  doi          = {10.1109/ICARCV.2008.4795680},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/icarcv/KumarZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/LiZYZB08,
  author       = {Qin Li and
                  Lei Zhang and
                  Jane You and
                  David Zhang and
                  Prabir Bhattacharya},
  title        = {Dark line detection with line width extraction},
  booktitle    = {Proceedings of the International Conference on Image Processing, {ICIP}
                  2008, October 12-15, 2008, San Diego, California, {USA}},
  pages        = {621--624},
  publisher    = {{IEEE}},
  year         = {2008},
  url          = {https://doi.org/10.1109/ICIP.2008.4711831},
  doi          = {10.1109/ICIP.2008.4711831},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/icip/LiZYZB08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icnc/WuQW008,
  author       = {Xiangqian Wu and
                  Ning Qi and
                  Kuanquan Wang and
                  David Zhang},
  editor       = {Maozu Guo and
                  Liang Zhao and
                  Lipo Wang},
  title        = {A Novel Cryptosystem Based on Iris Key Generation},
  booktitle    = {Fourth International Conference on Natural Computation, {ICNC} 2008,
                  Jinan, Shandong, China, 18-20 October 2008, Volume 4},
  pages        = {53--56},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/ICNC.2008.808},
  doi          = {10.1109/ICNC.2008.808},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icnc/WuQW008.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/KumarKZ08,
  author       = {Ajay Kumar and
                  Vivek Kanhangad and
                  David Zhang},
  title        = {Multimodal biometrics management using adaptive score-level combination},
  booktitle    = {19th International Conference on Pattern Recognition {(ICPR} 2008),
                  December 8-11, 2008, Tampa, Florida, {USA}},
  pages        = {1--4},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/ICPR.2008.4761879},
  doi          = {10.1109/ICPR.2008.4761879},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/KumarKZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/LiuZKW08,
  author       = {Laura Li Liu and
                  David Zhang and
                  Ajay Kumar and
                  Xiangqian Wu},
  title        = {Tongue line extraction},
  booktitle    = {19th International Conference on Pattern Recognition {(ICPR} 2008),
                  December 8-11, 2008, Tampa, Florida, {USA}},
  pages        = {1--4},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/ICPR.2008.4761651},
  doi          = {10.1109/ICPR.2008.4761651},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/LiuZKW08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/WuWZ08,
  author       = {Xiangqian Wu and
                  Kuanquan Wang and
                  David Zhang},
  title        = {A cryptosystem based on palmprint feature},
  booktitle    = {19th International Conference on Pattern Recognition {(ICPR} 2008),
                  December 8-11, 2008, Tampa, Florida, {USA}},
  pages        = {1--4},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/ICPR.2008.4761117},
  doi          = {10.1109/ICPR.2008.4761117},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/WuWZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/YueZWZ08,
  author       = {Feng Yue and
                  Wangmeng Zuo and
                  Kuanquan Wang and
                  David Zhang},
  title        = {A performance evaluation of filter design and coding schemes for palmprint
                  recognition},
  booktitle    = {19th International Conference on Pattern Recognition {(ICPR} 2008),
                  December 8-11, 2008, Tampa, Florida, {USA}},
  pages        = {1--4},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/ICPR.2008.4761845},
  doi          = {10.1109/ICPR.2008.4761845},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/YueZWZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/YueZWZ08a,
  author       = {Feng Yue and
                  Wangmeng Zuo and
                  Kuanquan Wang and
                  David Zhang},
  title        = {FCM-based orientation selection for competitive coding-based palmprint
                  recognition},
  booktitle    = {19th International Conference on Pattern Recognition {(ICPR} 2008),
                  December 8-11, 2008, Tampa, Florida, {USA}},
  pages        = {1--4},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/ICPR.2008.4761846},
  doi          = {10.1109/ICPR.2008.4761846},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/YueZWZ08a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/ZhaoZZLB08,
  author       = {Qijun Zhao and
                  Lei Zhang and
                  David Zhang and
                  Nan Luo and
                  Jing Bao},
  title        = {Adaptive pore model for fingerprint pore extraction},
  booktitle    = {19th International Conference on Pattern Recognition {(ICPR} 2008),
                  December 8-11, 2008, Tampa, Florida, {USA}},
  pages        = {1--4},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/ICPR.2008.4761458},
  doi          = {10.1109/ICPR.2008.4761458},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/ZhaoZZLB08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/ZuoYWZ08,
  author       = {Wangmeng Zuo and
                  Feng Yue and
                  Kuanquan Wang and
                  David Zhang},
  title        = {Multiscale competitive code for efficient palmprint recognition},
  booktitle    = {19th International Conference on Pattern Recognition {(ICPR} 2008),
                  December 8-11, 2008, Tampa, Florida, {USA}},
  pages        = {1--4},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/ICPR.2008.4761868},
  doi          = {10.1109/ICPR.2008.4761868},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/ZuoYWZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iih-msp/WuQWZ08,
  author       = {Xiangqian Wu and
                  Ning Qi and
                  Kuanquan Wang and
                  David Zhang},
  editor       = {Jeng{-}Shyang Pan and
                  Xiamu Niu and
                  Hsiang{-}Cheh Huang and
                  Lakhmi C. Jain},
  title        = {An Iris Cryptosystem for Information Security},
  booktitle    = {4th International Conference on Intelligent Information Hiding and
                  Multimedia Signal Processing {(IIH-MSP} 2008), Harbin, China, 15-17
                  August 2008, Proceedings},
  pages        = {1533--1536},
  publisher    = {{IEEE} Computer Society},
  year         = {2008},
  url          = {https://doi.org/10.1109/IIH-MSP.2008.83},
  doi          = {10.1109/IIH-MSP.2008.83},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iih-msp/WuQWZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/medbiometrics/LiuZ08,
  author       = {Laura Li Liu and
                  David Zhang},
  editor       = {David Zhang},
  title        = {Extracting Tongue Cracks Using the Wide Line Detector},
  booktitle    = {Medical Biometrics, First International Conference, {ICMB} 2008, Hong
                  Kong, China, January 4-5, 2008, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4901},
  pages        = {49--56},
  publisher    = {Springer},
  year         = {2008},
  url          = {https://doi.org/10.1007/978-3-540-77413-6\_7},
  doi          = {10.1007/978-3-540-77413-6\_7},
  timestamp    = {Tue, 14 May 2019 10:00:39 +0200},
  biburl       = {https://dblp.org/rec/conf/medbiometrics/LiuZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/JiaHTZ08,
  author       = {Wei Jia and
                  De{-}Shuang Huang and
                  Dacheng Tao and
                  David Zhang},
  title        = {Palmprint identification based on directional representation},
  booktitle    = {Proceedings of the {IEEE} International Conference on Systems, Man
                  and Cybernetics, Singapore, 12-15 October 2008},
  pages        = {1562--1567},
  publisher    = {{IEEE}},
  year         = {2008},
  url          = {https://doi.org/10.1109/ICSMC.2008.4811509},
  doi          = {10.1109/ICSMC.2008.4811509},
  timestamp    = {Wed, 16 Oct 2019 14:14:51 +0200},
  biburl       = {https://dblp.org/rec/conf/smc/JiaHTZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sspr/XuZ08,
  author       = {Yong Xu and
                  David Zhang},
  editor       = {Niels da Vitoria Lobo and
                  Takis Kasparis and
                  Fabio Roli and
                  James Tin{-}Yau Kwok and
                  Michael Georgiopoulos and
                  Georgios C. Anagnostopoulos and
                  Marco Loog},
  title        = {A New Solution Scheme of Unsupervised Locality Preserving Projection
                  Method for the {SSS} Problem},
  booktitle    = {Structural, Syntactic, and Statistical Pattern Recognition, Joint
                  {IAPR} International Workshop, {SSPR} {\&} {SPR} 2008, Orlando,
                  USA, December 4-6, 2008. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {5342},
  pages        = {775--781},
  publisher    = {Springer},
  year         = {2008},
  url          = {https://doi.org/10.1007/978-3-540-89689-0\_81},
  doi          = {10.1007/978-3-540-89689-0\_81},
  timestamp    = {Tue, 14 May 2019 10:00:36 +0200},
  biburl       = {https://dblp.org/rec/conf/sspr/XuZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsc/JohnstonSYZ08,
  author       = {Lenrick Johnston and
                  Lee Schruben and
                  Arden Yang and
                  David Zhang},
  editor       = {Scott J. Mason and
                  Raymond R. Hill and
                  Lars M{\"{o}}nch and
                  Oliver Rose and
                  Thomas Jefferson and
                  John W. Fowler},
  title        = {Establishing the credibility of a biotech simulation model},
  booktitle    = {Proceedings of the 2008 Winter Simulation Conference, Global Gateway
                  to Discovery, {WSC} 2008, InterContinental Hotel, Miami, Florida,
                  USA, December 7-10, 2008},
  pages        = {822--826},
  publisher    = {{WSC}},
  year         = {2008},
  url          = {https://doi.org/10.1109/WSC.2008.4736145},
  doi          = {10.1109/WSC.2008.4736145},
  timestamp    = {Thu, 10 Jun 2021 22:19:17 +0200},
  biburl       = {https://dblp.org/rec/conf/wsc/JohnstonSYZ08.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/medbiometrics/2008,
  editor       = {David Zhang},
  title        = {Medical Biometrics, First International Conference, {ICMB} 2008, Hong
                  Kong, China, January 4-5, 2008, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4901},
  publisher    = {Springer},
  year         = {2008},
  url          = {https://doi.org/10.1007/978-3-540-77413-6},
  doi          = {10.1007/978-3-540-77413-6},
  isbn         = {978-3-540-77410-5},
  timestamp    = {Tue, 14 May 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/medbiometrics/2008.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/appml/ShaoYZ07,
  author       = {Zhendong Shao and
                  Roger K. Yeh and
                  David Zhang},
  title        = {The \emph{L}(2, 1)-labeling on the skew and converse skew products
                  of graphs},
  journal      = {Appl. Math. Lett.},
  volume       = {20},
  number       = {1},
  pages        = {59--64},
  year         = {2007},
  url          = {https://doi.org/10.1016/j.aml.2006.02.032},
  doi          = {10.1016/J.AML.2006.02.032},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/appml/ShaoYZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbm/XuZWLW07,
  author       = {Lisheng Xu and
                  David Zhang and
                  Kuanquan Wang and
                  Naimin Li and
                  Xiaoyun Wang},
  title        = {Baseline wander correction in pulse waveforms using wavelet-based
                  cascaded adaptive filter},
  journal      = {Comput. Biol. Medicine},
  volume       = {37},
  number       = {5},
  pages        = {716--731},
  year         = {2007},
  url          = {https://doi.org/10.1016/j.compbiomed.2006.06.014},
  doi          = {10.1016/J.COMPBIOMED.2006.06.014},
  timestamp    = {Sat, 05 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cbm/XuZWLW07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cim/ZhangZ07,
  author       = {David Zhang and
                  Wangmeng Zuo},
  title        = {Computational Intelligence-Based Biometric Technologies},
  journal      = {{IEEE} Comput. Intell. Mag.},
  volume       = {2},
  number       = {2},
  pages        = {26--36},
  year         = {2007},
  url          = {https://doi.org/10.1109/MCI.2007.353418},
  doi          = {10.1109/MCI.2007.353418},
  timestamp    = {Tue, 01 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cim/ZhangZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmig/ZhiZYLT07,
  author       = {Liu Zhi and
                  David Zhang and
                  Jingqi Yan and
                  Qingli Li and
                  Qun{-}lin Tang},
  title        = {Classification of hyperspectral medical tongue images for tongue diagnosis},
  journal      = {Comput. Medical Imaging Graph.},
  volume       = {31},
  number       = {8},
  pages        = {672--678},
  year         = {2007},
  url          = {https://doi.org/10.1016/j.compmedimag.2007.07.008},
  doi          = {10.1016/J.COMPMEDIMAG.2007.07.008},
  timestamp    = {Thu, 20 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cmig/ZhiZYLT07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cviu/ZhangZ07,
  author       = {Lei Zhang and
                  David Zhang},
  title        = {A joint demosaicking-zooming scheme for single chip digital color
                  cameras},
  journal      = {Comput. Vis. Image Underst.},
  volume       = {107},
  number       = {1-2},
  pages        = {14--25},
  year         = {2007},
  url          = {https://doi.org/10.1016/j.cviu.2006.11.006},
  doi          = {10.1016/J.CVIU.2006.11.006},
  timestamp    = {Fri, 21 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cviu/ZhangZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/ZuoWZZ07,
  author       = {Wangmeng Zuo and
                  Kuanquan Wang and
                  David Zhang and
                  Hongzhi Zhang},
  title        = {Combination of two novel LDA-based methods for face recognition},
  journal      = {Neurocomputing},
  volume       = {70},
  number       = {4-6},
  pages        = {735--742},
  year         = {2007},
  url          = {https://doi.org/10.1016/j.neucom.2006.10.008},
  doi          = {10.1016/J.NEUCOM.2006.10.008},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/ZuoWZZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/YuWZ07,
  author       = {Li Yu and
                  Kuanquan Wang and
                  David Zhang},
  title        = {Extracting the autonomic nerve wreath of iris based on an improved
                  snake approach},
  journal      = {Neurocomputing},
  volume       = {70},
  number       = {4-6},
  pages        = {743--748},
  year         = {2007},
  url          = {https://doi.org/10.1016/j.neucom.2006.10.009},
  doi          = {10.1016/J.NEUCOM.2006.10.009},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/YuWZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/XuZSYJL07,
  author       = {Yong Xu and
                  David Zhang and
                  Fengxi Song and
                  Jing{-}Yu Yang and
                  Zhong Jing and
                  Miao Li},
  title        = {A method for speeding up feature extraction based on {KPCA}},
  journal      = {Neurocomputing},
  volume       = {70},
  number       = {4-6},
  pages        = {1056--1061},
  year         = {2007},
  url          = {https://doi.org/10.1016/j.neucom.2006.09.005},
  doi          = {10.1016/J.NEUCOM.2006.09.005},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijon/XuZSYJL07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/SongZWLT07,
  author       = {Fengxi Song and
                  David Zhang and
                  Jizhong Wang and
                  Hang Liu and
                  Qing Tao},
  title        = {A parameterized direct {LDA} and its application to face recognition},
  journal      = {Neurocomputing},
  volume       = {71},
  number       = {1-3},
  pages        = {191--196},
  year         = {2007},
  url          = {https://doi.org/10.1016/j.neucom.2007.01.003},
  doi          = {10.1016/J.NEUCOM.2007.01.003},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/SongZWLT07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijprai/SongZXW07,
  author       = {Fengxi Song and
                  David Zhang and
                  Yong Xu and
                  Jizhong Wang},
  title        = {Five New Feature Selection Metrics in Text Categorization},
  journal      = {Int. J. Pattern Recognit. Artif. Intell.},
  volume       = {21},
  number       = {6},
  pages        = {1085--1101},
  year         = {2007},
  url          = {https://doi.org/10.1142/S0218001407005831},
  doi          = {10.1142/S0218001407005831},
  timestamp    = {Mon, 11 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijprai/SongZXW07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcst/SongZCY07,
  author       = {Fengxi Song and
                  David Zhang and
                  Cai{-}Kou Chen and
                  Jing{-}Yu Yang},
  title        = {Facial Feature Extraction Method Based on Coefficients of Variances},
  journal      = {J. Comput. Sci. Technol.},
  volume       = {22},
  number       = {4},
  pages        = {626--632},
  year         = {2007},
  url          = {https://doi.org/10.1007/s11390-007-9070-2},
  doi          = {10.1007/S11390-007-9070-2},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jcst/SongZCY07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/paa/SongZCW07,
  author       = {Fengxi Song and
                  David Zhang and
                  Qinglong Chen and
                  Jizhong Wang},
  title        = {Face recognition based on a novel linear discriminant criterion},
  journal      = {Pattern Anal. Appl.},
  volume       = {10},
  number       = {3},
  pages        = {165--174},
  year         = {2007},
  url          = {https://doi.org/10.1007/s10044-006-0057-3},
  doi          = {10.1007/S10044-006-0057-3},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/paa/SongZCW07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/YangZYN07,
  author       = {Jian Yang and
                  David Zhang and
                  Jing{-}Yu Yang and
                  Ben Niu},
  title        = {Globally Maximizing, Locally Minimizing: Unsupervised Discriminant
                  Projection with Applications to Face and Palm Biometrics},
  journal      = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
  volume       = {29},
  number       = {4},
  pages        = {650--664},
  year         = {2007},
  url          = {https://doi.org/10.1109/TPAMI.2007.1008},
  doi          = {10.1109/TPAMI.2007.1008},
  timestamp    = {Thu, 15 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pami/YangZYN07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/YuZW07,
  author       = {Li Yu and
                  David Zhang and
                  Kuanquan Wang},
  title        = {The relative distance of key point based iris recognition},
  journal      = {Pattern Recognit.},
  volume       = {40},
  number       = {2},
  pages        = {423--430},
  year         = {2007},
  url          = {https://doi.org/10.1016/j.patcog.2006.03.008},
  doi          = {10.1016/J.PATCOG.2006.03.008},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/YuZW07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/LiangZS07,
  author       = {Zhizheng Liang and
                  David Zhang and
                  Pengfei Shi},
  title        = {The theoretical analysis of {GLRAM} and its applications},
  journal      = {Pattern Recognit.},
  volume       = {40},
  number       = {3},
  pages        = {1032--1041},
  year         = {2007},
  url          = {https://doi.org/10.1016/j.patcog.2006.04.038},
  doi          = {10.1016/J.PATCOG.2006.04.038},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/LiangZS07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/LamLZ07,
  author       = {Toby H. W. Lam and
                  Raymond S. T. Lee and
                  David Zhang},
  title        = {Human gait recognition by the fusion of motion and static spatio-temporal
                  templates},
  journal      = {Pattern Recognit.},
  volume       = {40},
  number       = {9},
  pages        = {2563--2573},
  year         = {2007},
  url          = {https://doi.org/10.1016/j.patcog.2006.11.014},
  doi          = {10.1016/J.PATCOG.2006.11.014},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/LamLZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/JingYZYL07,
  author       = {Xiao{-}Yuan Jing and
                  Yong{-}Fang Yao and
                  David Zhang and
                  Jing{-}Yu Yang and
                  Miao Li},
  title        = {Face and palmprint pixel level fusion and Kernel {DCV-RBF} classifier
                  for small sample biometric recognition},
  journal      = {Pattern Recognit.},
  volume       = {40},
  number       = {11},
  pages        = {3209--3224},
  year         = {2007},
  url          = {https://doi.org/10.1016/j.patcog.2007.01.034},
  doi          = {10.1016/J.PATCOG.2007.01.034},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/JingYZYL07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tifs/KumarZ07,
  author       = {Ajay Kumar and
                  David Zhang},
  title        = {Hand-Geometry Recognition Using Entropy-Based Discretization},
  journal      = {{IEEE} Trans. Inf. Forensics Secur.},
  volume       = {2},
  number       = {2},
  pages        = {181--187},
  year         = {2007},
  url          = {https://doi.org/10.1109/TIFS.2007.896915},
  doi          = {10.1109/TIFS.2007.896915},
  timestamp    = {Thu, 06 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tifs/KumarZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/LiuZY07,
  author       = {L. Liu and
                  David Zhang and
                  Jane You},
  title        = {Detecting Wide Lines Using Isotropic Nonlinear Filtering},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {16},
  number       = {6},
  pages        = {1584--1595},
  year         = {2007},
  url          = {https://doi.org/10.1109/TIP.2007.894288},
  doi          = {10.1109/TIP.2007.894288},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/LiuZY07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/ZhangWZ07,
  author       = {Lei Zhang and
                  Xiaolin Wu and
                  David Zhang},
  title        = {Color Reproduction From Noisy {CFA} Data of Single Sensor Digital
                  Cameras},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {16},
  number       = {9},
  pages        = {2184--2197},
  year         = {2007},
  url          = {https://doi.org/10.1109/TIP.2007.901807},
  doi          = {10.1109/TIP.2007.901807},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/ZhangWZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/YangZY07,
  author       = {Jian Yang and
                  David Zhang and
                  Jing{-}Yu Yang},
  title        = {Constructing {PCA} Baseline Algorithms to Reevaluate ICA-Based Face-Recognition
                  Performance},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {B}},
  volume       = {37},
  number       = {4},
  pages        = {1015--1021},
  year         = {2007},
  url          = {https://doi.org/10.1109/TSMCB.2007.891541},
  doi          = {10.1109/TSMCB.2007.891541},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/YangZY07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/GaoZZY07,
  author       = {Quanxue Gao and
                  Lei Zhang and
                  David Zhang and
                  Jian Yang},
  title        = {Comments on "On Image Matrix Based Feature Extraction Algorithms"},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {B}},
  volume       = {37},
  number       = {5},
  pages        = {1373--1374},
  year         = {2007},
  url          = {https://doi.org/10.1109/TSMCB.2007.899415},
  doi          = {10.1109/TSMCB.2007.899415},
  timestamp    = {Mon, 18 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/GaoZZY07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/SongZMG07,
  author       = {Fengxi Song and
                  David Zhang and
                  Dayong Mei and
                  Zhongwei Guo},
  title        = {A Multiple Maximum Scatter Difference Discriminant Criterion for Facial
                  Feature Extraction},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {B}},
  volume       = {37},
  number       = {6},
  pages        = {1599--1606},
  year         = {2007},
  url          = {https://doi.org/10.1109/TSMCB.2007.906579},
  doi          = {10.1109/TSMCB.2007.906579},
  timestamp    = {Mon, 18 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/SongZMG07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvt/ZhouGZ07,
  author       = {Jie Zhou and
                  Dashan Gao and
                  David Zhang},
  title        = {Moving Vehicle Detection for Automatic Traffic Monitoring},
  journal      = {{IEEE} Trans. Veh. Technol.},
  volume       = {56},
  number       = {1},
  pages        = {51--59},
  year         = {2007},
  url          = {https://doi.org/10.1109/TVT.2006.883735},
  doi          = {10.1109/TVT.2006.883735},
  timestamp    = {Wed, 16 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tvt/ZhouGZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/IEEEicci/LinZSXZ07,
  author       = {Fen Lin and
                  David Dapeng Zhang and
                  Zhongzhi Shi and
                  Minjie Xu and
                  Yuanbing Zhou},
  editor       = {Du Zhang and
                  Yingxu Wang and
                  Witold Kinsner},
  title        = {A Novel Simulation Approach For Estimating Residential Power Demand
                  Based on Multi-Agent Society},
  booktitle    = {Proceedings of the Six {IEEE} International Conference on Cognitive
                  Informatics, {ICCI} 2007, August 6-8, Lake Tahoe, CA, {USA}},
  pages        = {450--455},
  publisher    = {{IEEE} Computer Society},
  year         = {2007},
  url          = {https://doi.org/10.1109/COGINF.2007.4341923},
  doi          = {10.1109/COGINF.2007.4341923},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/IEEEicci/LinZSXZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/adma/WuZWQ07,
  author       = {Xiangqian Wu and
                  David Zhang and
                  Kuanquan Wang and
                  Ning Qi},
  editor       = {Reda Alhajj and
                  Hong Gao and
                  Xue Li and
                  Jianzhong Li and
                  Osmar R. Za{\"{\i}}ane},
  title        = {Fusion of Palmprint and Iris for Personal Authentication},
  booktitle    = {Advanced Data Mining and Applications, Third International Conference,
                  {ADMA} 2007, Harbin, China, August 6-8, 2007, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4632},
  pages        = {466--475},
  publisher    = {Springer},
  year         = {2007},
  url          = {https://doi.org/10.1007/978-3-540-73871-8\_43},
  doi          = {10.1007/978-3-540-73871-8\_43},
  timestamp    = {Mon, 31 Aug 2020 16:04:32 +0200},
  biburl       = {https://dblp.org/rec/conf/adma/WuZWQ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/emmcvpr/WuWZQ07,
  author       = {Xiangqian Wu and
                  Kuanquan Wang and
                  David Zhang and
                  Ning Qi},
  editor       = {Alan L. Yuille and
                  Song Chun Zhu and
                  Daniel Cremers and
                  Yongtian Wang},
  title        = {Combining Left and Right Irises for Personal Authentication},
  booktitle    = {Energy Minimization Methods in Computer Vision and Pattern Recognition,
                  6th International Conference, {EMMCVPR} 2007, Ezhou, China, August
                  27-29, 2007, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4679},
  pages        = {145--152},
  publisher    = {Springer},
  year         = {2007},
  url          = {https://doi.org/10.1007/978-3-540-74198-5\_12},
  doi          = {10.1007/978-3-540-74198-5\_12},
  timestamp    = {Tue, 14 May 2019 10:00:54 +0200},
  biburl       = {https://dblp.org/rec/conf/emmcvpr/WuWZQ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/KumarZ07,
  author       = {Ajay Kumar and
                  David Zhang},
  title        = {Biometric Recognition using Entropy-Based Discretization},
  booktitle    = {Proceedings of the {IEEE} International Conference on Acoustics, Speech,
                  and Signal Processing, {ICASSP} 2007, Honolulu, Hawaii, USA, April
                  15-20, 2007},
  pages        = {125--128},
  publisher    = {{IEEE}},
  year         = {2007},
  url          = {https://doi.org/10.1109/ICASSP.2007.366188},
  doi          = {10.1109/ICASSP.2007.366188},
  timestamp    = {Mon, 22 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icassp/KumarZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/WanZZ07,
  author       = {Dingrui Wan and
                  Jie Zhou and
                  David Zhang},
  title        = {A Spherical Rectification for Dual-PTZ-Camera System},
  booktitle    = {Proceedings of the {IEEE} International Conference on Acoustics, Speech,
                  and Signal Processing, {ICASSP} 2007, Honolulu, Hawaii, USA, April
                  15-20, 2007},
  pages        = {777--780},
  publisher    = {{IEEE}},
  year         = {2007},
  url          = {https://doi.org/10.1109/ICASSP.2007.366023},
  doi          = {10.1109/ICASSP.2007.366023},
  timestamp    = {Mon, 22 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icassp/WanZZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/ZhouGZ07,
  author       = {Jie Zhou and
                  Jinwei Gu and
                  David Zhang},
  editor       = {Seong{-}Whan Lee and
                  Stan Z. Li},
  title        = {Singular Points Analysis in Fingerprints Based on Topological Structure
                  and Orientation Field},
  booktitle    = {Advances in Biometrics, International Conference, {ICB} 2007, Seoul,
                  Korea, August 27-29, 2007, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4642},
  pages        = {261--270},
  publisher    = {Springer},
  year         = {2007},
  url          = {https://doi.org/10.1007/978-3-540-74549-5\_28},
  doi          = {10.1007/978-3-540-74549-5\_28},
  timestamp    = {Wed, 16 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icb/ZhouGZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/ZhaoLZL07,
  author       = {Tuo Zhao and
                  Zhizheng Liang and
                  David Zhang and
                  Yahui Liu},
  editor       = {Seong{-}Whan Lee and
                  Stan Z. Li},
  title        = {A Novel Null Space-Based Kernel Discriminant Analysis for Face Recognition},
  booktitle    = {Advances in Biometrics, International Conference, {ICB} 2007, Seoul,
                  Korea, August 27-29, 2007, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4642},
  pages        = {547--556},
  publisher    = {Springer},
  year         = {2007},
  url          = {https://doi.org/10.1007/978-3-540-74549-5\_58},
  doi          = {10.1007/978-3-540-74549-5\_58},
  timestamp    = {Thu, 17 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icb/ZhaoLZL07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/LiWZ07,
  author       = {Bin Li and
                  Kuanquan Wang and
                  David Zhang},
  editor       = {Seong{-}Whan Lee and
                  Stan Z. Li},
  title        = {Minimizing Spatial Deformation Method for Online Signature Matching},
  booktitle    = {Advances in Biometrics, International Conference, {ICB} 2007, Seoul,
                  Korea, August 27-29, 2007, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4642},
  pages        = {646--652},
  publisher    = {Springer},
  year         = {2007},
  url          = {https://doi.org/10.1007/978-3-540-74549-5\_68},
  doi          = {10.1007/978-3-540-74549-5\_68},
  timestamp    = {Tue, 25 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icb/LiWZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/WuZW07,
  author       = {Xiangqian Wu and
                  David Zhang and
                  Kuanquan Wang},
  editor       = {Seong{-}Whan Lee and
                  Stan Z. Li},
  title        = {A Palmprint Cryptosystem},
  booktitle    = {Advances in Biometrics, International Conference, {ICB} 2007, Seoul,
                  Korea, August 27-29, 2007, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4642},
  pages        = {1035--1042},
  publisher    = {Springer},
  year         = {2007},
  url          = {https://doi.org/10.1007/978-3-540-74549-5\_108},
  doi          = {10.1007/978-3-540-74549-5\_108},
  timestamp    = {Thu, 27 Sep 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icb/WuZW07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/ZhangLYS07,
  author       = {David Zhang and
                  Zhi Liu and
                  Jingqi Yan and
                  Pengfei Shi},
  editor       = {Seong{-}Whan Lee and
                  Stan Z. Li},
  title        = {Tongue-Print: {A} Novel Biometrics Pattern},
  booktitle    = {Advances in Biometrics, International Conference, {ICB} 2007, Seoul,
                  Korea, August 27-29, 2007, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4642},
  pages        = {1174--1183},
  publisher    = {Springer},
  year         = {2007},
  url          = {https://doi.org/10.1007/978-3-540-74549-5\_122},
  doi          = {10.1007/978-3-540-74549-5\_122},
  timestamp    = {Thu, 17 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icb/ZhangLYS07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iciap/ZhangGZ07,
  author       = {Lei Zhang and
                  Quanxue Gao and
                  David Zhang},
  editor       = {Rita Cucchiara},
  title        = {Block Independent Component Analysis for Face Recognition},
  booktitle    = {14th International Conference on Image Analysis and Processing {(ICIAP}
                  2007), 10-14 September 2007, Modena, Italy},
  pages        = {217--222},
  publisher    = {{IEEE} Computer Society},
  year         = {2007},
  url          = {https://doi.org/10.1109/ICIAP.2007.4362782},
  doi          = {10.1109/ICIAP.2007.4362782},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iciap/ZhangGZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icic/ZuoWZZ07,
  author       = {Wangmeng Zuo and
                  Kuanquan Wang and
                  Hongzhi Zhang and
                  David Zhang},
  editor       = {De{-}Shuang Huang and
                  Laurent Heutte and
                  Marco Loog},
  title        = {Kernel Difference-Weighted k-Nearest Neighbors Classification},
  booktitle    = {Advanced Intelligent Computing Theories and Applications. With Aspects
                  of Artificial Intelligence, Third International Conference on Intelligent
                  Computing, {ICIC} 2007, Qingdao, China, August 21-24, 2007, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4682},
  pages        = {861--870},
  publisher    = {Springer},
  year         = {2007},
  url          = {https://doi.org/10.1007/978-3-540-74205-0\_89},
  doi          = {10.1007/978-3-540-74205-0\_89},
  timestamp    = {Tue, 14 May 2019 10:00:53 +0200},
  biburl       = {https://dblp.org/rec/conf/icic/ZuoWZZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/ZhangGWZ07,
  author       = {Lei Zhang and
                  Zhenhua Guo and
                  Zhou Wang and
                  David Zhang},
  title        = {Palmprint Verification using Complex Wavelet Transform},
  booktitle    = {Proceedings of the International Conference on Image Processing, {ICIP}
                  2007, September 16-19, 2007, San Antonio, Texas, {USA}},
  pages        = {417--420},
  publisher    = {{IEEE}},
  year         = {2007},
  url          = {https://doi.org/10.1109/ICIP.2007.4379181},
  doi          = {10.1109/ICIP.2007.4379181},
  timestamp    = {Fri, 30 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icip/ZhangGWZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icnc/ZhaoZLZ07,
  author       = {Tianwen Zhao and
                  Qijun Zhao and
                  Hongtao Lu and
                  David Zhang},
  editor       = {Jingsheng Lei and
                  JingTao Yao and
                  Qingfu Zhang},
  title        = {Bagging Evolutionary Feature Extraction Algorithm for Classification},
  booktitle    = {Third International Conference on Natural Computation, {ICNC} 2007,
                  Haikou, Hainan, China, 24-27 August 2007, Volume 3},
  pages        = {540--545},
  publisher    = {{IEEE} Computer Society},
  year         = {2007},
  url          = {https://doi.org/10.1109/ICNC.2007.280},
  doi          = {10.1109/ICNC.2007.280},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icnc/ZhaoZLZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iih-msp/ShenXLZ07,
  author       = {Bo Shen and
                  Yong Xu and
                  Guangming Lu and
                  David Zhang},
  editor       = {Bin{-}Yih Liao and
                  Jeng{-}Shyang Pan and
                  Lakhmi C. Jain and
                  Mark Liao and
                  Hideki Noda and
                  Anthony T. S. Ho},
  title        = {Detecting Iris Lacunae Based on Gaussian Filter},
  booktitle    = {3rd International Conference on Intelligent Information Hiding and
                  Multimedia Signal Processing {(IIH-MSP} 2007), Kaohsiung, Taiwan,
                  26-28 November 2007, Proceedings},
  pages        = {233--236},
  publisher    = {{IEEE} Computer Society},
  year         = {2007},
  url          = {https://doi.org/10.1109/IIHMSP.2007.4457533},
  doi          = {10.1109/IIHMSP.2007.4457533},
  timestamp    = {Fri, 24 Mar 2023 08:33:27 +0100},
  biburl       = {https://dblp.org/rec/conf/iih-msp/ShenXLZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isnn/ZuoWZY07,
  author       = {Wangmeng Zuo and
                  Kuanquan Wang and
                  David Zhang and
                  Feng Yue},
  editor       = {Derong Liu and
                  Shumin Fei and
                  Zeng{-}Guang Hou and
                  Huaguang Zhang and
                  Changyin Sun},
  title        = {Iteratively Reweighted Fitting for Reduced Multivariate Polynomial
                  Model},
  booktitle    = {Advances in Neural Networks - {ISNN} 2007, 4th International Symposium
                  on Neural Networks, {ISNN} 2007, Nanjing, China, June 3-7, 2007, Proceedings,
                  Part {II}},
  series       = {Lecture Notes in Computer Science},
  volume       = {4492},
  pages        = {583--592},
  publisher    = {Springer},
  year         = {2007},
  url          = {https://doi.org/10.1007/978-3-540-72393-6\_70},
  doi          = {10.1007/978-3-540-72393-6\_70},
  timestamp    = {Tue, 14 May 2019 10:00:36 +0200},
  biburl       = {https://dblp.org/rec/conf/isnn/ZuoWZY07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwec/WuWZ07,
  author       = {Xiangqian Wu and
                  Kuanquan Wang and
                  David Zhang},
  editor       = {Lizhuang Ma and
                  Matthias Rauterberg and
                  Ryohei Nakatsu},
  title        = {Automated Personal Authentication Using Both Palmprints},
  booktitle    = {Entertainment Computing - {ICEC} 2007, 6th International Conference,
                  Shanghai, China, September 15-17, 2007, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4740},
  pages        = {450--453},
  publisher    = {Springer},
  year         = {2007},
  url          = {https://doi.org/10.1007/978-3-540-74873-1\_58},
  doi          = {10.1007/978-3-540-74873-1\_58},
  timestamp    = {Fri, 27 Mar 2020 09:01:01 +0100},
  biburl       = {https://dblp.org/rec/conf/iwec/WuWZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/sci/LiZ07,
  author       = {Yanlai Li and
                  David Zhang},
  editor       = {Ke Chen and
                  Lipo Wang},
  title        = {Modular Neural Networks and Their Applications in Biometrics},
  booktitle    = {Trends in Neural Computation},
  series       = {Studies in Computational Intelligence},
  volume       = {35},
  pages        = {337--365},
  publisher    = {Springer},
  year         = {2007},
  url          = {https://doi.org/10.1007/978-3-540-36122-0\_14},
  doi          = {10.1007/978-3-540-36122-0\_14},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/series/sci/LiZ07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/smpai/LuZKL07,
  author       = {Guangming Lu and
                  David Zhang and
                  Adams Wai{-}Kin Kong and
                  Qingmin Liao},
  editor       = {Svetlana N. Yanushkevich and
                  Marina L. Gavrilova and
                  Patrick S. P. Wang and
                  Sargur N. Srihari},
  title        = {Palmprint Identification by Fused Wavelet Characteristics},
  booktitle    = {Image Pattern Recognition - Synthesis and Analysis in Biometrics},
  series       = {Series in Machine Perception and Artificial Intelligence},
  volume       = {67},
  pages        = {225--242},
  publisher    = {WorldScientific},
  year         = {2007},
  url          = {https://doi.org/10.1142/9789812770677\_0009},
  doi          = {10.1142/9789812770677\_0009},
  timestamp    = {Sun, 25 Jul 2021 11:34:35 +0200},
  biburl       = {https://dblp.org/rec/series/smpai/LuZKL07.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ejasp/XuZWW06,
  author       = {Lisheng Xu and
                  David Zhang and
                  Kuanquan Wang and
                  Lu Wang},
  title        = {Arrhythmic Pulses Detection Using Lempel-Ziv Complexity Analysis},
  journal      = {{EURASIP} J. Adv. Signal Process.},
  volume       = {2006},
  year         = {2006},
  url          = {https://doi.org/10.1155/ASP/2006/18268},
  doi          = {10.1155/ASP/2006/18268},
  timestamp    = {Sat, 05 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ejasp/XuZWW06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijig/LiPZ06,
  author       = {Li Li and
                  Zhigeng Pan and
                  David Zhang},
  title        = {A Public Mesh Watermarking Algorithm Based on Addition Property of
                  Fourier Transform},
  journal      = {Int. J. Image Graph.},
  volume       = {6},
  number       = {1},
  pages        = {35--44},
  year         = {2006},
  url          = {https://doi.org/10.1142/S0219467806002070},
  doi          = {10.1142/S0219467806002070},
  timestamp    = {Tue, 24 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijig/LiPZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijig/KumarZ06,
  author       = {Ajay Kumar and
                  David Zhang},
  title        = {Integrating Shape and Texture for Hand Verification},
  journal      = {Int. J. Image Graph.},
  volume       = {6},
  number       = {1},
  pages        = {101--114},
  year         = {2006},
  url          = {https://doi.org/10.1142/S0219467806002148},
  doi          = {10.1142/S0219467806002148},
  timestamp    = {Tue, 24 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijig/KumarZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijig/LiZW06,
  author       = {Bin Li and
                  David Zhang and
                  Kuanquan Wang},
  title        = {Online Signature Verification by Combining Shape Contexts and Local
                  Features},
  journal      = {Int. J. Image Graph.},
  volume       = {6},
  number       = {3},
  pages        = {407--420},
  year         = {2006},
  url          = {https://doi.org/10.1142/S0219467806002318},
  doi          = {10.1142/S0219467806002318},
  timestamp    = {Tue, 25 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijig/LiZW06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/LiangZS06,
  author       = {Zhizheng Liang and
                  David Zhang and
                  Pengfei Shi},
  title        = {Robust kernel discriminant analysis and its application to feature
                  extraction and recognition},
  journal      = {Neurocomputing},
  volume       = {69},
  number       = {7-9},
  pages        = {928--933},
  year         = {2006},
  url          = {https://doi.org/10.1016/j.neucom.2005.09.001},
  doi          = {10.1016/J.NEUCOM.2005.09.001},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/LiangZS06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/SongZY06,
  author       = {Fengxi Song and
                  David Zhang and
                  Jing{-}Yu Yang},
  title        = {A novel dimensionality-reduction approach for face recognition},
  journal      = {Neurocomputing},
  volume       = {69},
  number       = {13-15},
  pages        = {1683--1687},
  year         = {2006},
  url          = {https://doi.org/10.1016/j.neucom.2006.01.016},
  doi          = {10.1016/J.NEUCOM.2006.01.016},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijon/SongZY06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/YangZY06,
  author       = {Jian Yang and
                  David Zhang and
                  Jing{-}Yu Yang},
  title        = {Locally principal component learning for face representation and recognition},
  journal      = {Neurocomputing},
  volume       = {69},
  number       = {13-15},
  pages        = {1697--1701},
  year         = {2006},
  url          = {https://doi.org/10.1016/j.neucom.2006.01.009},
  doi          = {10.1016/J.NEUCOM.2006.01.009},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijon/YangZY06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/FengHZZ06,
  author       = {Guiyu Feng and
                  Dewen Hu and
                  David Zhang and
                  Zongtan Zhou},
  title        = {An alternative formulation of kernel {LPP} with application to image
                  recognition},
  journal      = {Neurocomputing},
  volume       = {69},
  number       = {13-15},
  pages        = {1733--1738},
  year         = {2006},
  url          = {https://doi.org/10.1016/j.neucom.2006.01.006},
  doi          = {10.1016/J.NEUCOM.2006.01.006},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/FengHZZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/LiuYZ06,
  author       = {Heng Liu and
                  Jingqi Yan and
                  David Zhang},
  title        = {Three-dimensional surface registration: {A} neural network strategy},
  journal      = {Neurocomputing},
  volume       = {70},
  number       = {1-3},
  pages        = {597--602},
  year         = {2006},
  url          = {https://doi.org/10.1016/j.neucom.2006.04.004},
  doi          = {10.1016/J.NEUCOM.2006.04.004},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/LiuYZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/imst/ZhangZWZ06,
  author       = {Hongzhi Zhang and
                  Wangmeng Zuo and
                  Kuanquan Wang and
                  David Zhang},
  title        = {A snake-based approach to automated segmentation of tongue image using
                  polar edge detector},
  journal      = {Int. J. Imaging Syst. Technol.},
  volume       = {16},
  number       = {4},
  pages        = {103--112},
  year         = {2006},
  url          = {https://doi.org/10.1002/ima.20075},
  doi          = {10.1002/IMA.20075},
  timestamp    = {Thu, 18 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/imst/ZhangZWZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npl/LiZW06,
  author       = {Yanlai Li and
                  David Zhang and
                  Kuanquan Wang},
  title        = {Parameter by Parameter Algorithm for Multilayer Perceptrons},
  journal      = {Neural Process. Lett.},
  volume       = {23},
  number       = {2},
  pages        = {229--242},
  year         = {2006},
  url          = {https://doi.org/10.1007/s11063-006-0003-9},
  doi          = {10.1007/S11063-006-0003-9},
  timestamp    = {Thu, 09 Jul 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/npl/LiZW06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/paa/LiZW06,
  author       = {Bin Li and
                  David Zhang and
                  Kuanquan Wang},
  title        = {Online signature verification based on null component analysis and
                  principal component analysis},
  journal      = {Pattern Anal. Appl.},
  volume       = {8},
  number       = {4},
  pages        = {345--356},
  year         = {2006},
  url          = {https://doi.org/10.1007/s10044-005-0016-4},
  doi          = {10.1007/S10044-005-0016-4},
  timestamp    = {Tue, 25 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/paa/LiZW06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/paa/WuZW06,
  author       = {Xiangqian Wu and
                  David Zhang and
                  Kuanquan Wang},
  title        = {Fusion of phase and orientation information for palmprint authentication},
  journal      = {Pattern Anal. Appl.},
  volume       = {9},
  number       = {2-3},
  pages        = {103--111},
  year         = {2006},
  url          = {https://doi.org/10.1007/s10044-005-0006-6},
  doi          = {10.1007/S10044-005-0006-6},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/paa/WuZW06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ZhaoLZ06,
  author       = {Qijun Zhao and
                  Hongtao Lu and
                  David Zhang},
  title        = {A fast evolutionary pursuit algorithm based on linearly combining
                  vectors},
  journal      = {Pattern Recognit.},
  volume       = {39},
  number       = {2},
  pages        = {310--312},
  year         = {2006},
  url          = {https://doi.org/10.1016/j.patcog.2005.09.001},
  doi          = {10.1016/J.PATCOG.2005.09.001},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/ZhaoLZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/KongZK06,
  author       = {Adams Wai{-}Kin Kong and
                  David Zhang and
                  Mohamed Kamel},
  title        = {Palmprint identification using feature-level fusion},
  journal      = {Pattern Recognit.},
  volume       = {39},
  number       = {3},
  pages        = {478--487},
  year         = {2006},
  url          = {https://doi.org/10.1016/j.patcog.2005.08.014},
  doi          = {10.1016/J.PATCOG.2005.08.014},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/KongZK06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/JingWZ06,
  author       = {Xiao{-}Yuan Jing and
                  Hau{-}San Wong and
                  David Zhang},
  title        = {Face recognition based on 2D Fisherface approach},
  journal      = {Pattern Recognit.},
  volume       = {39},
  number       = {4},
  pages        = {707--710},
  year         = {2006},
  url          = {https://doi.org/10.1016/j.patcog.2005.10.020},
  doi          = {10.1016/J.PATCOG.2005.10.020},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/JingWZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/XuZJLY06,
  author       = {Yong Xu and
                  David Zhang and
                  Zhong Jin and
                  Miao Li and
                  Jing{-}Yu Yang},
  title        = {A fast kernel-based nonlinear discriminant analysis for multi-class
                  problems},
  journal      = {Pattern Recognit.},
  volume       = {39},
  number       = {6},
  pages        = {1026--1033},
  year         = {2006},
  url          = {https://doi.org/10.1016/j.patcog.2005.10.029},
  doi          = {10.1016/J.PATCOG.2005.10.029},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/XuZJLY06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/KongCZKY06,
  author       = {Adams Wai{-}Kin Kong and
                  King Hong Cheung and
                  David Zhang and
                  Mohamed S. Kamel and
                  Jane You},
  title        = {An analysis of BioHashing and its variants},
  journal      = {Pattern Recognit.},
  volume       = {39},
  number       = {7},
  pages        = {1359--1368},
  year         = {2006},
  url          = {https://doi.org/10.1016/j.patcog.2005.10.025},
  doi          = {10.1016/J.PATCOG.2005.10.025},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/KongCZKY06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/KongZL06,
  author       = {Adams Wai{-}Kin Kong and
                  David Zhang and
                  Guangming Lu},
  title        = {A study of identical twins' palmprints for personal verification},
  journal      = {Pattern Recognit.},
  volume       = {39},
  number       = {11},
  pages        = {2149--2156},
  year         = {2006},
  url          = {https://doi.org/10.1016/j.patcog.2006.04.035},
  doi          = {10.1016/J.PATCOG.2006.04.035},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/KongZL06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/LiuYZ06,
  author       = {Heng Liu and
                  Jingqi Yan and
                  David Zhang},
  title        = {What is wrong with mesh {PCA} in coordinate direction normalization},
  journal      = {Pattern Recognit.},
  volume       = {39},
  number       = {11},
  pages        = {2244--2247},
  year         = {2006},
  url          = {https://doi.org/10.1016/j.patcog.2006.05.019},
  doi          = {10.1016/J.PATCOG.2006.05.019},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/LiuYZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/ZuoZW06,
  author       = {Wangmeng Zuo and
                  David Zhang and
                  Kuanquan Wang},
  title        = {An assembled matrix distance metric for 2DPCA-based image recognition},
  journal      = {Pattern Recognit. Lett.},
  volume       = {27},
  number       = {3},
  pages        = {210--216},
  year         = {2006},
  url          = {https://doi.org/10.1016/j.patrec.2005.08.017},
  doi          = {10.1016/J.PATREC.2005.08.017},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/prl/ZuoZW06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/JingWZ06,
  author       = {Xiao{-}Yuan Jing and
                  Hau{-}San Wong and
                  David Zhang},
  title        = {Face recognition based on discriminant fractional Fourier feature
                  extraction},
  journal      = {Pattern Recognit. Lett.},
  volume       = {27},
  number       = {13},
  pages        = {1465--1471},
  year         = {2006},
  url          = {https://doi.org/10.1016/j.patrec.2006.02.020},
  doi          = {10.1016/J.PATREC.2006.02.020},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/prl/JingWZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/KumarZ06,
  author       = {Ajay Kumar and
                  David Zhang},
  title        = {Personal recognition using hand shape and texture},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {15},
  number       = {8},
  pages        = {2454--2461},
  year         = {2006},
  url          = {https://doi.org/10.1109/TIP.2006.875214},
  doi          = {10.1109/TIP.2006.875214},
  timestamp    = {Sun, 10 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/KumarZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/ZuoZW06,
  author       = {Wangmeng Zuo and
                  David Zhang and
                  Kuanquan Wang},
  title        = {Bidirectional {PCA} with assembled matrix distance metric for image
                  recognition},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {B}},
  volume       = {36},
  number       = {4},
  pages        = {863--872},
  year         = {2006},
  url          = {https://doi.org/10.1109/TSMCB.2006.872274},
  doi          = {10.1109/TSMCB.2006.872274},
  timestamp    = {Sat, 30 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/ZuoZW06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/ZuoZYW06,
  author       = {Wangmeng Zuo and
                  David Zhang and
                  Jian Yang and
                  Kuanquan Wang},
  title        = {{BDPCA} plus {LDA:} a novel fast feature extraction technique for
                  face recognition},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {B}},
  volume       = {36},
  number       = {4},
  pages        = {946--953},
  year         = {2006},
  url          = {https://doi.org/10.1109/TSMCB.2005.863377},
  doi          = {10.1109/TSMCB.2005.863377},
  timestamp    = {Sat, 30 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/ZuoZYW06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/WuZW06,
  author       = {Xiangqian Wu and
                  David Zhang and
                  Kuanquan Wang},
  title        = {Palm line extraction and matching for personal authentication},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {A}},
  volume       = {36},
  number       = {5},
  pages        = {978--987},
  year         = {2006},
  url          = {https://doi.org/10.1109/TSMCA.2006.871797},
  doi          = {10.1109/TSMCA.2006.871797},
  timestamp    = {Mon, 25 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/WuZW06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/KongZK06,
  author       = {Adams Wai{-}Kin Kong and
                  David Zhang and
                  Mohamed Kamel},
  title        = {Analysis of Brute-Force Break-Ins of a Palmprint Authentication System},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {B}},
  volume       = {36},
  number       = {5},
  pages        = {1201--1205},
  year         = {2006},
  url          = {https://doi.org/10.1109/TSMCB.2006.876168},
  doi          = {10.1109/TSMCB.2006.876168},
  timestamp    = {Sat, 30 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/KongZK06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvcg/YanYSZ06,
  author       = {Jingqi Yan and
                  Xin Yang and
                  Pengfei Shi and
                  David Zhang},
  title        = {Mesh Parameterization by Minimizing the Synthesized Distortion Metric
                  with the Coefficient-Optimizing Algorithm},
  journal      = {{IEEE} Trans. Vis. Comput. Graph.},
  volume       = {12},
  number       = {1},
  pages        = {83--92},
  year         = {2006},
  url          = {https://doi.org/10.1109/TVCG.2006.10},
  doi          = {10.1109/TVCG.2006.10},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tvcg/YanYSZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaai/ZhaoZL06,
  author       = {Qijun Zhao and
                  David Zhang and
                  Hongtao Lu},
  title        = {A Direct Evolutionary Feature Extraction Algorithm for Classifying
                  High Dimensional Data},
  booktitle    = {Proceedings, The Twenty-First National Conference on Artificial Intelligence
                  and the Eighteenth Innovative Applications of Artificial Intelligence
                  Conference, July 16-20, 2006, Boston, Massachusetts, {USA}},
  pages        = {561--566},
  publisher    = {{AAAI} Press},
  year         = {2006},
  url          = {http://www.aaai.org/Library/AAAI/2006/aaai06-090.php},
  timestamp    = {Tue, 05 Sep 2023 09:10:47 +0200},
  biburl       = {https://dblp.org/rec/conf/aaai/ZhaoZL06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/accv/LiangSZ06,
  author       = {Zhizheng Liang and
                  Pengfei Shi and
                  David Zhang},
  editor       = {P. J. Narayanan and
                  Shree K. Nayar and
                  Heung{-}Yeung Shum},
  title        = {Two-Dimensional Fisher Discriminant Analysis and Its Application to
                  Face Recognition},
  booktitle    = {Computer Vision - {ACCV} 2006, 7th Asian Conference on Computer Vision,
                  Hyderabad, India, January 13-16, 2006, Proceedings, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {3851},
  pages        = {130--139},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11612032\_14},
  doi          = {10.1007/11612032\_14},
  timestamp    = {Thu, 17 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/accv/LiangSZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icarcv/YangZY06,
  author       = {Jian Yang and
                  David Zhang and
                  Jing{-}Yu Yang},
  title        = {"Non-locality" Preserving Projection and Its Application
                  to Palmprint Recognition},
  booktitle    = {Ninth International Conference on Control, Automation, Robotics and
                  Vision, {ICARCV} 2006, Singapore, 5-8 December 2006, Proceedings},
  pages        = {1--4},
  publisher    = {{IEEE}},
  year         = {2006},
  url          = {https://doi.org/10.1109/ICARCV.2006.345339},
  doi          = {10.1109/ICARCV.2006.345339},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icarcv/YangZY06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/YangZXY06,
  author       = {Jian Yang and
                  David Zhang and
                  Yong Xu and
                  Jing{-}Yu Yang},
  editor       = {David Zhang and
                  Anil K. Jain},
  title        = {Recognize Color Face Images Using Complex Eigenfaces},
  booktitle    = {Advances in Biometrics, International Conference, {ICB} 2006, Hong
                  Kong, China, January 5-7, 2006, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3832},
  pages        = {64--68},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11608288\_9},
  doi          = {10.1007/11608288\_9},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icb/YangZXY06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/ZuoWZ06,
  author       = {Wangmeng Zuo and
                  Kuanquan Wang and
                  David Zhang},
  editor       = {David Zhang and
                  Anil K. Jain},
  title        = {Improvement on Null Space {LDA} for Face Recognition: {A} Symmetry
                  Consideration},
  booktitle    = {Advances in Biometrics, International Conference, {ICB} 2006, Hong
                  Kong, China, January 5-7, 2006, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3832},
  pages        = {78--84},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11608288\_11},
  doi          = {10.1007/11608288\_11},
  timestamp    = {Tue, 26 Jun 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icb/ZuoWZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/CheungKZKY06,
  author       = {King Hong Cheung and
                  Adams Wai{-}Kin Kong and
                  David Zhang and
                  Mohamed Kamel and
                  Jane You},
  editor       = {David Zhang and
                  Anil K. Jain},
  title        = {Revealing the Secret of FaceHashing},
  booktitle    = {Advances in Biometrics, International Conference, {ICB} 2006, Hong
                  Kong, China, January 5-7, 2006, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3832},
  pages        = {106--112},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11608288\_15},
  doi          = {10.1007/11608288\_15},
  timestamp    = {Tue, 26 Jun 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icb/CheungKZKY06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/YuWZ06,
  author       = {Li Yu and
                  Kuanquan Wang and
                  David Zhang},
  editor       = {David Zhang and
                  Anil K. Jain},
  title        = {A Novel Method for Coarse Iris Classification},
  booktitle    = {Advances in Biometrics, International Conference, {ICB} 2006, Hong
                  Kong, China, January 5-7, 2006, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3832},
  pages        = {404--410},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11608288\_54},
  doi          = {10.1007/11608288\_54},
  timestamp    = {Tue, 26 Jun 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icb/YuWZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/KongZL06,
  author       = {Adams Wai{-}Kin Kong and
                  David Zhang and
                  Guangming Lu},
  editor       = {David Zhang and
                  Anil K. Jain},
  title        = {A Study of Identical Twins' Palmprints for Personal Authentication},
  booktitle    = {Advances in Biometrics, International Conference, {ICB} 2006, Hong
                  Kong, China, January 5-7, 2006, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3832},
  pages        = {668--674},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11608288\_89},
  doi          = {10.1007/11608288\_89},
  timestamp    = {Tue, 26 Jun 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icb/KongZL06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icb/JingLZ06,
  author       = {Xiao{-}Yuan Jing and
                  Chen Lu and
                  David Zhang},
  editor       = {David Zhang and
                  Anil K. Jain},
  title        = {An Uncorrelated Fisherface Approach for Face and Palmprint Recognition},
  booktitle    = {Advances in Biometrics, International Conference, {ICB} 2006, Hong
                  Kong, China, January 5-7, 2006, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3832},
  pages        = {682--687},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11608288\_91},
  doi          = {10.1007/11608288\_91},
  timestamp    = {Tue, 26 Jun 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icb/JingLZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccsa/LiuYZ06,
  author       = {Heng Liu and
                  Jingqi Yan and
                  David Zhang},
  editor       = {Marina L. Gavrilova and
                  Osvaldo Gervasi and
                  Vipin Kumar and
                  Chih Jeng Kenneth Tan and
                  David Taniar and
                  Antonio Lagan{\`{a}} and
                  Youngsong Mun and
                  Hyunseung Choo},
  title        = {A Neural Network Strategy for 3D Surface Registration},
  booktitle    = {Computational Science and Its Applications - {ICCSA} 2006, International
                  Conference, Glasgow, UK, May 8-11, 2006, Proceedings, Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {3980},
  pages        = {528--536},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11751540\_56},
  doi          = {10.1007/11751540\_56},
  timestamp    = {Thu, 28 Apr 2022 16:17:38 +0200},
  biburl       = {https://dblp.org/rec/conf/iccsa/LiuYZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/LiZZB06,
  author       = {Qin Li and
                  Lei Zhang and
                  David Zhang and
                  Prabir Bhattacharya},
  title        = {A New Approach to Automated Retinal Vessel Segmentation Using Multiscale
                  Analysis},
  booktitle    = {18th International Conference on Pattern Recognition {(ICPR} 2006),
                  20-24 August 2006, Hong Kong, China},
  pages        = {77--80},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://doi.org/10.1109/ICPR.2006.112},
  doi          = {10.1109/ICPR.2006.112},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/LiZZB06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/KongZK06,
  author       = {Adams Wai{-}Kin Kong and
                  David Zhang and
                  Mohamed Kamel},
  title        = {An Anatomy of IrisCode for Precise Phase Representation},
  booktitle    = {18th International Conference on Pattern Recognition {(ICPR} 2006),
                  20-24 August 2006, Hong Kong, China},
  pages        = {429--432},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://doi.org/10.1109/ICPR.2006.234},
  doi          = {10.1109/ICPR.2006.234},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/KongZK06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/CheungKZKY06,
  author       = {King Hong Cheung and
                  Adams Wai{-}Kin Kong and
                  David Zhang and
                  Mohamed Kamel and
                  Jane You},
  title        = {Does EigenPalm work? {A} System and Evaluation Perspective},
  booktitle    = {18th International Conference on Pattern Recognition {(ICPR} 2006),
                  20-24 August 2006, Hong Kong, China},
  pages        = {445--448},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://doi.org/10.1109/ICPR.2006.460},
  doi          = {10.1109/ICPR.2006.460},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/CheungKZKY06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/KumarZ06,
  author       = {Ajay Kumar and
                  David Zhang},
  title        = {Combining Fingerprint, Palmprint and Hand-Shape for User Authentication},
  booktitle    = {18th International Conference on Pattern Recognition {(ICPR} 2006),
                  20-24 August 2006, Hong Kong, China},
  pages        = {549--552},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://doi.org/10.1109/ICPR.2006.383},
  doi          = {10.1109/ICPR.2006.383},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/KumarZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/YangZJY06,
  author       = {Jian Yang and
                  David Zhang and
                  Zhong Jin and
                  Jing{-}Yu Yang},
  title        = {Unsupervised Discriminant Projection Analysis for Feature Extraction},
  booktitle    = {18th International Conference on Pattern Recognition {(ICPR} 2006),
                  20-24 August 2006, Hong Kong, China},
  pages        = {904--907},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://doi.org/10.1109/ICPR.2006.1143},
  doi          = {10.1109/ICPR.2006.1143},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/YangZJY06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isda/WuWJZ06,
  author       = {Xiangqian Wu and
                  Kuanquan Wang and
                  Liao Jing and
                  David Zhang},
  title        = {Graph based Cross-shape Recognition for Palm Diagnosis},
  booktitle    = {Proceedings of the Sixth International Conference on Intelligent Systems
                  Design and Applications {(ISDA} 2006), October 16-18, 2006, Jinan,
                  China},
  pages        = {325--328},
  publisher    = {{IEEE} Computer Society},
  year         = {2006},
  url          = {https://doi.org/10.1109/ISDA.2006.253855},
  doi          = {10.1109/ISDA.2006.253855},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/isda/WuWJZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isnn/ZhaoLZ06,
  author       = {Qijun Zhao and
                  Hongtao Lu and
                  David Zhang},
  editor       = {Jun Wang and
                  Zhang Yi and
                  Jacek M. Zurada and
                  Bao{-}Liang Lu and
                  Hujun Yin},
  title        = {Parsimonious Feature Extraction Based on Genetic Algorithms and Support
                  Vector Machines},
  booktitle    = {Advances in Neural Networks - {ISNN} 2006, Third International Symposium
                  on Neural Networks, Chengdu, China, May 28 - June 1, 2006, Proceedings,
                  Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {3971},
  pages        = {1387--1393},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11759966\_206},
  doi          = {10.1007/11759966\_206},
  timestamp    = {Tue, 14 May 2019 10:00:36 +0200},
  biburl       = {https://dblp.org/rec/conf/isnn/ZhaoLZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pcm/WuWZ06,
  author       = {Xiangqian Wu and
                  Kuanquan Wang and
                  David Zhang},
  editor       = {Yueting Zhuang and
                  Shiqiang Yang and
                  Yong Rui and
                  Qinming He},
  title        = {Differential Operation Based Palmprint Authentication for Multimedia
                  Security},
  booktitle    = {Advances in Multimedia Information Processing - {PCM} 2006, 7th Pacific
                  Rim Conference on Multimedia, Hangzhou, China, November 2-4, 2006,
                  Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4261},
  pages        = {237--244},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11922162\_28},
  doi          = {10.1007/11922162\_28},
  timestamp    = {Tue, 14 May 2019 10:00:54 +0200},
  biburl       = {https://dblp.org/rec/conf/pcm/WuWZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pcm/ZuoWZ06,
  author       = {Wangmeng Zuo and
                  Kuanquan Wang and
                  David Zhang},
  editor       = {Yueting Zhuang and
                  Shiqiang Yang and
                  Yong Rui and
                  Qinming He},
  title        = {Robust Recognition of Noisy and Partially Occluded Faces Using Iteratively
                  Reweighted Fitting of Eigenfaces},
  booktitle    = {Advances in Multimedia Information Processing - {PCM} 2006, 7th Pacific
                  Rim Conference on Multimedia, Hangzhou, China, November 2-4, 2006,
                  Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4261},
  pages        = {844--851},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11922162\_96},
  doi          = {10.1007/11922162\_96},
  timestamp    = {Sat, 16 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pcm/ZuoWZ06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/psivt/SongZCY06,
  author       = {Fengxi Song and
                  David Zhang and
                  Qinglong Chen and
                  Jing{-}Yu Yang},
  editor       = {Long{-}Wen Chang and
                  Wen{-}Nung Lie},
  title        = {A Novel Supervised Dimensionality Reduction Algorithm for Online Image
                  Recognition},
  booktitle    = {Advances in Image and Video Technology, First Pacific Rim Symposium,
                  {PSIVT} 2006, Hsinchu, Taiwan, December 10-13, 2006, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {4319},
  pages        = {198--207},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11949534\_20},
  doi          = {10.1007/11949534\_20},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/psivt/SongZCY06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/YangZY06,
  author       = {Jian Yang and
                  David Zhang and
                  Jing{-}Yu Yang},
  title        = {Median {LDA:} {A} Robust Feature Extraction Method for Face Recognition},
  booktitle    = {Proceedings of the {IEEE} International Conference on Systems, Man
                  and Cybernetics, Taipei, Taiwan, October 8-11, 2006},
  pages        = {4208--4213},
  publisher    = {{IEEE}},
  year         = {2006},
  url          = {https://doi.org/10.1109/ICSMC.2006.384795},
  doi          = {10.1109/ICSMC.2006.384795},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/smc/YangZY06.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icb/2006,
  editor       = {David Zhang and
                  Anil K. Jain},
  title        = {Advances in Biometrics, International Conference, {ICB} 2006, Hong
                  Kong, China, January 5-7, 2006, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3832},
  publisher    = {Springer},
  year         = {2006},
  url          = {https://doi.org/10.1007/11608288},
  doi          = {10.1007/11608288},
  isbn         = {3-540-31111-4},
  timestamp    = {Thu, 17 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icb/2006.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/automatica/ZhangXSZ05,
  author       = {Huanshui Zhang and
                  Lihua Xie and
                  Yeng Chai Soh and
                  David Zhang},
  title        = {H\({}_{\mbox{infinity}}\) Fixed-lag smoothing for discrete linear
                  time-varying systems},
  journal      = {Autom.},
  volume       = {41},
  number       = {5},
  pages        = {839--846},
  year         = {2005},
  url          = {https://doi.org/10.1016/j.automatica.2004.11.028},
  doi          = {10.1016/J.AUTOMATICA.2004.11.028},
  timestamp    = {Thu, 20 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/automatica/ZhangXSZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/JingWZT05,
  author       = {Xiao{-}Yuan Jing and
                  Hau{-}San Wong and
                  David Zhang and
                  Yuan Yan Tang},
  title        = {An uncorrelated fisherface approach},
  journal      = {Neurocomputing},
  volume       = {67},
  pages        = {328--334},
  year         = {2005},
  url          = {https://doi.org/10.1016/j.neucom.2005.01.001},
  doi          = {10.1016/J.NEUCOM.2005.01.001},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/JingWZT05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isci/PangZW05,
  author       = {Bo Pang and
                  David Zhang and
                  Kuanquan Wang},
  title        = {Tongue image analysis for appendicitis diagnosis},
  journal      = {Inf. Sci.},
  volume       = {175},
  number       = {3},
  pages        = {160--176},
  year         = {2005},
  url          = {https://doi.org/10.1016/j.ins.2005.01.010},
  doi          = {10.1016/J.INS.2005.01.010},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/isci/PangZW05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcst/ZhangLKW05,
  author       = {David Zhang and
                  Guangming Lu and
                  Adams Wai{-}Kin Kong and
                  Michael Wong},
  title        = {Online Palmprint Identification System for Civil Applications},
  journal      = {J. Comput. Sci. Technol.},
  volume       = {20},
  number       = {1},
  pages        = {70--76},
  year         = {2005},
  url          = {https://doi.org/10.1007/s11390-005-0008-2},
  doi          = {10.1007/S11390-005-0008-2},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jcst/ZhangLKW05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcst/WuWZ05,
  author       = {Xiangqian Wu and
                  Kuanquan Wang and
                  David Zhang},
  title        = {Wavelet Energy Feature Extraction and Matching for Palmprint Recognition},
  journal      = {J. Comput. Sci. Technol.},
  volume       = {20},
  number       = {3},
  pages        = {411--418},
  year         = {2005},
  url          = {https://doi.org/10.1007/s11390-005-0411-8},
  doi          = {10.1007/S11390-005-0411-8},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jcst/WuWZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/YangFYZJ05,
  author       = {Jian Yang and
                  Alejandro F. Frangi and
                  Jing{-}Yu Yang and
                  David Zhang and
                  Zhong Jin},
  title        = {{KPCA} Plus {LDA:} {A} Complete Kernel Fisher Discriminant Framework
                  for Feature Extraction and Recognition},
  journal      = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
  volume       = {27},
  number       = {2},
  pages        = {230--244},
  year         = {2005},
  url          = {https://doi.org/10.1109/TPAMI.2005.33},
  doi          = {10.1109/TPAMI.2005.33},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pami/YangFYZJ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/JingTZ05,
  author       = {Xiao{-}Yuan Jing and
                  Yuan Yan Tang and
                  David Zhang},
  title        = {A Fourier-LDA approach for image recognition},
  journal      = {Pattern Recognit.},
  volume       = {38},
  number       = {3},
  pages        = {453--457},
  year         = {2005},
  url          = {https://doi.org/10.1016/j.patcog.2003.09.020},
  doi          = {10.1016/J.PATCOG.2003.09.020},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/JingTZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/YangZYY05,
  author       = {Jian Yang and
                  David Zhang and
                  Yong Xu and
                  Jing{-}Yu Yang},
  title        = {Two-dimensional discriminant transform for face recognition},
  journal      = {Pattern Recognit.},
  volume       = {38},
  number       = {7},
  pages        = {1125--1129},
  year         = {2005},
  url          = {https://doi.org/10.1016/j.patcog.2004.11.019},
  doi          = {10.1016/J.PATCOG.2004.11.019},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/YangZYY05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/KumarZ05,
  author       = {Ajay Kumar and
                  David Zhang},
  title        = {Personal authentication using multiple palmprint representation},
  journal      = {Pattern Recognit.},
  volume       = {38},
  number       = {10},
  pages        = {1695--1704},
  year         = {2005},
  url          = {https://doi.org/10.1016/j.patcog.2005.03.012},
  doi          = {10.1016/J.PATCOG.2005.03.012},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/KumarZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/YangGZY05,
  author       = {Jian Yang and
                  Xiumei Gao and
                  David Zhang and
                  Jing{-}Yu Yang},
  title        = {Kernel {ICA:} An alternative formulation and its application to face
                  recognition},
  journal      = {Pattern Recognit.},
  volume       = {38},
  number       = {10},
  pages        = {1784--1787},
  year         = {2005},
  url          = {https://doi.org/10.1016/j.patcog.2005.01.023},
  doi          = {10.1016/J.PATCOG.2005.01.023},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/YangGZY05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/YuZWY05,
  author       = {Li Yu and
                  David Zhang and
                  Kuanquan Wang and
                  Wen Yang},
  title        = {Coarse iris classification using box-counting to estimate fractal
                  dimensions},
  journal      = {Pattern Recognit.},
  volume       = {38},
  number       = {11},
  pages        = {1791--1798},
  year         = {2005},
  url          = {https://doi.org/10.1016/j.patcog.2005.03.015},
  doi          = {10.1016/J.PATCOG.2005.03.015},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/YuZWY05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/XuZW05,
  author       = {Lisheng Xu and
                  David Zhang and
                  Kuanquan Wang},
  title        = {Wavelet-based cascaded adaptive filter for removing baseline drift
                  in pulse waveforms},
  journal      = {{IEEE} Trans. Biomed. Eng.},
  volume       = {52},
  number       = {11},
  pages        = {1973--1975},
  year         = {2005},
  url          = {https://doi.org/10.1109/TBME.2005.856296},
  doi          = {10.1109/TBME.2005.856296},
  timestamp    = {Sat, 05 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tbe/XuZW05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmi/PangZW05,
  author       = {Bo Pang and
                  David Zhang and
                  Kuanquan Wang},
  title        = {The Bi-Elliptical Deformable Contour and Its Application to Automated
                  Tongue Segmentation in Chinese Medicine},
  journal      = {{IEEE} Trans. Medical Imaging},
  volume       = {24},
  number       = {8},
  pages        = {946--956},
  year         = {2005},
  url          = {https://doi.org/10.1109/TMI.2005.850552},
  doi          = {10.1109/TMI.2005.850552},
  timestamp    = {Thu, 18 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tmi/PangZW05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tmm/LiYZ05,
  author       = {Wenxin Li and
                  Jane You and
                  David Zhang},
  title        = {Texture-based palmprint retrieval using a layered search scheme for
                  personal identification},
  journal      = {{IEEE} Trans. Multim.},
  volume       = {7},
  number       = {5},
  pages        = {891--898},
  year         = {2005},
  url          = {https://doi.org/10.1109/TMM.2005.854380},
  doi          = {10.1109/TMM.2005.854380},
  timestamp    = {Wed, 28 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tmm/LiYZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/LiZLQ05,
  author       = {Wen Li and
                  David Dapeng Zhang and
                  Zhiyong Liu and
                  Xiangzhen Qiao},
  title        = {Fast block-based image restoration employing the improved best neighborhood
                  matching approach},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {A}},
  volume       = {35},
  number       = {4},
  pages        = {546--555},
  year         = {2005},
  url          = {https://doi.org/10.1109/TSMCA.2005.850605},
  doi          = {10.1109/TSMCA.2005.850605},
  timestamp    = {Mon, 25 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/LiZLQ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amfg/ZuoWZY05,
  author       = {Wangmeng Zuo and
                  Kuanquan Wang and
                  David Zhang and
                  Jian Yang},
  editor       = {Wenyi Zhao and
                  Shaogang Gong and
                  Xiaoou Tang},
  title        = {Regularization of {LDA} for Face Recognition: {A} Post-processing
                  Approach},
  booktitle    = {Analysis and Modelling of Faces and Gestures, Second International
                  Workshop, {AMFG} 2005, Beijing, China, October 16, 2005, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3723},
  pages        = {377--391},
  publisher    = {Springer},
  year         = {2005},
  url          = {https://doi.org/10.1007/11564386\_29},
  doi          = {10.1007/11564386\_29},
  timestamp    = {Tue, 14 May 2019 10:00:53 +0200},
  biburl       = {https://dblp.org/rec/conf/amfg/ZuoWZY05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/avbpa/WangZZ05,
  author       = {Kuanquan Wang and
                  Wangmeng Zuo and
                  David Zhang},
  editor       = {Takeo Kanade and
                  Anil K. Jain and
                  Nalini K. Ratha},
  title        = {Post-processing on LDA's Discriminant Vectors for Facial Feature Extraction},
  booktitle    = {Audio- and Video-Based Biometric Person Authentication, 5th International
                  Conference, {AVBPA} 2005, Hilton Rye Town, NY, USA, July 20-22, 2005,
                  Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3546},
  pages        = {346--354},
  publisher    = {Springer},
  year         = {2005},
  url          = {https://doi.org/10.1007/11527923\_36},
  doi          = {10.1007/11527923\_36},
  timestamp    = {Tue, 14 May 2019 10:00:44 +0200},
  biburl       = {https://dblp.org/rec/conf/avbpa/WangZZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/avbpa/KongZK05,
  author       = {Adams Wai{-}Kin Kong and
                  David Zhang and
                  Mohamed Kamel},
  editor       = {Takeo Kanade and
                  Anil K. Jain and
                  Nalini K. Ratha},
  title        = {A Study of Brute-Force Break-ins of a Palmprint Verification System},
  booktitle    = {Audio- and Video-Based Biometric Person Authentication, 5th International
                  Conference, {AVBPA} 2005, Hilton Rye Town, NY, USA, July 20-22, 2005,
                  Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3546},
  pages        = {447--454},
  publisher    = {Springer},
  year         = {2005},
  url          = {https://doi.org/10.1007/11527923\_46},
  doi          = {10.1007/11527923\_46},
  timestamp    = {Sat, 16 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/avbpa/KongZK05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/avbpa/WuWZ05,
  author       = {Xiangqian Wu and
                  Kuanquan Wang and
                  David Zhang},
  editor       = {Takeo Kanade and
                  Anil K. Jain and
                  Nalini K. Ratha},
  title        = {Palmprint Authentication Based on Orientation Code Matching},
  booktitle    = {Audio- and Video-Based Biometric Person Authentication, 5th International
                  Conference, {AVBPA} 2005, Hilton Rye Town, NY, USA, July 20-22, 2005,
                  Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3546},
  pages        = {555--562},
  publisher    = {Springer},
  year         = {2005},
  url          = {https://doi.org/10.1007/11527923\_57},
  doi          = {10.1007/11527923\_57},
  timestamp    = {Thu, 27 Sep 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/avbpa/WuWZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/avbpa/LiuZ05,
  author       = {Li Liu and
                  David Zhang},
  editor       = {Takeo Kanade and
                  Anil K. Jain and
                  Nalini K. Ratha},
  title        = {A Novel Palm-Line Detector},
  booktitle    = {Audio- and Video-Based Biometric Person Authentication, 5th International
                  Conference, {AVBPA} 2005, Hilton Rye Town, NY, USA, July 20-22, 2005,
                  Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3546},
  pages        = {563--571},
  publisher    = {Springer},
  year         = {2005},
  url          = {https://doi.org/10.1007/11527923\_58},
  doi          = {10.1007/11527923\_58},
  timestamp    = {Thu, 17 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/avbpa/LiuZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/avbpa/KumarZ05,
  author       = {Ajay Kumar and
                  David Zhang},
  editor       = {Takeo Kanade and
                  Anil K. Jain and
                  Nalini K. Ratha},
  title        = {Biometric Recognition Using Feature Selection and Combination},
  booktitle    = {Audio- and Video-Based Biometric Person Authentication, 5th International
                  Conference, {AVBPA} 2005, Hilton Rye Town, NY, USA, July 20-22, 2005,
                  Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3546},
  pages        = {813--822},
  publisher    = {Springer},
  year         = {2005},
  url          = {https://doi.org/10.1007/11527923\_85},
  doi          = {10.1007/11527923\_85},
  timestamp    = {Mon, 18 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/avbpa/KumarZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cisst/CheungKYZ05,
  author       = {King Hong Cheung and
                  Adams Wai{-}Kin Kong and
                  Jane You and
                  David Zhang},
  editor       = {Hamid R. Arabnia},
  title        = {An Analysis on Invertibility of Cancelable Biometrics based on BioHashing},
  booktitle    = {Proceedings of The 2005 International Conference on Imaging Science,
                  Systems, and Technology: Computer Graphics, {CISST} 2005, Las Vegas,
                  Nevada, USA, June 27-30, 2005},
  pages        = {40--45},
  publisher    = {{CSREA} Press},
  year         = {2005},
  timestamp    = {Sat, 16 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cisst/CheungKYZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccv/YangZY05,
  author       = {Jian Yang and
                  David Zhang and
                  Jing{-}Yu Yang},
  title        = {Is {ICA} Significantly Better than {PCA} for Face Recognition?},
  booktitle    = {10th {IEEE} International Conference on Computer Vision {(ICCV} 2005),
                  17-20 October 2005, Beijing, China},
  pages        = {198--203},
  publisher    = {{IEEE} Computer Society},
  year         = {2005},
  url          = {https://doi.org/10.1109/ICCV.2005.127},
  doi          = {10.1109/ICCV.2005.127},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iccv/YangZY05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icic/LiuZYL05,
  author       = {Heng Liu and
                  David Zhang and
                  Jingqi Yan and
                  Zushu Li},
  editor       = {De{-}Shuang Huang and
                  Xiao{-}Ping (Steven) Zhang and
                  Guang{-}Bin Huang},
  title        = {Fast and Robust Portrait Segmentation Using {QEA} and Histogram Peak
                  Distribution Methods},
  booktitle    = {Advances in Intelligent Computing, International Conference on Intelligent
                  Computing, {ICIC} 2005, Hefei, China, August 23-26, 2005, Proceedings,
                  Part {II}},
  series       = {Lecture Notes in Computer Science},
  volume       = {3645},
  pages        = {920--928},
  publisher    = {Springer},
  year         = {2005},
  url          = {https://doi.org/10.1007/11538356\_95},
  doi          = {10.1007/11538356\_95},
  timestamp    = {Thu, 12 Dec 2019 16:43:34 +0100},
  biburl       = {https://dblp.org/rec/conf/icic/LiuZYL05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icic/WuZWZ05,
  author       = {Xiangqian Wu and
                  Fengmiao Zhang and
                  Kuanquan Wang and
                  David Zhang},
  editor       = {De{-}Shuang Huang and
                  Xiao{-}Ping (Steven) Zhang and
                  Guang{-}Bin Huang},
  title        = {Fusion of the Textural Feature and Palm-Lines for Palmprint Authentication},
  booktitle    = {Advances in Intelligent Computing, International Conference on Intelligent
                  Computing, {ICIC} 2005, Hefei, China, August 23-26, 2005, Proceedings,
                  Part {I}},
  series       = {Lecture Notes in Computer Science},
  volume       = {3644},
  pages        = {1075--1084},
  publisher    = {Springer},
  year         = {2005},
  url          = {https://doi.org/10.1007/11538059\_111},
  doi          = {10.1007/11538059\_111},
  timestamp    = {Thu, 12 Dec 2019 16:43:34 +0100},
  biburl       = {https://dblp.org/rec/conf/icic/WuZWZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/WuWZZ05,
  author       = {Xiangqian Wu and
                  Kuanquan Wang and
                  Fengmiao Zhang and
                  David Zhang},
  title        = {Fusion of phase and orientation information for palmprint authentication},
  booktitle    = {Proceedings of the 2005 International Conference on Image Processing,
                  {ICIP} 2005, Genoa, Italy, September 11-14, 2005},
  pages        = {29--32},
  publisher    = {{IEEE}},
  year         = {2005},
  url          = {https://doi.org/10.1109/ICIP.2005.1529983},
  doi          = {10.1109/ICIP.2005.1529983},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/icip/WuWZZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/LiuZ05,
  author       = {Laura Li Liu and
                  David Zhang and
                  Kuanquan Wang},
  title        = {Palm-line detection},
  booktitle    = {Proceedings of the 2005 International Conference on Image Processing,
                  {ICIP} 2005, Genoa, Italy, September 11-14, 2005},
  pages        = {269--272},
  publisher    = {{IEEE}},
  year         = {2005},
  url          = {https://doi.org/10.1109/ICIP.2005.1530380},
  doi          = {10.1109/ICIP.2005.1530380},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icip/LiuZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/YuWZ05,
  author       = {Li Yu and
                  Kuanquan Wang and
                  David Zhang},
  title        = {Coarse iris classification based on box-counting method},
  booktitle    = {Proceedings of the 2005 International Conference on Image Processing,
                  {ICIP} 2005, Genoa, Italy, September 11-14, 2005},
  pages        = {301--304},
  publisher    = {{IEEE}},
  year         = {2005},
  url          = {https://doi.org/10.1109/ICIP.2005.1530388},
  doi          = {10.1109/ICIP.2005.1530388},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icip/YuWZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icip/ZuoWZ05,
  author       = {Wangmeng Zuo and
                  Kuanquan Wang and
                  David Zhang},
  title        = {Bi-directional {PCA} with assembled matrix distance metric},
  booktitle    = {Proceedings of the 2005 International Conference on Image Processing,
                  {ICIP} 2005, Genoa, Italy, September 11-14, 2005},
  pages        = {958--961},
  publisher    = {{IEEE}},
  year         = {2005},
  url          = {https://doi.org/10.1109/ICIP.2005.1530216},
  doi          = {10.1109/ICIP.2005.1530216},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icip/ZuoWZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isnn/LiWZ05,
  author       = {Yanlai Li and
                  Kuanquan Wang and
                  David Zhang},
  editor       = {Jun Wang and
                  Xiaofeng Liao and
                  Zhang Yi},
  title        = {Palmprint Recognition Based on Translation Invariant Zernike Moments
                  and Modular Neural Network},
  booktitle    = {Advances in Neural Networks - {ISNN} 2005, Second International Symposium
                  on Neural Networks, Chongqing, China, May 30 - June 1, 2005, Proceedings,
                  Part {II}},
  series       = {Lecture Notes in Computer Science},
  volume       = {3497},
  pages        = {177--182},
  publisher    = {Springer},
  year         = {2005},
  url          = {https://doi.org/10.1007/11427445\_28},
  doi          = {10.1007/11427445\_28},
  timestamp    = {Tue, 14 May 2019 10:00:36 +0200},
  biburl       = {https://dblp.org/rec/conf/isnn/LiWZ05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kes/CheungKZKYL05,
  author       = {King Hong Cheung and
                  Adams Wai{-}Kin Kong and
                  David Zhang and
                  Mohamed Kamel and
                  Jane You and
                  Ho{-}Wang Lam},
  editor       = {Rajiv Khosla and
                  Robert J. Howlett and
                  Lakhmi C. Jain},
  title        = {An Analysis on Accuracy of Cancelable Biometrics Based on BioHashing},
  booktitle    = {Knowledge-Based Intelligent Information and Engineering Systems, 9th
                  International Conference, {KES} 2005, Melbourne, Australia, September
                  14-16, 2005, Proceedings, Part {III}},
  series       = {Lecture Notes in Computer Science},
  volume       = {3683},
  pages        = {1168--1172},
  publisher    = {Springer},
  year         = {2005},
  url          = {https://doi.org/10.1007/11553939\_162},
  doi          = {10.1007/11553939\_162},
  timestamp    = {Tue, 14 May 2019 10:00:51 +0200},
  biburl       = {https://dblp.org/rec/conf/kes/CheungKZKYL05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/premi/ZhangLKW05,
  author       = {David Zhang and
                  Guangming Lu and
                  Adams Wai{-}Kin Kong and
                  Michael Wong},
  editor       = {Sankar K. Pal and
                  Sanghamitra Bandyopadhyay and
                  Sambhunath Biswas},
  title        = {A Novel Personal Authentication System Using Palmprint Technology},
  booktitle    = {Pattern Recognition and Machine Intelligence, First International
                  Conference, PReMI 2005, Kolkata, India, December 20-22, 2005, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3776},
  pages        = {147--156},
  publisher    = {Springer},
  year         = {2005},
  url          = {https://doi.org/10.1007/11590316\_18},
  doi          = {10.1007/11590316\_18},
  timestamp    = {Tue, 14 May 2019 10:00:41 +0200},
  biburl       = {https://dblp.org/rec/conf/premi/ZhangLKW05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/CheungKYLZB05,
  author       = {King Hong Cheung and
                  Adams Wai{-}Kin Kong and
                  Jane You and
                  Qin Li and
                  David Zhang and
                  Prabir Bhattacharya},
  title        = {A new approach to appearance-based face recognition},
  booktitle    = {Proceedings of the {IEEE} International Conference on Systems, Man
                  and Cybernetics, Waikoloa, Hawaii, USA, October 10-12, 2005},
  pages        = {1686--1691},
  publisher    = {{IEEE}},
  year         = {2005},
  url          = {https://doi.org/10.1109/ICSMC.2005.1571391},
  doi          = {10.1109/ICSMC.2005.1571391},
  timestamp    = {Wed, 03 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/smc/CheungKYLZB05.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/iwbrs/2005,
  editor       = {Stan Z. Li and
                  Zhenan Sun and
                  Tieniu Tan and
                  Sharath Pankanti and
                  G{\'{e}}rard Chollet and
                  David Zhang},
  title        = {Advances in Biometric Person Authentication, International Workshop
                  on Biometric Recognition Systems, IWBRS2005, Beijing, China, October
                  22-23, 2005, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3781},
  publisher    = {Springer},
  year         = {2005},
  url          = {https://doi.org/10.1007/11569947},
  doi          = {10.1007/11569947},
  isbn         = {3-540-29431-7},
  timestamp    = {Thu, 17 Oct 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iwbrs/2005.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/automatica/XieLZZ04,
  author       = {Lihua Xie and
                  Lilei Lu and
                  David Zhang and
                  Huanshui Zhang},
  title        = {Improved robust H\({}_{\mbox{2}}\) and H\({}_{\mbox{infinity}}\) filtering
                  for uncertain discrete-time systems},
  journal      = {Autom.},
  volume       = {40},
  number       = {5},
  pages        = {873--880},
  year         = {2004},
  url          = {https://doi.org/10.1016/j.automatica.2004.01.003},
  doi          = {10.1016/J.AUTOMATICA.2004.01.003},
  timestamp    = {Thu, 20 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/automatica/XieLZZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/automatica/ZhangZX04,
  author       = {Huanshui Zhang and
                  David Zhang and
                  Lihua Xie},
  title        = {An innovation approach to H\({}_{\mbox{infinity}}\) prediction for
                  continuous-time systems with application to systems with delayed measurements},
  journal      = {Autom.},
  volume       = {40},
  number       = {7},
  pages        = {1253--1261},
  year         = {2004},
  url          = {https://doi.org/10.1016/j.automatica.2004.02.016},
  doi          = {10.1016/J.AUTOMATICA.2004.02.016},
  timestamp    = {Thu, 20 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/automatica/ZhangZX04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/automatica/ZhangZXL04,
  author       = {Huanshui Zhang and
                  David Zhang and
                  Lihua Xie and
                  Jun Lin},
  title        = {Robust filtering under stochastic parametric uncertainties},
  journal      = {Autom.},
  volume       = {40},
  number       = {9},
  pages        = {1583--1589},
  year         = {2004},
  url          = {https://doi.org/10.1016/j.automatica.2004.04.002},
  doi          = {10.1016/J.AUTOMATICA.2004.04.002},
  timestamp    = {Thu, 20 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/automatica/ZhangZXL04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cg/LiZPSZY04,
  author       = {Li Li and
                  David Zhang and
                  Zhigeng Pan and
                  Jiaoying Shi and
                  Kun Zhou and
                  Kai Ye},
  title        = {Watermarking 3D mesh by spherical parameterization},
  journal      = {Comput. Graph.},
  volume       = {28},
  number       = {6},
  pages        = {981--989},
  year         = {2004},
  url          = {https://doi.org/10.1016/j.cag.2004.08.002},
  doi          = {10.1016/J.CAG.2004.08.002},
  timestamp    = {Mon, 19 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cg/LiZPSZY04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/paa/YangYZ04,
  author       = {Jian Yang and
                  Hui Ye and
                  David Zhang},
  title        = {A new {LDA-KL} combined method for feature extraction and its generalisation},
  journal      = {Pattern Anal. Appl.},
  volume       = {7},
  number       = {1},
  pages        = {40--50},
  year         = {2004},
  url          = {https://doi.org/10.1007/s10044-004-0205-6},
  doi          = {10.1007/S10044-004-0205-6},
  timestamp    = {Fri, 12 Mar 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/paa/YangYZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/paa/YangYYZ04,
  author       = {Jian Yang and
                  Hui Ye and
                  Jing{-}Yu Yang and
                  David Zhang},
  title        = {A new {LDA-KL} combined method for feature extraction and its generalisation},
  journal      = {Pattern Anal. Appl.},
  volume       = {7},
  number       = {2},
  pages        = {225},
  year         = {2004},
  url          = {https://doi.org/10.1007/s10044-004-0221-6},
  doi          = {10.1007/S10044-004-0221-6},
  timestamp    = {Thu, 27 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/paa/YangYYZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/YangZFY04,
  author       = {Jian Yang and
                  David Zhang and
                  Alejandro F. Frangi and
                  Jing{-}Yu Yang},
  title        = {Two-Dimensional {PCA:} {A} New Approach to Appearance-Based Face Representation
                  and Recognition},
  journal      = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
  volume       = {26},
  number       = {1},
  pages        = {131--137},
  year         = {2004},
  url          = {http://doi.ieeecomputersociety.org/10.1109/TPAMI.2004.10004},
  doi          = {10.1109/TPAMI.2004.10004},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pami/YangZFY04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ZhangZZ04,
  author       = {Yungang Zhang and
                  Changshui Zhang and
                  David Zhang},
  title        = {Distance metric learning by knowledge embedding},
  journal      = {Pattern Recognit.},
  volume       = {37},
  number       = {1},
  pages        = {161--163},
  year         = {2004},
  url          = {https://doi.org/10.1016/S0031-3203(03)00218-8},
  doi          = {10.1016/S0031-3203(03)00218-8},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/ZhangZZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ZhangWZZ04,
  author       = {Changshui Zhang and
                  Jun Wang and
                  Nanyuan Zhao and
                  David Zhang},
  title        = {Reconstruction and analysis of multi-pose face images based on nonlinear
                  dimensionality reduction},
  journal      = {Pattern Recognit.},
  volume       = {37},
  number       = {2},
  pages        = {325--336},
  year         = {2004},
  url          = {https://doi.org/10.1016/j.patcog.2003.07.005},
  doi          = {10.1016/J.PATCOG.2003.07.005},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/ZhangWZZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/GuZZ04,
  author       = {Jinwei Gu and
                  Jie Zhou and
                  David Zhang},
  title        = {A combination model for orientation field of fingerprints},
  journal      = {Pattern Recognit.},
  volume       = {37},
  number       = {3},
  pages        = {543--553},
  year         = {2004},
  url          = {https://doi.org/10.1016/S0031-3203(03)00178-X},
  doi          = {10.1016/S0031-3203(03)00178-X},
  timestamp    = {Wed, 16 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/GuZZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ZhangZZ04a,
  author       = {Yungang Zhang and
                  Changshui Zhang and
                  David Zhang},
  title        = {Erratum to "Distance metric learning by knowledge embedding"
                  [Pattern Recognition 37(1)161-163(2004)]},
  journal      = {Pattern Recognit.},
  volume       = {37},
  number       = {4},
  pages        = {855},
  year         = {2004},
  url          = {https://doi.org/10.1016/j.patcog.2003.12.001},
  doi          = {10.1016/J.PATCOG.2003.12.001},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/ZhangZZ04a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/WuZWH04,
  author       = {Xiangqian Wu and
                  David Zhang and
                  Kuanquan Wang and
                  Bo Huang},
  title        = {Palmprint classification using principal lines},
  journal      = {Pattern Recognit.},
  volume       = {37},
  number       = {10},
  pages        = {1987--1998},
  year         = {2004},
  url          = {https://doi.org/10.1016/j.patcog.2004.02.015},
  doi          = {10.1016/J.PATCOG.2004.02.015},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/WuZWH04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/YangJYZF04,
  author       = {Jian Yang and
                  Zhong Jin and
                  Jing{-}Yu Yang and
                  David Zhang and
                  Alejandro F. Frangi},
  title        = {Essence of kernel Fisher discriminant: {KPCA} plus {LDA}},
  journal      = {Pattern Recognit.},
  volume       = {37},
  number       = {10},
  pages        = {2097--2100},
  year         = {2004},
  url          = {https://doi.org/10.1016/j.patcog.2003.10.015},
  doi          = {10.1016/J.PATCOG.2003.10.015},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/YangJYZF04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spic/WangZ04,
  author       = {Huiyuan Wang and
                  David Zhang},
  title        = {A linear edge model and its application in lossless image coding},
  journal      = {Signal Process. Image Commun.},
  volume       = {19},
  number       = {10},
  pages        = {955--958},
  year         = {2004},
  url          = {https://doi.org/10.1016/j.image.2004.04.006},
  doi          = {10.1016/J.IMAGE.2004.04.006},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/spic/WangZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tac/ZhangXZS04,
  author       = {Huanshui Zhang and
                  Lihua Xie and
                  David Zhang and
                  Yeng Chai Soh},
  title        = {A reorganized innovation approach to linear estimation},
  journal      = {{IEEE} Trans. Autom. Control.},
  volume       = {49},
  number       = {10},
  pages        = {1810--1814},
  year         = {2004},
  url          = {https://doi.org/10.1109/TAC.2004.835599},
  doi          = {10.1109/TAC.2004.835599},
  timestamp    = {Wed, 20 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tac/ZhangXZS04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tbe/PangZLW04,
  author       = {Bo Pang and
                  David Zhang and
                  Naimin Li and
                  Kuanquan Wang},
  title        = {Computerized tongue diagnosis based on Bayesian networks},
  journal      = {{IEEE} Trans. Biomed. Eng.},
  volume       = {51},
  number       = {10},
  pages        = {1803--1810},
  year         = {2004},
  url          = {https://doi.org/10.1109/TBME.2004.831534},
  doi          = {10.1109/TBME.2004.831534},
  timestamp    = {Wed, 02 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tbe/PangZLW04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/YouKZC04,
  author       = {Jane You and
                  Adams Wai{-}Kin Kong and
                  David Zhang and
                  King Hong Cheung},
  title        = {On hierarchical palmprint coding with multiple features for personal
                  identification in large databases},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {14},
  number       = {2},
  pages        = {234--243},
  year         = {2004},
  url          = {https://doi.org/10.1109/TCSVT.2003.821978},
  doi          = {10.1109/TCSVT.2003.821978},
  timestamp    = {Tue, 25 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcsv/YouKZC04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/ZhangZ04,
  author       = {Lei Zhang and
                  David Zhang},
  title        = {Characterization of palmprints by wavelet signatures via directional
                  context modeling},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {B}},
  volume       = {34},
  number       = {3},
  pages        = {1335--1347},
  year         = {2004},
  url          = {https://doi.org/10.1109/TSMCB.2004.824521},
  doi          = {10.1109/TSMCB.2004.824521},
  timestamp    = {Mon, 18 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/ZhangZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/JingZT04,
  author       = {Xiao{-}Yuan Jing and
                  David Zhang and
                  Yuan Yan Tang},
  title        = {An improved {LDA} approach},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {B}},
  volume       = {34},
  number       = {5},
  pages        = {1942--1951},
  year         = {2004},
  url          = {https://doi.org/10.1109/TSMCB.2004.831770},
  doi          = {10.1109/TSMCB.2004.831770},
  timestamp    = {Mon, 18 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/JingZT04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/JingZ04,
  author       = {Xiao{-}Yuan Jing and
                  David Zhang},
  title        = {A face and palmprint recognition approach based on discriminant {DCT}
                  feature extraction},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {B}},
  volume       = {34},
  number       = {6},
  pages        = {2405--2415},
  year         = {2004},
  url          = {https://doi.org/10.1109/TSMCB.2004.837586},
  doi          = {10.1109/TSMCB.2004.837586},
  timestamp    = {Mon, 18 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/JingZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvcg/YanSZ04,
  author       = {Jingqi Yan and
                  Pengfei Shi and
                  David Zhang},
  title        = {Mesh Simplification with Hierarchical Shape Analysis and Iterative
                  Edge Contraction},
  journal      = {{IEEE} Trans. Vis. Comput. Graph.},
  volume       = {10},
  number       = {2},
  pages        = {142--151},
  year         = {2004},
  url          = {https://doi.org/10.1109/TVCG.2004.1260766},
  doi          = {10.1109/TVCG.2004.1260766},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tvcg/YanSZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/asplos/SuhLZD04,
  author       = {G. Edward Suh and
                  Jae W. Lee and
                  David Zhang and
                  Srinivas Devadas},
  editor       = {Shubu Mukherjee and
                  Kathryn S. McKinley},
  title        = {Secure program execution via dynamic information flow tracking},
  booktitle    = {Proceedings of the 11th International Conference on Architectural
                  Support for Programming Languages and Operating Systems, {ASPLOS}
                  2004, Boston, MA, USA, October 7-13, 2004},
  pages        = {85--96},
  publisher    = {{ACM}},
  year         = {2004},
  url          = {https://doi.org/10.1145/1024393.1024404},
  doi          = {10.1145/1024393.1024404},
  timestamp    = {Fri, 15 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/asplos/SuhLZD04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eccv/ZhangLKW04,
  author       = {David Zhang and
                  Guangming Lu and
                  Adams Wai{-}Kin Kong and
                  Michael Wong},
  editor       = {Davide Maltoni and
                  Anil K. Jain},
  title        = {Palmprint Authentication System for Civil Applications},
  booktitle    = {Biometric Authentication, {ECCV} 2004 International Workshop, BioAW
                  2004, Prague, Czech Republic, May 15, 2004, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3087},
  pages        = {217--228},
  publisher    = {Springer},
  year         = {2004},
  url          = {https://doi.org/10.1007/978-3-540-25976-3\_20},
  doi          = {10.1007/978-3-540-25976-3\_20},
  timestamp    = {Tue, 14 May 2019 10:00:45 +0200},
  biburl       = {https://dblp.org/rec/conf/eccv/ZhangLKW04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icba/ZhouWBZ04,
  author       = {Jie Zhou and
                  Chenyu Wu and
                  Zhaoqi Bian and
                  David Zhang},
  editor       = {David Zhang and
                  Anil K. Jain},
  title        = {Improving Fingerprint Recognition Based on Crease Detection},
  booktitle    = {Biometric Authentication, First International Conference, {ICBA} 2004,
                  Hong Kong, China, July 15-17, 2004, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3072},
  pages        = {287--293},
  publisher    = {Springer},
  year         = {2004},
  url          = {https://doi.org/10.1007/978-3-540-25948-0\_40},
  doi          = {10.1007/978-3-540-25948-0\_40},
  timestamp    = {Wed, 16 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icba/ZhouWBZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icba/LiWZ04,
  author       = {Bin Li and
                  Kuanquan Wang and
                  David Zhang},
  editor       = {David Zhang and
                  Anil K. Jain},
  title        = {On-Line Signature Verification Based on {PCA} (Principal Component
                  Analysis) and {MCA} (Minor Component Analysis)},
  booktitle    = {Biometric Authentication, First International Conference, {ICBA} 2004,
                  Hong Kong, China, July 15-17, 2004, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3072},
  pages        = {540--546},
  publisher    = {Springer},
  year         = {2004},
  url          = {https://doi.org/10.1007/978-3-540-25948-0\_74},
  doi          = {10.1007/978-3-540-25948-0\_74},
  timestamp    = {Tue, 25 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icba/LiWZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icba/FengDHZ04,
  author       = {Guiyu Feng and
                  Kaifeng Dong and
                  Dewen Hu and
                  David Zhang},
  editor       = {David Zhang and
                  Anil K. Jain},
  title        = {When Faces Are Combined with Palmprints: {A} Novel Biometric Fusion
                  Strategy},
  booktitle    = {Biometric Authentication, First International Conference, {ICBA} 2004,
                  Hong Kong, China, July 15-17, 2004, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3072},
  pages        = {701--707},
  publisher    = {Springer},
  year         = {2004},
  url          = {https://doi.org/10.1007/978-3-540-25948-0\_95},
  doi          = {10.1007/978-3-540-25948-0\_95},
  timestamp    = {Thu, 21 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icba/FengDHZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icba/YouKZC04,
  author       = {Jane You and
                  Adams Wai{-}Kin Kong and
                  David Zhang and
                  King Hong Cheung},
  editor       = {David Zhang and
                  Anil K. Jain},
  title        = {A New Approach to Personal Identification in Large Databases by Hierarchical
                  Palmprint Coding with Multi-features},
  booktitle    = {Biometric Authentication, First International Conference, {ICBA} 2004,
                  Hong Kong, China, July 15-17, 2004, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3072},
  pages        = {739--745},
  publisher    = {Springer},
  year         = {2004},
  url          = {https://doi.org/10.1007/978-3-540-25948-0\_100},
  doi          = {10.1007/978-3-540-25948-0\_100},
  timestamp    = {Sat, 16 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icba/YouKZC04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icba/KongZ04,
  author       = {Adams Wai{-}Kin Kong and
                  David Zhang},
  editor       = {David Zhang and
                  Anil K. Jain},
  title        = {Feature-Level Fusion for Effective Palmprint Authentication},
  booktitle    = {Biometric Authentication, First International Conference, {ICBA} 2004,
                  Hong Kong, China, July 15-17, 2004, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3072},
  pages        = {761--767},
  publisher    = {Springer},
  year         = {2004},
  url          = {https://doi.org/10.1007/978-3-540-25948-0\_103},
  doi          = {10.1007/978-3-540-25948-0\_103},
  timestamp    = {Sat, 16 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icba/KongZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icba/WuWZ04,
  author       = {Xiangqian Wu and
                  Kuanquan Wang and
                  David Zhang},
  editor       = {David Zhang and
                  Anil K. Jain},
  title        = {HMMs Based Palmprint Identification},
  booktitle    = {Biometric Authentication, First International Conference, {ICBA} 2004,
                  Hong Kong, China, July 15-17, 2004, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3072},
  pages        = {775--781},
  publisher    = {Springer},
  year         = {2004},
  url          = {https://doi.org/10.1007/978-3-540-25948-0\_105},
  doi          = {10.1007/978-3-540-25948-0\_105},
  timestamp    = {Thu, 27 Sep 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icba/WuWZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icig/KumarZ04,
  author       = {Ajay Kumar and
                  David Zhang},
  title        = {Integrating shape and texture for hand verification},
  booktitle    = {Third International Conference on Image and Graphics, {ICIG} 2004,
                  Hong Kong, China, December 18-20, 2004},
  pages        = {222--225},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.org/10.1109/ICIG.2004.87},
  doi          = {10.1109/ICIG.2004.87},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icig/KumarZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icig/WuWZ04,
  author       = {Xiangqian Wu and
                  Kuanquan Wang and
                  David Zhang},
  title        = {A novel approach of palm-line extraction},
  booktitle    = {Third International Conference on Image and Graphics, {ICIG} 2004,
                  Hong Kong, China, December 18-20, 2004},
  pages        = {230--233},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.org/10.1109/ICIG.2004.16},
  doi          = {10.1109/ICIG.2004.16},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icig/WuWZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icig/ZuoWZZ04,
  author       = {Wangmeng Zuo and
                  Kuanquan Wang and
                  David Zhang and
                  Hongzhi Zhang},
  title        = {Combination of polar edge detection and active contour model for automated
                  tongue segmentation},
  booktitle    = {Third International Conference on Image and Graphics, {ICIG} 2004,
                  Hong Kong, China, December 18-20, 2004},
  pages        = {270--273},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.org/10.1109/ICIG.2004.48},
  doi          = {10.1109/ICIG.2004.48},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icig/ZuoWZZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icig/CheungYKZ04,
  author       = {King Hong Cheung and
                  Jane You and
                  Adams Wai{-}Kin Kong and
                  David Zhang},
  title        = {A study of aggregated 2D Gabor features on appearance-based face recognition},
  booktitle    = {Third International Conference on Image and Graphics, {ICIG} 2004,
                  Hong Kong, China, December 18-20, 2004},
  pages        = {310--313},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.org/10.1109/ICIG.2004.26},
  doi          = {10.1109/ICIG.2004.26},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icig/CheungYKZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icig/LiPZ04,
  author       = {Li Li and
                  Zhigeng Pan and
                  David Zhang},
  title        = {A public mesh watermarking algorithm based on addition property of
                  Fourier transform},
  booktitle    = {Third International Conference on Image and Graphics, {ICIG} 2004,
                  Hong Kong, China, December 18-20, 2004},
  pages        = {324--328},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.org/10.1109/ICIG.2004.22},
  doi          = {10.1109/ICIG.2004.22},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icig/LiPZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icig/PanLZZ04,
  author       = {Zhigeng Pan and
                  Li Li and
                  Mingmin Zhang and
                  David Zhang},
  title        = {Watermark extraction by magnifying noise and applying global minimum
                  decoder},
  booktitle    = {Third International Conference on Image and Graphics, {ICIG} 2004,
                  Hong Kong, China, December 18-20, 2004},
  pages        = {349--352},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.org/10.1109/ICIG.2004.146},
  doi          = {10.1109/ICIG.2004.146},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icig/PanLZZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/WuWZ04,
  author       = {Xiangqian Wu and
                  Kuanquan Wang and
                  David Zhang},
  title        = {Palmprint Recognition Using Directional Line Energy Feature},
  booktitle    = {17th International Conference on Pattern Recognition, {ICPR} 2004,
                  Cambridge, UK, August 23-26, 2004},
  pages        = {475--478},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.org/10.1109/ICPR.2004.1333805},
  doi          = {10.1109/ICPR.2004.1333805},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/WuWZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/KongZ04,
  author       = {Adams Wai{-}Kin Kong and
                  David Zhang},
  title        = {Competitive Coding Scheme for Palmprint Verification},
  booktitle    = {17th International Conference on Pattern Recognition, {ICPR} 2004,
                  Cambridge, UK, August 23-26, 2004},
  pages        = {520--523},
  publisher    = {{IEEE} Computer Society},
  year         = {2004},
  url          = {https://doi.org/10.1109/ICPR.2004.1334184},
  doi          = {10.1109/ICPR.2004.1334184},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/KongZ04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sinobiometrics/ZhangLKW04,
  author       = {David Zhang and
                  Guangming Lu and
                  Adams Wai{-}Kin Kong and
                  Michael Wong},
  editor       = {Stan Z. Li and
                  Jian{-}Huang Lai and
                  Tieniu Tan and
                  Guo{-}Can Feng and
                  Yangsheng Wang},
  title        = {Palmprint Authentication Technologies, Systems and Applications},
  booktitle    = {Advances in Biometric Person Authentication, 5th Chinese Conference
                  on Biometric Recognition, {SINOBIOMETRICS} 2004, Guangzhou, China,
                  December 13-14, 2004, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3338},
  pages        = {78--89},
  publisher    = {Springer},
  year         = {2004},
  url          = {https://doi.org/10.1007/978-3-540-30548-4\_10},
  doi          = {10.1007/978-3-540-30548-4\_10},
  timestamp    = {Tue, 14 May 2019 10:00:53 +0200},
  biburl       = {https://dblp.org/rec/conf/sinobiometrics/ZhangLKW04.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/icba/2004,
  editor       = {David Zhang and
                  Anil K. Jain},
  title        = {Biometric Authentication, First International Conference, {ICBA} 2004,
                  Hong Kong, China, July 15-17, 2004, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {3072},
  publisher    = {Springer},
  year         = {2004},
  url          = {https://doi.org/10.1007/b98225},
  doi          = {10.1007/B98225},
  isbn         = {3-540-22146-8},
  timestamp    = {Tue, 14 May 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icba/2004.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijon/JingZ03,
  author       = {Xiao{-}Yuan Jing and
                  David Zhang},
  title        = {Face recognition based on linear classifiers combination},
  journal      = {Neurocomputing},
  volume       = {50},
  pages        = {485--488},
  year         = {2003},
  url          = {https://doi.org/10.1016/S0925-2312(02)00674-4},
  doi          = {10.1016/S0925-2312(02)00674-4},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijon/JingZ03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijprai/KongZ03,
  author       = {Adams Wai{-}Kin Kong and
                  David Zhang},
  title        = {Detecting Eyelash and Reflection for Accurate Iris Segmentation},
  journal      = {Int. J. Pattern Recognit. Artif. Intell.},
  volume       = {17},
  number       = {6},
  pages        = {1025--1034},
  year         = {2003},
  url          = {https://doi.org/10.1142/S0218001403002733},
  doi          = {10.1142/S0218001403002733},
  timestamp    = {Mon, 11 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijprai/KongZ03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijprai/YangYFZ03,
  author       = {Jian Yang and
                  Jing{-}Yu Yang and
                  Alejandro F. Frangi and
                  David Zhang},
  title        = {Uncorrelated Projection Discriminant Analysis And Its Application
                  To Face Image Feature Extraction},
  journal      = {Int. J. Pattern Recognit. Artif. Intell.},
  volume       = {17},
  number       = {8},
  pages        = {1325--1347},
  year         = {2003},
  url          = {https://doi.org/10.1142/S0218001403002903},
  doi          = {10.1142/S0218001403002903},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijprai/YangYFZ03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/imst/LiZLQ03,
  author       = {Wen Li and
                  David Zhang and
                  Zhiyong Liu and
                  Xiangzhen Qiao},
  title        = {A fast {BNM} (Best Neighborhood Matching): Algorithm and parallel
                  processing for image restoration},
  journal      = {Int. J. Imaging Syst. Technol.},
  volume       = {13},
  number       = {4},
  pages        = {189--200},
  year         = {2003},
  url          = {https://doi.org/10.1002/ima.10057},
  doi          = {10.1002/IMA.10057},
  timestamp    = {Thu, 18 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/imst/LiZLQ03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ivc/YangZ03,
  author       = {Yang Yang and
                  David Zhang},
  title        = {A novel line scan clustering algorithm for identifying connected components
                  in digital images},
  journal      = {Image Vis. Comput.},
  volume       = {21},
  number       = {5},
  pages        = {459--472},
  year         = {2003},
  url          = {https://doi.org/10.1016/S0262-8856(03)00015-5},
  doi          = {10.1016/S0262-8856(03)00015-5},
  timestamp    = {Thu, 20 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ivc/YangZ03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/paa/YangZY03,
  author       = {Jian Yang and
                  David Zhang and
                  Jing{-}Yu Yang},
  title        = {A generalised {K-L} expansion method which can deal with small sample
                  size and high-dimensional problems},
  journal      = {Pattern Anal. Appl.},
  volume       = {6},
  number       = {1},
  pages        = {47--54},
  year         = {2003},
  url          = {https://doi.org/10.1007/s10044-002-0177-3},
  doi          = {10.1007/S10044-002-0177-3},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/paa/YangZY03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pami/ZhangKYW03,
  author       = {David Zhang and
                  Adams Wai{-}Kin Kong and
                  Jane You and
                  Michael Wong},
  title        = {Online Palmprint Identification},
  journal      = {{IEEE} Trans. Pattern Anal. Mach. Intell.},
  volume       = {25},
  number       = {9},
  pages        = {1041--1050},
  year         = {2003},
  url          = {https://doi.org/10.1109/TPAMI.2003.1227981},
  doi          = {10.1109/TPAMI.2003.1227981},
  timestamp    = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pami/ZhangKYW03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ZhouXZ02,
  author       = {Jie Zhou and
                  Le{-}ping Xin and
                  David Zhang},
  title        = {Scale-orientation histogram for texture image retrieval},
  journal      = {Pattern Recognit.},
  volume       = {36},
  number       = {4},
  pages        = {1061--1063},
  year         = {2003},
  url          = {https://doi.org/10.1016/S0031-3203(02)00264-9},
  doi          = {10.1016/S0031-3203(02)00264-9},
  timestamp    = {Wed, 16 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/ZhouXZ02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/YangYZL03,
  author       = {Jian Yang and
                  Jing{-}Yu Yang and
                  David Zhang and
                  Jianfeng Lu},
  title        = {Feature fusion: parallel strategy vs. serial strategy},
  journal      = {Pattern Recognit.},
  volume       = {36},
  number       = {6},
  pages        = {1369--1381},
  year         = {2003},
  url          = {https://doi.org/10.1016/S0031-3203(02)00262-5},
  doi          = {10.1016/S0031-3203(02)00262-5},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/YangYZL03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/JingZY03,
  author       = {Xiao{-}Yuan Jing and
                  David Zhang and
                  Jing{-}Yu Yang},
  title        = {Face recognition based on a group decision-making combination approach},
  journal      = {Pattern Recognit.},
  volume       = {36},
  number       = {7},
  pages        = {1675--1678},
  year         = {2003},
  url          = {https://doi.org/10.1016/S0031-3203(02)00287-X},
  doi          = {10.1016/S0031-3203(02)00287-X},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/JingZY03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/JingZJ03,
  author       = {Xiao{-}Yuan Jing and
                  David Zhang and
                  Zhong Jin},
  title        = {Improvements on the uncorrelated optimal discriminant vectors},
  journal      = {Pattern Recognit.},
  volume       = {36},
  number       = {8},
  pages        = {1921--1923},
  year         = {2003},
  url          = {https://doi.org/10.1016/S0031-3203(02)00319-9},
  doi          = {10.1016/S0031-3203(02)00319-9},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/JingZJ03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/KongZL03,
  author       = {Adams Wai{-}Kin Kong and
                  David Zhang and
                  Wenxin Li},
  title        = {Palmprint feature extraction using 2-D Gabor filters},
  journal      = {Pattern Recognit.},
  volume       = {36},
  number       = {10},
  pages        = {2339--2347},
  year         = {2003},
  url          = {https://doi.org/10.1016/S0031-3203(03)00121-3},
  doi          = {10.1016/S0031-3203(03)00121-3},
  timestamp    = {Wed, 28 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/KongZL03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/JingZJ03a,
  author       = {Xiao{-}Yuan Jing and
                  David Zhang and
                  Zhong Jin},
  title        = {{UODV:} improved algorithm and generalized theory},
  journal      = {Pattern Recognit.},
  volume       = {36},
  number       = {11},
  pages        = {2593--2602},
  year         = {2003},
  url          = {https://doi.org/10.1016/S0031-3203(03)00177-8},
  doi          = {10.1016/S0031-3203(03)00177-8},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/JingZJ03a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/GuoZS03,
  author       = {Jie Guo and
                  David Zhang and
                  Pengfei Shi},
  title        = {Self-synchronizing watermarking scheme for an arbitrarily shaped object},
  journal      = {Pattern Recognit.},
  volume       = {36},
  number       = {11},
  pages        = {2737--2741},
  year         = {2003},
  url          = {https://doi.org/10.1016/S0031-3203(03)00048-7},
  doi          = {10.1016/S0031-3203(03)00048-7},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/GuoZS03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/LuZW03,
  author       = {Guangming Lu and
                  David Zhang and
                  Kuanquan Wang},
  title        = {Palmprint recognition using eigenpalms features},
  journal      = {Pattern Recognit. Lett.},
  volume       = {24},
  number       = {9-10},
  pages        = {1463--1467},
  year         = {2003},
  url          = {https://doi.org/10.1016/S0167-8655(02)00386-0},
  doi          = {10.1016/S0167-8655(02)00386-0},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/prl/LuZW03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/JingZY03,
  author       = {Xiao{-}Yuan Jing and
                  David Zhang and
                  Yong{-}Fang Yao},
  title        = {Improvements on the linear discrimination technique with application
                  to face recognition},
  journal      = {Pattern Recognit. Lett.},
  volume       = {24},
  number       = {15},
  pages        = {2695--2701},
  year         = {2003},
  url          = {https://doi.org/10.1016/S0167-8655(03)00112-0},
  doi          = {10.1016/S0167-8655(03)00112-0},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/prl/JingZY03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/prl/WuZW03,
  author       = {Xiangqian Wu and
                  David Zhang and
                  Kuanquan Wang},
  title        = {Fisherpalms based palmprint recognition},
  journal      = {Pattern Recognit. Lett.},
  volume       = {24},
  number       = {15},
  pages        = {2829--2838},
  year         = {2003},
  url          = {https://doi.org/10.1016/S0167-8655(03)00141-7},
  doi          = {10.1016/S0167-8655(03)00141-7},
  timestamp    = {Sat, 22 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/prl/WuZW03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spic/LiZX03,
  author       = {Wenxin Li and
                  David Zhang and
                  Zhuoqun Xu},
  title        = {Image alignment based on invariant features for palmprint identification},
  journal      = {Signal Process. Image Commun.},
  volume       = {18},
  number       = {5},
  pages        = {373--379},
  year         = {2003},
  url          = {https://doi.org/10.1016/S0923-5965(03)00011-0},
  doi          = {10.1016/S0923-5965(03)00011-0},
  timestamp    = {Wed, 28 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/spic/LiZX03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/ZhangZX03,
  author       = {Huanshui Zhang and
                  David Zhang and
                  Lihua Xie},
  title        = {H\({}_{\mbox{{\(\infty\)}}}\) fixed-lag smoothing and prediction for
                  linear continous-time systems},
  booktitle    = {American Control Conference, {ACC} 2003, Denver, CO, USA, June 4-6
                  2003},
  pages        = {4201--4206},
  publisher    = {{IEEE}},
  year         = {2003},
  url          = {https://doi.org/10.1109/ACC.2003.1240495},
  doi          = {10.1109/ACC.2003.1240495},
  timestamp    = {Mon, 06 Dec 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/amcc/ZhangZX03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caine/CheungKYZ03,
  author       = {King Hong Cheung and
                  Adams Wai{-}Kin Kong and
                  Jane You and
                  David Zhang},
  editor       = {Kendall E. Nygard},
  title        = {An Integration of Principal Component Analysis and Self-Organizing
                  Map for Effective Palmprint Retrieval},
  booktitle    = {Proceedings of the 16th International Conference on Computer Applications
                  in Industry and Engineering, November 11-13, 2003, Imperial Palace
                  Hotel, Las Vegas, Nevada, {USA}},
  pages        = {101--104},
  publisher    = {{ISCA}},
  year         = {2003},
  timestamp    = {Sat, 16 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/caine/CheungKYZ03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caine/YouKZC03,
  author       = {Jane You and
                  Adams Wai{-}Kin Kong and
                  David Zhang and
                  King Hong Cheung},
  editor       = {Kendall E. Nygard},
  title        = {On Hierarchical Palmprint Coding with Multi-Features for Personal
                  Identification in Large Databases},
  booktitle    = {Proceedings of the 16th International Conference on Computer Applications
                  in Industry and Engineering, November 11-13, 2003, Imperial Palace
                  Hotel, Las Vegas, Nevada, {USA}},
  pages        = {105--108},
  publisher    = {{ISCA}},
  year         = {2003},
  timestamp    = {Sat, 16 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/caine/YouKZC03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/WangXLZLW03,
  author       = {Kuanquan Wang and
                  Lisheng Xu and
                  Zhenguo Li and
                  David Zhang and
                  Naimin Li and
                  Shuying Wang},
  title        = {Approximate Entropy Based Pulse Variability Analysis},
  booktitle    = {16th {IEEE} Symposium on Computer-Based Medical Systems {(CBMS} 2003),
                  26-27 June 2003, New York, NY, {USA}},
  pages        = {236--241},
  publisher    = {{IEEE} Computer Society},
  year         = {2003},
  url          = {https://doi.org/10.1109/CBMS.2003.1212795},
  doi          = {10.1109/CBMS.2003.1212795},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/WangXLZLW03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/XieL0Z03,
  author       = {Lihua Xie and
                  Lilei Lu and
                  David Zhang and
                  Huanshui Zhang},
  title        = {Robust filtering for uncertain discrete-time systems: an improved
                  {LMI} approach},
  booktitle    = {42nd {IEEE} Conference on Decision and Control, {CDC} 2003, Maui,
                  Hawaii, USA, December 9-12, 2003},
  pages        = {906--911},
  publisher    = {{IEEE}},
  year         = {2003},
  url          = {https://doi.org/10.1109/CDC.2003.1272682},
  doi          = {10.1109/CDC.2003.1272682},
  timestamp    = {Mon, 07 Mar 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cdc/XieL0Z03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/Zhang00X03,
  author       = {Huanshui Zhang and
                  David Zhang and
                  Wei Wang and
                  Lihua Xie},
  title        = {Robust filtering by fictitious noises},
  booktitle    = {42nd {IEEE} Conference on Decision and Control, {CDC} 2003, Maui,
                  Hawaii, USA, December 9-12, 2003},
  pages        = {1280--1284},
  publisher    = {{IEEE}},
  year         = {2003},
  url          = {https://doi.org/10.1109/CDC.2003.1272785},
  doi          = {10.1109/CDC.2003.1272785},
  timestamp    = {Mon, 07 Mar 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cdc/Zhang00X03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cdc/Zhang0X03,
  author       = {Huanshui Zhang and
                  David Zhang and
                  Lihua Xie},
  title        = {Necessary and sufficient condition for finite horizon H\({}_{\mbox{{\(\infty\)}}}\)
                  estimation of time delay systems},
  booktitle    = {42nd {IEEE} Conference on Decision and Control, {CDC} 2003, Maui,
                  Hawaii, USA, December 9-12, 2003},
  pages        = {5735--5740},
  publisher    = {{IEEE}},
  year         = {2003},
  url          = {https://doi.org/10.1109/CDC.2003.1271919},
  doi          = {10.1109/CDC.2003.1271919},
  timestamp    = {Sat, 09 Apr 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cdc/Zhang0X03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cisst/CheungKYZ03,
  author       = {King Hong Cheung and
                  Adams Wai{-}Kin Kong and
                  Jane You and
                  David Zhang},
  editor       = {Hamid R. Arabnia and
                  Youngsong Mun},
  title        = {On Effective Palmprint Retrieval for Personal Identification},
  booktitle    = {Proceedings of the International Conference on Imaging Science, Systems
                  and Technology, {CISST} '03, June 23 - 26, 2003, Las Vegas, Nevada,
                  USA, Volume 1},
  pages        = {111--117},
  publisher    = {{CSREA} Press},
  year         = {2003},
  timestamp    = {Sat, 16 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cisst/CheungKYZ03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cisst/YouZCK03,
  author       = {Jane You and
                  David Zhang and
                  King Hong Cheung and
                  Adams Wai{-}Kin Kong},
  editor       = {Hamid R. Arabnia and
                  Youngsong Mun},
  title        = {A New Approach to Personal Identification Via Hierarchical Palmprint
                  Coding},
  booktitle    = {Proceedings of the International Conference on Imaging Science, Systems
                  and Technology, {CISST} '03, June 23 - 26, 2003, Las Vegas, Nevada,
                  USA, Volume 2},
  pages        = {531--537},
  publisher    = {{CSREA} Press},
  year         = {2003},
  timestamp    = {Sat, 16 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cisst/YouZCK03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icassp/0006BZ03,
  author       = {Lei Zhang and
                  Paul Bao and
                  David Zhang},
  title        = {Interscale image denoising with wavelet context modeling},
  booktitle    = {2003 {IEEE} International Conference on Acoustics, Speech, and Signal
                  Processing, {ICASSP} '03, Hong Kong, April 6-10, 2003},
  pages        = {97--100},
  publisher    = {{IEEE}},
  year         = {2003},
  url          = {https://doi.org/10.1109/ICASSP.2003.1201627},
  doi          = {10.1109/ICASSP.2003.1201627},
  timestamp    = {Mon, 22 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/icassp/0006BZ03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpp/YouZCG03,
  author       = {Jane You and
                  David Zhang and
                  Jiannong Cao and
                  Minyi Guo},
  title        = {Parallel Biometrics Computing Using Mobile Agents},
  booktitle    = {32nd International Conference on Parallel Processing {(ICPP} 2003),
                  6-9 October 2003, Kaohsiung, Taiwan},
  pages        = {305--312},
  publisher    = {{IEEE} Computer Society},
  year         = {2003},
  url          = {https://doi.org/10.1109/ICPP.2003.1240593},
  doi          = {10.1109/ICPP.2003.1240593},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpp/YouZCG03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/waa/YuWWZ03,
  author       = {Li Yu and
                  Kuanquan Wang and
                  Chengfa Wang and
                  David Zhang},
  editor       = {Jian Ping Li and
                  Jing Zhao and
                  M. Victor Wickerhauser and
                  Yuan Yan Tang and
                  John Daugman and
                  Lizhong Peng},
  title        = {Multiscale Wavelet Texture Based Iris Verification},
  booktitle    = {Wavelet Analysis and Its Applications, Third International Conference
                  on WAA, Chongqing, P. R. China 29-31 May 2003, Proceedings},
  pages        = {200--205},
  publisher    = {World Scientific},
  year         = {2003},
  timestamp    = {Sat, 16 Sep 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/waa/YuWWZ03.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijig/YouZ02,
  author       = {Jane You and
                  David Zhang},
  title        = {Smart Sensor: An On-Board Image Processing System for Real-Time Remote
                  Sensing},
  journal      = {Int. J. Image Graph.},
  volume       = {2},
  number       = {3},
  pages        = {481},
  year         = {2002},
  url          = {https://doi.org/10.1142/S0219467802000718},
  doi          = {10.1142/S0219467802000718},
  timestamp    = {Tue, 24 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijig/YouZ02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijprai/BianZS02,
  author       = {Zhaoqi Bian and
                  David Zhang and
                  Wei Shu},
  title        = {Knowledge-Based Fingerprint Post-Processing},
  journal      = {Int. J. Pattern Recognit. Artif. Intell.},
  volume       = {16},
  number       = {1},
  pages        = {53--67},
  year         = {2002},
  url          = {https://doi.org/10.1142/S021800140200154X},
  doi          = {10.1142/S021800140200154X},
  timestamp    = {Mon, 11 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijprai/BianZS02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijprai/LiZX02,
  author       = {Wenxin Li and
                  David Zhang and
                  Zhuoqun Xu},
  title        = {Palmprint Identification by Fourier Transform},
  journal      = {Int. J. Pattern Recognit. Artif. Intell.},
  volume       = {16},
  number       = {4},
  pages        = {417--432},
  year         = {2002},
  url          = {https://doi.org/10.1142/S0218001402001757},
  doi          = {10.1142/S0218001402001757},
  timestamp    = {Wed, 28 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijprai/LiZX02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ivc/ZhouLZW02,
  author       = {Jie Zhou and
                  Xiao guang Lu and
                  David Zhang and
                  Chenyu Wu},
  title        = {Orientation analysis for rotated human face detection},
  journal      = {Image Vis. Comput.},
  volume       = {20},
  number       = {4},
  pages        = {257--264},
  year         = {2002},
  url          = {https://doi.org/10.1016/S0262-8856(02)00018-5},
  doi          = {10.1016/S0262-8856(02)00018-5},
  timestamp    = {Wed, 16 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ivc/ZhouLZW02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/YouLZ02,
  author       = {Jane You and
                  Wenxin Li and
                  David Zhang},
  title        = {Hierarchical palmprint identification via multiple feature extraction},
  journal      = {Pattern Recognit.},
  volume       = {35},
  number       = {4},
  pages        = {847--859},
  year         = {2002},
  url          = {https://doi.org/10.1016/S0031-3203(01)00100-5},
  doi          = {10.1016/S0031-3203(01)00100-5},
  timestamp    = {Wed, 28 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/YouLZ02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/YangYZ02,
  author       = {Jian Yang and
                  Jing{-}Yu Yang and
                  David Zhang},
  title        = {What's wrong with Fisher criterion?},
  journal      = {Pattern Recognit.},
  volume       = {35},
  number       = {11},
  pages        = {2665--2668},
  year         = {2002},
  url          = {https://doi.org/10.1016/S0031-3203(02)00071-7},
  doi          = {10.1016/S0031-3203(02)00071-7},
  timestamp    = {Tue, 01 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/pr/YangYZ02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcsv/ZhangW02,
  author       = {David Dapeng Zhang and
                  Zhou Wang},
  title        = {Image information restoration based on long-range correlation},
  journal      = {{IEEE} Trans. Circuits Syst. Video Technol.},
  volume       = {12},
  number       = {5},
  pages        = {331--341},
  year         = {2002},
  url          = {https://doi.org/10.1109/TCSVT.2002.1003472},
  doi          = {10.1109/TCSVT.2002.1003472},
  timestamp    = {Fri, 30 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcsv/ZhangW02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/ZhangPZP02,
  author       = {David Zhang and
                  Hui Peng and
                  Jie Zhou and
                  Sankar K. Pal},
  title        = {A novel face recognition system using hybrid neural and dual eigenspaces
                  methods},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {A}},
  volume       = {32},
  number       = {6},
  pages        = {787--793},
  year         = {2002},
  url          = {https://doi.org/10.1109/TSMCA.2003.808252},
  doi          = {10.1109/TSMCA.2003.808252},
  timestamp    = {Wed, 16 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/ZhangPZP02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/LishengZZC02,
  author       = {Lisheng Xu and
                  Kuanquan Zhang and
                  David Zhang and
                  Shi Cheng},
  title        = {Adaptive Baseline Wander Removal in the Pulse Waveform},
  booktitle    = {15th {IEEE} Symposium on Computer-Based Medical Systems {(CBMS} 2002),
                  4-7 June 2002, Maribor, Slovenia},
  pages        = {143--148},
  publisher    = {{IEEE} Computer Society},
  year         = {2002},
  url          = {https://doi.org/10.1109/CBMS.2002.1011368},
  doi          = {10.1109/CBMS.2002.1011368},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/LishengZZC02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/LiWZ02,
  author       = {Yanlai Li and
                  Kuanquan Wang and
                  David Zhang},
  title        = {Step Acceleration Based Training Algorithm for Feedforward Neural
                  Networks},
  booktitle    = {16th International Conference on Pattern Recognition, {ICPR} 2002,
                  Quebec, Canada, August 11-15, 2002},
  pages        = {84--87},
  publisher    = {{IEEE} Computer Society},
  year         = {2002},
  url          = {https://doi.org/10.1109/ICPR.2002.1048243},
  doi          = {10.1109/ICPR.2002.1048243},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/LiWZ02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/WuWZ02,
  author       = {Xiangqian Wu and
                  Kuanquan Wang and
                  David Zhang},
  title        = {Fuzzy Directional Element Energy Feature {(FDEEF)} Based Palmprint
                  Identification},
  booktitle    = {16th International Conference on Pattern Recognition, {ICPR} 2002,
                  Quebec, Canada, August 11-15, 2002},
  pages        = {95--98},
  publisher    = {{IEEE} Computer Society},
  year         = {2002},
  url          = {https://doi.org/10.1109/ICPR.2002.1044621},
  doi          = {10.1109/ICPR.2002.1044621},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/WuWZ02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/ZhouZ02,
  author       = {Jie Zhou and
                  David Zhang},
  title        = {Face Recognition by Combining Several Algorithms},
  booktitle    = {16th International Conference on Pattern Recognition, {ICPR} 2002,
                  Quebec, Canada, August 11-15, 2002},
  pages        = {497},
  publisher    = {{IEEE} Computer Society},
  year         = {2002},
  url          = {https://doi.org/10.1109/ICPR.2002.1047985},
  doi          = {10.1109/ICPR.2002.1047985},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/ZhouZ02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/PangWZZ02,
  author       = {Bo Pang and
                  Kuanquan Wang and
                  David Zhang and
                  Fengmiao Zhang},
  title        = {On Automated Tongue Image Segmentation in Chinese Medicine},
  booktitle    = {16th International Conference on Pattern Recognition, {ICPR} 2002,
                  Quebec, Canada, August 11-15, 2002},
  pages        = {616--619},
  publisher    = {{IEEE} Computer Society},
  year         = {2002},
  url          = {https://doi.org/10.1109/ICPR.2002.1044817},
  doi          = {10.1109/ICPR.2002.1044817},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/PangWZZ02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/KongZ02,
  author       = {Adams Wai{-}Kin Kong and
                  David Zhang},
  title        = {Palmprint Texture Analysis Based on Low-Resolution Images for Personal
                  Authentication},
  booktitle    = {16th International Conference on Pattern Recognition, {ICPR} 2002,
                  Quebec, Canada, August 11-15, 2002},
  pages        = {807--810},
  publisher    = {{IEEE} Computer Society},
  year         = {2002},
  url          = {https://doi.org/10.1109/ICPR.2002.1048142},
  doi          = {10.1109/ICPR.2002.1048142},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/KongZ02.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cg/YinPSZ01,
  author       = {KangKang Yin and
                  Zhigeng Pan and
                  Jiaoying Shi and
                  David Zhang},
  title        = {Robust mesh watermarking based on multiresolution processing},
  journal      = {Comput. Graph.},
  volume       = {25},
  number       = {3},
  pages        = {409--420},
  year         = {2001},
  url          = {https://doi.org/10.1016/S0097-8493(01)00065-6},
  doi          = {10.1016/S0097-8493(01)00065-6},
  timestamp    = {Wed, 19 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cg/YinPSZ01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijig/ShuRBZ01,
  author       = {Wei Shu and
                  Gang Rong and
                  Zhaoqi Bian and
                  David Zhang},
  title        = {Automatic Palmprint Verification},
  journal      = {Int. J. Image Graph.},
  volume       = {1},
  number       = {1},
  pages        = {135--151},
  year         = {2001},
  url          = {https://doi.org/10.1142/S0219467801000104},
  doi          = {10.1142/S0219467801000104},
  timestamp    = {Tue, 24 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ijig/ShuRBZ01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jss/CaiCWYZ01,
  author       = {Kai{-}Yuan Cai and
                  Lin Cai and
                  Weidong Wang and
                  Zhou{-}Yi Yu and
                  David Zhang},
  title        = {On the neural network approach in software reliability modeling},
  journal      = {J. Syst. Softw.},
  volume       = {58},
  number       = {1},
  pages        = {47--62},
  year         = {2001},
  url          = {https://doi.org/10.1016/S0164-1212(01)00027-9},
  doi          = {10.1016/S0164-1212(01)00027-9},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jss/CaiCWYZ01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npsc/ZhuHSZ01,
  author       = {Xiaoyan Zhu and
                  Yu Hao and
                  Yifan Shi and
                  David Zhang},
  title        = {An effective result-feedback neural algorithm for handwritten character
                  recognition},
  journal      = {Neural Parallel Sci. Comput.},
  volume       = {9},
  number       = {2},
  pages        = {139--150},
  year         = {2001},
  url          = {http://dl.acm.org/citation.cfm?id=639014},
  timestamp    = {Wed, 02 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/npsc/ZhuHSZ01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cvpr/ZhouXGZZ01,
  author       = {Jie Zhou and
                  Le{-}ping Xin and
                  Dashan Gao and
                  Changshui Zhang and
                  David Zhang},
  title        = {Automated Cartridge Identification for Firearm Authentication},
  booktitle    = {2001 {IEEE} Computer Society Conference on Computer Vision and Pattern
                  Recognition {(CVPR} 2001), with CD-ROM, 8-14 December 2001, Kauai,
                  HI, {USA}},
  pages        = {749--754},
  publisher    = {{IEEE} Computer Society},
  year         = {2001},
  url          = {https://doi.org/10.1109/CVPR.2001.990551},
  doi          = {10.1109/CVPR.2001.990551},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cvpr/ZhouXGZZ01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/spieSR/LiZXY01,
  author       = {Wenxin Li and
                  David Zhang and
                  Zhuoqun Xu and
                  Jane You},
  editor       = {Minerva M. Yeung and
                  Chung{-}Sheng Li and
                  Rainer Lienhart},
  title        = {Texture-based approach to palmprint retrieval for personal identification},
  booktitle    = {Storage and Retrieval for Media Databases 2001, San Jose, CA, USA,
                  January 24, 2001},
  series       = {{SPIE} Proceedings},
  volume       = {4315},
  pages        = {415--424},
  publisher    = {{SPIE}},
  year         = {2001},
  url          = {https://doi.org/10.1117/12.410952},
  doi          = {10.1117/12.410952},
  timestamp    = {Wed, 28 Oct 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/spieSR/LiZXY01.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spic/WangZY00,
  author       = {Zhou Wang and
                  David Zhang and
                  Yinglin Yu},
  title        = {Hybrid image coding based on partial fractal mapping},
  journal      = {Signal Process. Image Commun.},
  volume       = {15},
  number       = {9},
  pages        = {767--779},
  year         = {2000},
  url          = {https://doi.org/10.1016/S0923-5965(99)00018-1},
  doi          = {10.1016/S0923-5965(99)00018-1},
  timestamp    = {Fri, 30 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/spic/WangZY00.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tnn/ZhangP00,
  author       = {David Zhang and
                  Sankar K. Pal},
  title        = {A fuzzy clustering neural networks (FCNs) system design methodology},
  journal      = {{IEEE} Trans. Neural Networks Learn. Syst.},
  volume       = {11},
  number       = {5},
  pages        = {1174--1177},
  year         = {2000},
  url          = {https://doi.org/10.1109/72.870048},
  doi          = {10.1109/72.870048},
  timestamp    = {Mon, 09 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tnn/ZhangP00.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/ZhangP00,
  author       = {David Zhang and
                  Sankar K. Pal},
  title        = {Parallel system design for time-delay neural networks},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {C}},
  volume       = {30},
  number       = {2},
  pages        = {265--275},
  year         = {2000},
  url          = {https://doi.org/10.1109/5326.868447},
  doi          = {10.1109/5326.868447},
  timestamp    = {Thu, 21 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/ZhangP00.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/YiyingZZ00,
  author       = {Yiying Zhang and
                  David Zhang and
                  Xiaoyan Zhu},
  title        = {A novel text-independent speaker verification method based on the
                  global speaker model},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {A}},
  volume       = {30},
  number       = {5},
  pages        = {598--602},
  year         = {2000},
  url          = {https://doi.org/10.1109/3468.867867},
  doi          = {10.1109/3468.867867},
  timestamp    = {Mon, 25 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/YiyingZZ00.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tsmc/ZhangZZ00,
  author       = {Y. Zhang and
                  X. Zhu and
                  David Zhang},
  title        = {Correction to a novel text-independent speaker verification method
                  based on the global speaker model},
  journal      = {{IEEE} Trans. Syst. Man Cybern. Part {A}},
  volume       = {30},
  number       = {6},
  pages        = {883},
  year         = {2000},
  url          = {https://doi.org/10.1109/TSMCA.2000.895929},
  doi          = {10.1109/TSMCA.2000.895929},
  timestamp    = {Mon, 25 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tsmc/ZhangZZ00.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icppw/LiZLQ00,
  author       = {Wen Li and
                  David Dapeng Zhang and
                  Zhiyong Liu and
                  Xiangzhen Qiao},
  title        = {A Jump and Look All Round Long Range Image Restoration and Its Parallelism},
  booktitle    = {Proceedings of the 2000 International Workshop on Parallel Processing,
                  {ICPPW} 2000, Toronto, Canada, August 21-24, 2000},
  pages        = {285--290},
  publisher    = {{IEEE} Computer Society},
  year         = {2000},
  url          = {https://doi.org/10.1109/ICPPW.2000.869114},
  doi          = {10.1109/ICPPW.2000.869114},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icppw/LiZLQ00.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/smc/ZhouXRZ00,
  author       = {Jie Zhou and
                  Le{-}ping Xin and
                  Gang Rong and
                  David Zhang},
  title        = {Decision fusion based cartridge identification using Support Vector
                  Machine},
  booktitle    = {Proceedings of the {IEEE} International Conference on Systems, Man
                  {\&} Cybernetics: "Cybernetics Evolving to Systems, Humans, Organizations,
                  and their Complex Interactions", Sheraton Music City Hotel, Nashville,
                  Tennessee, USA, 8-11 October 2000},
  pages        = {2873--2877},
  publisher    = {{IEEE}},
  year         = {2000},
  url          = {https://doi.org/10.1109/ICSMC.2000.884434},
  doi          = {10.1109/ICSMC.2000.884434},
  timestamp    = {Wed, 16 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/smc/ZhouXRZ00.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/pr/ZhangS99,
  author       = {David Dapeng Zhang and
                  Wei Shu},
  title        = {Two novel characteristics in palmprint verification: datum point invariance
                  and line feature matching},
  journal      = {Pattern Recognit.},
  volume       = {32},
  number       = {4},
  pages        = {691--702},
  year         = {1999},
  url          = {https://doi.org/10.1016/S0031-3203(98)00117-4},
  doi          = {10.1016/S0031-3203(98)00117-4},
  timestamp    = {Mon, 24 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/pr/ZhangS99.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cn/TongZ98,
  author       = {Franky H. F. Tong and
                  David Zhang},
  title        = {A new progressive colour image transmission scheme for the World Wide
                  Web},
  journal      = {Comput. Networks},
  volume       = {30},
  number       = {20-21},
  pages        = {2059--2064},
  year         = {1998},
  url          = {https://doi.org/10.1016/S0169-7552(98)00210-4},
  doi          = {10.1016/S0169-7552(98)00210-4},
  timestamp    = {Wed, 19 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cn/TongZ98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spl/WangZ98,
  author       = {Zhou Wang and
                  David Zhang},
  title        = {Restoration of impulse noise corrupted images using long-range correlation},
  journal      = {{IEEE} Signal Process. Lett.},
  volume       = {5},
  number       = {1},
  pages        = {4--7},
  year         = {1998},
  url          = {https://doi.org/10.1109/97.654865},
  doi          = {10.1109/97.654865},
  timestamp    = {Fri, 30 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/spl/WangZ98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcom/WangZ98,
  author       = {Zhou Wang and
                  David Dapeng Zhang},
  title        = {A novel approach for reduction of blocking effects in low-bit-rate
                  image compression},
  journal      = {{IEEE} Trans. Commun.},
  volume       = {46},
  number       = {6},
  pages        = {732--734},
  year         = {1998},
  url          = {https://doi.org/10.1109/26.681401},
  doi          = {10.1109/26.681401},
  timestamp    = {Fri, 30 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcom/WangZ98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tip/WangYZ98,
  author       = {Zhou Wang and
                  Yinglin Yu and
                  David Zhang},
  title        = {Best neighborhood matching: an information loss restoration technique
                  for block-based image coding systems},
  journal      = {{IEEE} Trans. Image Process.},
  volume       = {7},
  number       = {7},
  pages        = {1056--1061},
  year         = {1998},
  url          = {https://doi.org/10.1109/83.701166},
  doi          = {10.1109/83.701166},
  timestamp    = {Fri, 30 Jul 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tip/WangYZ98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icpr/ShuZ98,
  author       = {Wei Shu and
                  David Zhang},
  editor       = {Anil K. Jain and
                  Svetha Venkatesh and
                  Brian C. Lovell},
  title        = {Palmprint verification: an implementation of biometric technology},
  booktitle    = {Fourteenth International Conference on Pattern Recognition, {ICPR}
                  1998, Brisbane, Australia, 16-20 August, 1998},
  pages        = {219--221},
  publisher    = {{IEEE} Computer Society},
  year         = {1998},
  url          = {https://doi.org/10.1109/ICPR.1998.711120},
  doi          = {10.1109/ICPR.1998.711120},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/icpr/ShuZ98.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tvlsi/ZhangE97,
  author       = {David Zhang and
                  Mohamed I. Elmasry},
  title        = {{VLSI} compressor design with applications to digital neural networks},
  journal      = {{IEEE} Trans. Very Large Scale Integr. Syst.},
  volume       = {5},
  number       = {2},
  pages        = {230--233},
  year         = {1997},
  url          = {https://doi.org/10.1109/92.585226},
  doi          = {10.1109/92.585226},
  timestamp    = {Wed, 11 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/tvlsi/ZhangE97.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/apdc/Zhang97,
  author       = {David Dapeng Zhang},
  title        = {Parallel {VLSI} Neural System Design for Time-Delay Speech Recognition
                  Computing},
  booktitle    = {Proceedings of the 1997 Advances in Parallel and Distributed Computing
                  Conference {(APDC} '97), March 19-21, 1997, Shanghai, China},
  pages        = {12--17},
  publisher    = {{IEEE} Computer Society},
  year         = {1997},
  url          = {https://doi.org/10.1109/APDC.1997.574008},
  doi          = {10.1109/APDC.1997.574008},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/apdc/Zhang97.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijns/ZhangJ96,
  author       = {David Zhang and
                  Graham A. Jullien},
  title        = {{VLSI} Neural System Architecture for Finite Ring Recursive Reduction},
  journal      = {Int. J. Neural Syst.},
  volume       = {7},
  number       = {6},
  pages        = {697--708},
  year         = {1996},
  url          = {http://ejournals.wspc.com.sg/ijns/07/0706/jull.html},
  timestamp    = {Thu, 24 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijns/ZhangJ96.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jcsc/ZhangE96,
  author       = {David Zhang and
                  Mohamed I. Elmasry},
  title        = {A Digital Perceptron Learning Implementation with Look-up Table Feedback
                  Layer},
  journal      = {J. Circuits Syst. Comput.},
  volume       = {6},
  number       = {1},
  pages        = {79--84},
  year         = {1996},
  url          = {https://doi.org/10.1142/S021812669600008X},
  doi          = {10.1142/S021812669600008X},
  timestamp    = {Tue, 25 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jcsc/ZhangE96.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npsc/ZhangE96,
  author       = {David Zhang and
                  Mohamed I. Elmasry},
  title        = {Mapping neural networks onto systolic arrays},
  journal      = {Neural Parallel Sci. Comput.},
  volume       = {4},
  number       = {3},
  pages        = {341--352},
  year         = {1996},
  url          = {http://dl.acm.org/citation.cfm?id=241624},
  timestamp    = {Thu, 27 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/npsc/ZhangE96.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npsc/ZhangE96a,
  author       = {David Zhang and
                  Mohamed I. Elmasry},
  title        = {A parallel digital layered perceptrons implementation},
  journal      = {Neural Parallel Sci. Comput.},
  volume       = {4},
  number       = {4},
  pages        = {493--504},
  year         = {1996},
  url          = {http://dl.acm.org/citation.cfm?id=254756},
  timestamp    = {Thu, 27 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/npsc/ZhangE96a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npsc/ZhangGE95,
  author       = {David Zhang and
                  Richard X. Gu and
                  Mohamed I. Elmasry},
  title        = {A programmable neural network architecture using BiCMOS technology},
  journal      = {Neural Parallel Sci. Comput.},
  volume       = {3},
  number       = {1},
  pages        = {103--113},
  year         = {1995},
  url          = {http://dl.acm.org/citation.cfm?id=204450},
  timestamp    = {Mon, 18 Jul 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/npsc/ZhangGE95.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jifs/ZhangKE94,
  author       = {David Zhang and
                  Mohamed Kamel and
                  Mohamed I. Elmasry},
  title        = {Fuzzy Clustering Neural Network {(FCNN):} Competitive Learning and
                  Parallel Architecture},
  journal      = {J. Intell. Fuzzy Syst.},
  volume       = {2},
  number       = {4},
  pages        = {289--298},
  year         = {1994},
  url          = {https://doi.org/10.3233/IFS-1994-2402},
  doi          = {10.3233/IFS-1994-2402},
  timestamp    = {Mon, 28 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jifs/ZhangKE94.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jssc/JullienMGPBZ94,
  author       = {Graham A. Jullien and
                  William C. Miller and
                  Roger Grondin and
                  Lino Del Pup and
                  Sami S. Bizzan and
                  David Zhang},
  title        = {Dynamic computational blocks for bit-level systolic arrays},
  journal      = {{IEEE} J. Solid State Circuits},
  volume       = {29},
  number       = {1},
  pages        = {14--22},
  year         = {1994},
  url          = {https://doi.org/10.1109/4.272090},
  doi          = {10.1109/4.272090},
  timestamp    = {Mon, 28 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jssc/JullienMGPBZ94.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/npsc/ZhangDE94,
  author       = {David Zhang and
                  Li Deng and
                  Mohamed I. Elmasry},
  title        = {Pipelined architecture for neural-network-based speech recognition},
  journal      = {Neural Parallel Sci. Comput.},
  volume       = {2},
  number       = {1},
  pages        = {81--92},
  year         = {1994},
  url          = {http://dl.acm.org/citation.cfm?id=184206},
  timestamp    = {Thu, 27 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/npsc/ZhangDE94.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/arith/ZhangJMS91,
  author       = {David Zhang and
                  Graham A. Jullien and
                  William C. Miller and
                  Earl E. Swartzlander Jr.},
  title        = {Arithmetic for digital neural networks},
  booktitle    = {10th {IEEE} Symposium on Computer Arithmetic, {ARITH} 1991, Grenoble,
                  France, June 26-28, 1991},
  pages        = {58--63},
  publisher    = {{IEEE}},
  year         = {1991},
  url          = {https://doi.org/10.1109/ARITH.1991.145534},
  doi          = {10.1109/ARITH.1991.145534},
  timestamp    = {Thu, 24 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/arith/ZhangJMS91.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mva/ZhangB88,
  author       = {David Dapeng Zhang and
                  Zhaoqi Bian},
  title        = {Some Researches of Pyramid Structure in Robot Vision System},
  booktitle    = {Proceedings of {IAPR} Workshop on Computer Vision - Special Hardware
                  and Industrial Applications, {MVA} 1988, Tokyo, Japan, October 12-14,
                  1988},
  pages        = {124--127},
  year         = {1988},
  url          = {http://www.mva-org.jp/Proceedings/CommemorativeDVD/1988/papers/1988124.pdf},
  timestamp    = {Thu, 12 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/mva/ZhangB88.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
a service of  Schloss Dagstuhl - Leibniz Center for Informatics