Stop the war!
Остановите войну!
for scientists:
default search action
BibTeX records: David Zhang 0001
@article{DBLP:journals/cbm/ZhangJLZ24, author = {Nannan Zhang and Zhixing Jiang and Mu Li and David Zhang}, title = {A novel multi-feature learning model for disease diagnosis using face skin images}, journal = {Comput. Biol. Medicine}, volume = {168}, pages = {107837}, year = {2024}, url = {https://doi.org/10.1016/j.compbiomed.2023.107837}, doi = {10.1016/J.COMPBIOMED.2023.107837}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cbm/ZhangJLZ24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/PengLCXXSZ24, author = {Tianhao Peng and Mu Li and Fangmei Chen and Yong Xu and Yuan Xie and Yahan Sun and David Zhang}, title = {{ISFB-GAN:} Interpretable semantic face beautification with generative adversarial network}, journal = {Expert Syst. Appl.}, volume = {236}, pages = {121131}, year = {2024}, url = {https://doi.org/10.1016/j.eswa.2023.121131}, doi = {10.1016/J.ESWA.2023.121131}, timestamp = {Sun, 10 Dec 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/eswa/PengLCXXSZ24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/ZengCHLZC24, author = {Biqing Zeng and Junlong Chi and Peilin Hong and Guangming Lu and David Zhang and Bingzhi Chen}, title = {Context-aware graph embedding with gate and attention for session-based recommendation}, journal = {Neurocomputing}, volume = {574}, pages = {127221}, year = {2024}, url = {https://doi.org/10.1016/j.neucom.2023.127221}, doi = {10.1016/J.NEUCOM.2023.127221}, timestamp = {Thu, 29 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/ZengCHLZC24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/inffus/LiZJLLXZ24, author = {Jinxing Li and Chuhao Zhou and Xiaoqiang Ji and Mu Li and Guangming Lu and Yong Xu and David Zhang}, title = {Multi-view Instance Attention Fusion Network for classification}, journal = {Inf. Fusion}, volume = {101}, pages = {101974}, year = {2024}, url = {https://doi.org/10.1016/j.inffus.2023.101974}, doi = {10.1016/J.INFFUS.2023.101974}, timestamp = {Fri, 27 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/inffus/LiZJLLXZ24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/LiuLYZ24, author = {Guang{-}Hai Liu and Zuo{-}Yong Li and Jing{-}Yu Yang and David Zhang}, title = {Exploiting sublimated deep features for image retrieval}, journal = {Pattern Recognit.}, volume = {147}, pages = {110076}, year = {2024}, url = {https://doi.org/10.1016/j.patcog.2023.110076}, doi = {10.1016/J.PATCOG.2023.110076}, timestamp = {Fri, 26 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/LiuLYZ24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/FengJPLLZ24, author = {Xin Feng and Haobo Ji and Wenjie Pei and Jinxing Li and Guangming Lu and David Zhang}, title = {U{\({^2}\)}-Former: Nested U-Shaped Transformer for Image Restoration via Multi-View Contrastive Learning}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {34}, number = {1}, pages = {168--181}, year = {2024}, url = {https://doi.org/10.1109/TCSVT.2023.3286405}, doi = {10.1109/TCSVT.2023.3286405}, timestamp = {Fri, 26 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcsv/FengJPLLZ24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tmi/LiLFLZ24, author = {Wei Li and Guanghai Liu and Haoyi Fan and Zuoyong Li and David Zhang}, title = {Self-Supervised Multi-Scale Cropping and Simple Masked Attentive Predicting for Lung CT-Scan Anomaly Detection}, journal = {{IEEE} Trans. Medical Imaging}, volume = {43}, number = {1}, pages = {594--607}, year = {2024}, url = {https://doi.org/10.1109/TMI.2023.3313778}, doi = {10.1109/TMI.2023.3313778}, timestamp = {Fri, 26 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tmi/LiLFLZ24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/WuWXYLZ24, author = {Zhihao Wu and Jie Wen and Yong Xu and Jian Yang and Xuelong Li and David Zhang}, title = {Enhanced Spatial Feature Learning for Weakly Supervised Object Detection}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {35}, number = {1}, pages = {961--972}, year = {2024}, url = {https://doi.org/10.1109/TNNLS.2022.3178180}, doi = {10.1109/TNNLS.2022.3178180}, timestamp = {Fri, 26 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tnn/WuWXYLZ24.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/air/MinaeeASB023, author = {Shervin Minaee and Amirali Abdolrashidi and Hang Su and Mohammed Bennamoun and David Zhang}, title = {Biometrics recognition using deep learning: a survey}, journal = {Artif. Intell. Rev.}, volume = {56}, number = {8}, pages = {8647--8695}, year = {2023}, url = {https://doi.org/10.1007/s10462-022-10237-x}, doi = {10.1007/S10462-022-10237-X}, timestamp = {Sun, 06 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/air/MinaeeASB023.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cbm/ZhangJLZ23, author = {Nannan Zhang and Zhixing Jiang and Jinxing Li and David Zhang}, title = {Multiple color representation and fusion for diabetes mellitus diagnosis based on back tongue images}, journal = {Comput. Biol. Medicine}, volume = {155}, pages = {106652}, year = {2023}, url = {https://doi.org/10.1016/j.compbiomed.2023.106652}, doi = {10.1016/J.COMPBIOMED.2023.106652}, timestamp = {Tue, 30 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cbm/ZhangJLZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/GuoFJZ23, author = {Chaoxun Guo and Dandan Fan and Zhixing Jiang and David Zhang}, title = {{MDFN:} Mask deep fusion network for visible and infrared image fusion without reference ground-truth}, journal = {Expert Syst. Appl.}, volume = {211}, pages = {118631}, year = {2023}, url = {https://doi.org/10.1016/j.eswa.2022.118631}, doi = {10.1016/J.ESWA.2022.118631}, timestamp = {Wed, 17 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/eswa/GuoFJZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijcv/HeZGZ23, author = {Zhenwei He and Lei Zhang and Xinbo Gao and David Zhang}, title = {Multi-adversarial Faster-RCNN with Paradigm Teacher for Unrestricted Object Detection}, journal = {Int. J. Comput. Vis.}, volume = {131}, number = {3}, pages = {680--700}, year = {2023}, url = {https://doi.org/10.1007/s11263-022-01728-z}, doi = {10.1007/S11263-022-01728-Z}, timestamp = {Sat, 11 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijcv/HeZGZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/inffus/JiangLLLZL23, author = {Bo Jiang and Jinxing Li and Huafeng Li and Ruxian Li and David Zhang and Guangming Lu}, title = {Enhanced Frequency Fusion Network with Dynamic Hash Attention for image denoising}, journal = {Inf. Fusion}, volume = {92}, pages = {420--434}, year = {2023}, url = {https://doi.org/10.1016/j.inffus.2022.12.015}, doi = {10.1016/J.INFFUS.2022.12.015}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/inffus/JiangLLLZL23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jstsp/LiangFYJLZ23, author = {Xu Liang and Dandan Fan and Jinyang Yang and Wei Jia and Guangming Lu and David Zhang}, title = {PKLNet: Keypoint Localization Neural Network for Touchless Palmprint Recognition Based on Edge-Aware Regression}, journal = {{IEEE} J. Sel. Top. Signal Process.}, volume = {17}, number = {3}, pages = {662--676}, year = {2023}, url = {https://doi.org/10.1109/JSTSP.2023.3241540}, doi = {10.1109/JSTSP.2023.3241540}, timestamp = {Sat, 05 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jstsp/LiangFYJLZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/kbs/NingJZ23, author = {Zhihan Ning and Zhixing Jiang and David Zhang}, title = {Sparse projection infinite selection ensemble for imbalanced classification}, journal = {Knowl. Based Syst.}, volume = {262}, pages = {110246}, year = {2023}, url = {https://doi.org/10.1016/j.knosys.2022.110246}, doi = {10.1016/J.KNOSYS.2022.110246}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/kbs/NingJZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nca/ZhangLLCLZ23, author = {Le Zhang and Yao Lu and Jinxing Li and Fanglin Chen and Guangming Lu and David Zhang}, title = {Deep adaptive hiding network for image hiding using attentive frequency extraction and gradual depth extraction}, journal = {Neural Comput. Appl.}, volume = {35}, number = {15}, pages = {10909--10927}, year = {2023}, url = {https://doi.org/10.1007/s00521-023-08274-w}, doi = {10.1007/S00521-023-08274-W}, timestamp = {Sat, 29 Apr 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nca/ZhangLLCLZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pami/JiaJSCDZ23, author = {Xiaodong Jia and Xiao{-}Yuan Jing and Qixing Sun and Songcan Chen and Bo Du and David Zhang}, title = {Human Collective Intelligence Inspired Multi-View Representation Learning - Enabling View Communication by Simulating Human Communication Mechanism}, journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.}, volume = {45}, number = {6}, pages = {7412--7429}, year = {2023}, url = {https://doi.org/10.1109/TPAMI.2022.3218605}, doi = {10.1109/TPAMI.2022.3218605}, timestamp = {Wed, 17 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pami/JiaJSCDZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/TianZZZZZ23, author = {Chunwei Tian and Menghua Zheng and Wangmeng Zuo and Bob Zhang and Yanning Zhang and David Zhang}, title = {Multi-stage image denoising with the wavelet transform}, journal = {Pattern Recognit.}, volume = {134}, pages = {109050}, year = {2023}, url = {https://doi.org/10.1016/j.patcog.2022.109050}, doi = {10.1016/J.PATCOG.2022.109050}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/TianZZZZZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/PengLCXZ23, author = {Tianhao Peng and Mu Li and Fangmei Chen and Yong Xu and David Zhang}, title = {Learning efficient facial landmark model for human attractiveness analysis}, journal = {Pattern Recognit.}, volume = {138}, pages = {109370}, year = {2023}, url = {https://doi.org/10.1016/j.patcog.2023.109370}, doi = {10.1016/J.PATCOG.2023.109370}, timestamp = {Tue, 01 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/PengLCXZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/taffco/LiLLZZ23, author = {Yingjian Li and Guangming Lu and Jinxing Li and Zheng Zhang and David Zhang}, title = {Facial Expression Recognition in the Wild Using Multi-Level Features and Attention Mechanisms}, journal = {{IEEE} Trans. Affect. Comput.}, volume = {14}, number = {1}, pages = {451--462}, year = {2023}, url = {https://doi.org/10.1109/TAFFC.2020.3031602}, doi = {10.1109/TAFFC.2020.3031602}, timestamp = {Sat, 11 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/taffco/LiLLZZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/LiuZZ23, author = {Zhipu Liu and Lei Zhang and David Zhang}, title = {Neural Image Parts Group Search for Person Re-Identification}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {33}, number = {6}, pages = {2724--2737}, year = {2023}, url = {https://doi.org/10.1109/TCSVT.2022.3225285}, doi = {10.1109/TCSVT.2022.3225285}, timestamp = {Thu, 15 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcsv/LiuZZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tifs/ZhuZFZZ23, author = {Qi Zhu and Yuze Zhou and Lunke Fei and Daoqiang Zhang and David Zhang}, title = {Multi-Spectral Palmprints Joint Attack and Defense With Adversarial Examples Learning}, journal = {{IEEE} Trans. Inf. Forensics Secur.}, volume = {18}, pages = {1789--1799}, year = {2023}, url = {https://doi.org/10.1109/TIFS.2023.3254432}, doi = {10.1109/TIFS.2023.3254432}, timestamp = {Sun, 16 Apr 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tifs/ZhuZFZZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tifs/ZhuXFLZZZ23, author = {Qi Zhu and Guangnan Xin and Lunke Fei and Dong Liang and Zheng Zhang and Daoqiang Zhang and David Zhang}, title = {Contactless Palmprint Image Recognition Across Smartphones With Self-Paced CycleGAN}, journal = {{IEEE} Trans. Inf. Forensics Secur.}, volume = {18}, pages = {4944--4954}, year = {2023}, url = {https://doi.org/10.1109/TIFS.2023.3301729}, doi = {10.1109/TIFS.2023.3301729}, timestamp = {Fri, 18 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tifs/ZhuXFLZZZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/LinPCZL23, author = {Zebin Lin and Wenjie Pei and Fanglin Chen and David Zhang and Guangming Lu}, title = {Pedestrian Detection by Exemplar-Guided Contrastive Learning}, journal = {{IEEE} Trans. Image Process.}, volume = {32}, pages = {2003--2016}, year = {2023}, url = {https://doi.org/10.1109/TIP.2022.3189803}, doi = {10.1109/TIP.2022.3189803}, timestamp = {Sat, 29 Apr 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/LinPCZL23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/ZhangLZZ23, author = {Lei Zhang and Zhipu Liu and Wensheng Zhang and David Zhang}, title = {Style Uncertainty Based Self-Paced Meta Learning for Generalizable Person Re-Identification}, journal = {{IEEE} Trans. Image Process.}, volume = {32}, pages = {2107--2119}, year = {2023}, url = {https://doi.org/10.1109/TIP.2023.3263112}, doi = {10.1109/TIP.2023.3263112}, timestamp = {Sun, 22 Oct 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/ZhangLZZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/CaiQLLYWZ23, author = {Qing Cai and Yiming Qian and Jinxing Li and Jun Lyu and Yee{-}Hong Yang and Feng Wu and David Zhang}, title = {{HIPA:} Hierarchical Patch Transformer for Single Image Super Resolution}, journal = {{IEEE} Trans. Image Process.}, volume = {32}, pages = {3226--3237}, year = {2023}, url = {https://doi.org/10.1109/TIP.2023.3279977}, doi = {10.1109/TIP.2023.3279977}, timestamp = {Thu, 15 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/CaiQLLYWZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tmm/WuWXYZ23, author = {Zhihao Wu and Jie Wen and Yong Xu and Jian Yang and David Zhang}, title = {Multiple Instance Detection Networks With Adaptive Instance Refinement}, journal = {{IEEE} Trans. Multim.}, volume = {25}, pages = {267--279}, year = {2023}, url = {https://doi.org/10.1109/TMM.2021.3125130}, doi = {10.1109/TMM.2021.3125130}, timestamp = {Fri, 12 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tmm/WuWXYZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tmm/LiZCLZ23, author = {Yingjian Li and Zheng Zhang and Bingzhi Chen and Guangming Lu and David Zhang}, title = {Deep Margin-Sensitive Representation Learning for Cross-Domain Facial Expression Recognition}, journal = {{IEEE} Trans. Multim.}, volume = {25}, pages = {1359--1373}, year = {2023}, url = {https://doi.org/10.1109/TMM.2022.3141604}, doi = {10.1109/TMM.2022.3141604}, timestamp = {Wed, 17 May 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tmm/LiZCLZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/LiZLZTZ23, author = {Mu Li and Kai Zhang and Jinxing Li and Wangmeng Zuo and Radu Timofte and David Zhang}, title = {Learning Context-Based Nonlocal Entropy Modeling for Image Compression}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {34}, number = {3}, pages = {1132--1145}, year = {2023}, url = {https://doi.org/10.1109/TNNLS.2021.3104974}, doi = {10.1109/TNNLS.2021.3104974}, timestamp = {Mon, 28 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tnn/LiZLZTZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/HuangWXJYWZ23, author = {Chao Huang and Jie Wen and Yong Xu and Qiuping Jiang and Jian Yang and Yaowei Wang and David Zhang}, title = {Self-Supervised Attentive Generative Adversarial Networks for Video Anomaly Detection}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {34}, number = {11}, pages = {9389--9403}, year = {2023}, url = {https://doi.org/10.1109/TNNLS.2022.3159538}, doi = {10.1109/TNNLS.2022.3159538}, timestamp = {Thu, 09 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tnn/HuangWXJYWZ23.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/smc/ZhangZNWBJ023, author = {Weilong Zhang and Chongyang Zhang and Zhihan Ning and Guopeng Wang and Yingjie Bai and Zhixing Jiang and David Zhang}, title = {{M2SH:} {A} Hybrid Approach to Table Structure Recognition using Two-Stage Multi-Modality Feature Fusion}, booktitle = {{IEEE} International Conference on Systems, Man, and Cybernetics, {SMC} 2023, Honolulu, Oahu, HI, USA, October 1-4, 2023}, pages = {791--798}, publisher = {{IEEE}}, year = {2023}, url = {https://doi.org/10.1109/SMC53992.2023.10394093}, doi = {10.1109/SMC53992.2023.10394093}, timestamp = {Tue, 13 Feb 2024 09:22:04 +0100}, biburl = {https://dblp.org/rec/conf/smc/ZhangZNWBJ023.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@book{DBLP:books/sp/LiZZ22, author = {Jinxing Li and Bob Zhang and David Zhang}, title = {Information Fusion - Machine Learning Methods}, publisher = {Springer}, year = {2022}, url = {https://doi.org/10.1007/978-981-16-8976-5}, doi = {10.1007/978-981-16-8976-5}, isbn = {978-981-16-8975-8}, timestamp = {Mon, 14 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/books/sp/LiZZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cbm/GuoJHLZ22, author = {Chaoxun Guo and Zhixing Jiang and Haoze He and Yining Liao and David Zhang}, title = {Wrist pulse signal acquisition and analysis for disease diagnosis: {A} review}, journal = {Comput. Biol. Medicine}, volume = {143}, pages = {105312}, year = {2022}, url = {https://doi.org/10.1016/j.compbiomed.2022.105312}, doi = {10.1016/J.COMPBIOMED.2022.105312}, timestamp = {Mon, 04 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cbm/GuoJHLZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cmpb/JiangGZ22, author = {Zhixing Jiang and Chaoxun Guo and David Zhang}, title = {Pressure wrist pulse signal analysis by sparse decomposition using improved Gabor function}, journal = {Comput. Methods Programs Biomed.}, volume = {219}, pages = {106766}, year = {2022}, url = {https://doi.org/10.1016/j.cmpb.2022.106766}, doi = {10.1016/J.CMPB.2022.106766}, timestamp = {Tue, 16 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cmpb/JiangGZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/isci/NingYJZ22, author = {Zhihan Ning and Ziqing Ye and Zhixing Jiang and David Zhang}, title = {{BESS:} Balanced evolutionary semi-stacking for disease detection using partially labeled imbalanced data}, journal = {Inf. Sci.}, volume = {594}, pages = {233--248}, year = {2022}, url = {https://doi.org/10.1016/j.ins.2022.02.026}, doi = {10.1016/J.INS.2022.02.026}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/isci/NingYJZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/isci/ZhangLCCZ22, author = {Fan Zhang and Huiying Liu and Chuanshuo Cao and Qing Cai and David Zhang}, title = {{RVLSM:} Robust variational level set method for image segmentation with intensity inhomogeneity and high noise}, journal = {Inf. Sci.}, volume = {596}, pages = {439--459}, year = {2022}, url = {https://doi.org/10.1016/j.ins.2022.03.035}, doi = {10.1016/J.INS.2022.03.035}, timestamp = {Thu, 06 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/isci/ZhangLCCZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/kbs/JiangLLZ22, author = {Bo Jiang and Yao Lu and Guangming Lu and David Zhang}, title = {Real noise image adjustment networks for saliency-aware stylistic color retouch}, journal = {Knowl. Based Syst.}, volume = {242}, pages = {108317}, year = {2022}, url = {https://doi.org/10.1016/j.knosys.2022.108317}, doi = {10.1016/J.KNOSYS.2022.108317}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/kbs/JiangLLZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/kbs/LiangLFLJZ22, author = {Xu Liang and Zhaoqun Li and Dandan Fan and Jinxing Li and Wei Jia and David Zhang}, title = {Touchless palmprint recognition based on 3D Gabor template and block feature refinement}, journal = {Knowl. Based Syst.}, volume = {249}, pages = {108855}, year = {2022}, url = {https://doi.org/10.1016/j.knosys.2022.108855}, doi = {10.1016/J.KNOSYS.2022.108855}, timestamp = {Tue, 28 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/kbs/LiangLFLJZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nn/TianYZLZZ22, author = {Chunwei Tian and Yixuan Yuan and Shichao Zhang and Chia{-}Wen Lin and Wangmeng Zuo and David Zhang}, title = {Image super-resolution with an enhanced group convolutional neural network}, journal = {Neural Networks}, volume = {153}, pages = {373--385}, year = {2022}, url = {https://doi.org/10.1016/j.neunet.2022.06.009}, doi = {10.1016/J.NEUNET.2022.06.009}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nn/TianYZLZZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pami/LiXMBZ22, author = {Haifeng Li and Cong Xu and Lin Ma and Hongjian Bo and David Zhang}, title = {{MODENN:} {A} Shallow Broad Neural Network Model Based on Multi-Order Descartes Expansion}, journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.}, volume = {44}, number = {12}, pages = {9417--9433}, year = {2022}, url = {https://doi.org/10.1109/TPAMI.2021.3125690}, doi = {10.1109/TPAMI.2021.3125690}, timestamp = {Mon, 05 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pami/LiXMBZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/speech/JiangHWLZL22, author = {Bo Jiang and Mixiao Hou and Jiahuan Wang and Yao Lu and David Zhang and Guangming Lu}, title = {Recursive Feature Diversity Network for audio super-resolution}, journal = {Speech Commun.}, volume = {144}, pages = {57--66}, year = {2022}, url = {https://doi.org/10.1016/j.specom.2022.08.005}, doi = {10.1016/J.SPECOM.2022.08.005}, timestamp = {Mon, 26 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/speech/JiangHWLZL22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/taslp/HouZCZL22, author = {Mixiao Hou and Zheng Zhang and Qi Cao and David Zhang and Guangming Lu}, title = {Multi-View Speech Emotion Recognition Via Collective Relation Construction}, journal = {{IEEE} {ACM} Trans. Audio Speech Lang. Process.}, volume = {30}, pages = {218--229}, year = {2022}, url = {https://doi.org/10.1109/TASLP.2021.3133196}, doi = {10.1109/TASLP.2021.3133196}, timestamp = {Tue, 08 Feb 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/taslp/HouZCZL22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/taslp/YaoPCLZ22, author = {Zengwei Yao and Wenjie Pei and Fanglin Chen and Guangming Lu and David Zhang}, title = {Stepwise-Refining Speech Separation Network via Fine-Grained Encoding in High-Order Latent Domain}, journal = {{IEEE} {ACM} Trans. Audio Speech Lang. Process.}, volume = {30}, pages = {378--393}, year = {2022}, url = {https://doi.org/10.1109/TASLP.2022.3140556}, doi = {10.1109/TASLP.2022.3140556}, timestamp = {Tue, 08 Feb 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/taslp/YaoPCLZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/ChenZLLZ22, author = {Bingzhi Chen and Zheng Zhang and Ying{-}Jian Li and Guangming Lu and David Zhang}, title = {Multi-Label Chest X-Ray Image Classification via Semantic Similarity Graph Embedding}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {32}, number = {4}, pages = {2455--2468}, year = {2022}, url = {https://doi.org/10.1109/TCSVT.2021.3079900}, doi = {10.1109/TCSVT.2021.3079900}, timestamp = {Wed, 27 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcsv/ChenZLLZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/LiLCZLLZ22, author = {Yingjian Li and Yao Lu and Bingzhi Chen and Zheng Zhang and Jinxing Li and Guangming Lu and David Zhang}, title = {Learning Informative and Discriminative Features for Facial Expression Recognition in the Wild}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {32}, number = {5}, pages = {3178--3189}, year = {2022}, url = {https://doi.org/10.1109/TCSVT.2021.3103760}, doi = {10.1109/TCSVT.2021.3103760}, timestamp = {Wed, 18 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcsv/LiLCZLLZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/LiGCZLZ22, author = {Yingjian Li and Yingnan Gao and Bingzhi Chen and Zheng Zhang and Guangming Lu and David Zhang}, title = {Self-Supervised Exclusive-Inclusive Interactive Learning for Multi-Label Facial Expression Recognition in the Wild}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {32}, number = {5}, pages = {3190--3202}, year = {2022}, url = {https://doi.org/10.1109/TCSVT.2021.3103782}, doi = {10.1109/TCSVT.2021.3103782}, timestamp = {Wed, 18 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcsv/LiGCZLZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/JiangLWLZ22, author = {Bo Jiang and Yao Lu and Jiahuan Wang and Guangming Lu and David Zhang}, title = {Deep Image Denoising With Adaptive Priors}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {32}, number = {8}, pages = {5124--5136}, year = {2022}, url = {https://doi.org/10.1109/TCSVT.2022.3149518}, doi = {10.1109/TCSVT.2022.3149518}, timestamp = {Thu, 25 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcsv/JiangLWLZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/FengPLCZL22, author = {Xin Feng and Wenjie Pei and Fengjun Li and Fanglin Chen and David Zhang and Guangming Lu}, title = {Generative Memory-Guided Semantic Reasoning Model for Image Inpainting}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {32}, number = {11}, pages = {7432--7447}, year = {2022}, url = {https://doi.org/10.1109/TCSVT.2022.3188169}, doi = {10.1109/TCSVT.2022.3188169}, timestamp = {Sun, 13 Nov 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcsv/FengPLCZL22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcyb/LuLLXZZ22, author = {Yao Lu and Guangming Lu and Jinxing Li and Yuanrong Xu and Zheng Zhang and David Zhang}, title = {Multiscale Conditional Regularization for Convolutional Neural Networks}, journal = {{IEEE} Trans. Cybern.}, volume = {52}, number = {1}, pages = {444--458}, year = {2022}, url = {https://doi.org/10.1109/TCYB.2020.2979968}, doi = {10.1109/TCYB.2020.2979968}, timestamp = {Wed, 16 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcyb/LuLLXZZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcyb/LuZLZLZ22, author = {Yao Lu and Zheng Zhang and Guangming Lu and Yicong Zhou and Jinxing Li and David Zhang}, title = {Addi-Reg: {A} Better Generalization-Optimization Tradeoff Regularization Method for Convolutional Neural Networks}, journal = {{IEEE} Trans. Cybern.}, volume = {52}, number = {10}, pages = {10827--10842}, year = {2022}, url = {https://doi.org/10.1109/TCYB.2021.3062881}, doi = {10.1109/TCYB.2021.3062881}, timestamp = {Tue, 18 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcyb/LuZLZLZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tifs/XuLCLZ22, author = {Yuanrong Xu and Yao Lu and Fanglin Chen and Guangming Lu and David Zhang}, title = {High Resolution Fingerprint Retrieval Based on Pore Indexing and Graph Comparison}, journal = {{IEEE} Trans. Inf. Forensics Secur.}, volume = {17}, pages = {226--236}, year = {2022}, url = {https://doi.org/10.1109/TIFS.2021.3139219}, doi = {10.1109/TIFS.2021.3139219}, timestamp = {Fri, 21 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tifs/XuLCLZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/JiangWLLZ22, author = {Bo Jiang and Jiahuan Wang and Yao Lu and Guangming Lu and David Zhang}, title = {Multilevel Noise Contrastive Network for Few-Shot Image Denoising}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {71}, pages = {1--13}, year = {2022}, url = {https://doi.org/10.1109/TIM.2022.3189739}, doi = {10.1109/TIM.2022.3189739}, timestamp = {Sat, 10 Sep 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tim/JiangWLLZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/LinCXZLZ22, author = {Ailiang Lin and Bingzhi Chen and Jiayu Xu and Zheng Zhang and Guangming Lu and David Zhang}, title = {DS-TransUNet: Dual Swin Transformer U-Net for Medical Image Segmentation}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {71}, pages = {1--15}, year = {2022}, url = {https://doi.org/10.1109/TIM.2022.3178991}, doi = {10.1109/TIM.2022.3178991}, timestamp = {Tue, 28 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tim/LinCXZLZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/PangX0L022, author = {Qianting Pang and Yuanrong Xu and Fanglin Chen and Guangming Lu and David Zhang}, title = {Hierarchical Pore-Based High-Resolution Fingerprint Indexing}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {71}, pages = {1--13}, year = {2022}, url = {https://doi.org/10.1109/TIM.2022.3146944}, doi = {10.1109/TIM.2022.3146944}, timestamp = {Tue, 15 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tim/PangX0L022.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/CaiQZLYWZ22, author = {Qing Cai and Yiming Qian and Sanping Zhou and Jinxing Li and Yee{-}Hong Yang and Feng Wu and David Zhang}, title = {{AVLSM:} Adaptive Variational Level Set Model for Image Segmentation in the Presence of Severe Intensity Inhomogeneity and High Noise}, journal = {{IEEE} Trans. Image Process.}, volume = {31}, pages = {43--57}, year = {2022}, url = {https://doi.org/10.1109/TIP.2021.3127848}, doi = {10.1109/TIP.2021.3127848}, timestamp = {Wed, 15 Dec 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tip/CaiQZLYWZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/CaiLLYWZ22, author = {Qing Cai and Jinxing Li and Huafeng Li and Yee{-}Hong Yang and Feng Wu and David Zhang}, title = {{TDPN:} Texture and Detail-Preserving Network for Single Image Super-Resolution}, journal = {{IEEE} Trans. Image Process.}, volume = {31}, pages = {2375--2389}, year = {2022}, url = {https://doi.org/10.1109/TIP.2022.3154614}, doi = {10.1109/TIP.2022.3154614}, timestamp = {Fri, 01 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/CaiLLYWZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/QinFZWXZ22, author = {Jianyang Qin and Lunke Fei and Zheng Zhang and Jie Wen and Yong Xu and David Zhang}, title = {Joint Specifics and Consistency Hash Learning for Large-Scale Cross-Modal Retrieval}, journal = {{IEEE} Trans. Image Process.}, volume = {31}, pages = {5343--5358}, year = {2022}, url = {https://doi.org/10.1109/TIP.2022.3195059}, doi = {10.1109/TIP.2022.3195059}, timestamp = {Thu, 25 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/QinFZWXZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/LiLGWZ22, author = {Mu Li and Jinxing Li and Shuhang Gu and Feng Wu and David Zhang}, title = {End-to-End Optimized 360{\textdegree} Image Compression}, journal = {{IEEE} Trans. Image Process.}, volume = {31}, pages = {6267--6281}, year = {2022}, url = {https://doi.org/10.1109/TIP.2022.3208429}, doi = {10.1109/TIP.2022.3208429}, timestamp = {Sun, 13 Nov 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tip/LiLGWZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/titb/GuoJZ22, author = {Chaoxun Guo and Zhixing Jiang and David Zhang}, title = {Multi-Feature Complementary Learning for Diabetes Mellitus Detection Using Pulse Signals}, journal = {{IEEE} J. Biomed. Health Informatics}, volume = {26}, number = {11}, pages = {5684--5694}, year = {2022}, url = {https://doi.org/10.1109/JBHI.2022.3198792}, doi = {10.1109/JBHI.2022.3198792}, timestamp = {Mon, 05 Dec 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/titb/GuoJZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tmm/WuXZYZ22, author = {Shuai Wu and Yong Xu and Bob Zhang and Jian Yang and David Zhang}, title = {Deformable Template Network {(DTN)} for Object Detection}, journal = {{IEEE} Trans. Multim.}, volume = {24}, pages = {2058--2068}, year = {2022}, url = {https://doi.org/10.1109/TMM.2021.3075323}, doi = {10.1109/TMM.2021.3075323}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tmm/WuXZYZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/FeiZXTRZ22, author = {Lunke Fei and Bob Zhang and Yong Xu and Chunwei Tian and Imad Rida and David Zhang}, title = {Jointly Heterogeneous Palmprint Discriminant Feature Learning}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {33}, number = {9}, pages = {4979--4990}, year = {2022}, url = {https://doi.org/10.1109/TNNLS.2021.3066381}, doi = {10.1109/TNNLS.2021.3066381}, timestamp = {Mon, 28 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tnn/FeiZXTRZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/TianXZLZ22, author = {Chunwei Tian and Yong Xu and Wangmeng Zuo and Chia{-}Wen Lin and David Zhang}, title = {Asymmetric {CNN} for Image Superresolution}, journal = {{IEEE} Trans. Syst. Man Cybern. Syst.}, volume = {52}, number = {6}, pages = {3718--3730}, year = {2022}, url = {https://doi.org/10.1109/TSMC.2021.3069265}, doi = {10.1109/TSMC.2021.3069265}, timestamp = {Mon, 13 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/TianXZLZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/ChenZLCLZ22, author = {Bingzhi Chen and Zheng Zhang and Yao Lu and Fanglin Chen and Guangming Lu and David Zhang}, title = {Semantic-Interactive Graph Convolutional Network for Multilabel Image Recognition}, journal = {{IEEE} Trans. Syst. Man Cybern. Syst.}, volume = {52}, number = {8}, pages = {4887--4899}, year = {2022}, url = {https://doi.org/10.1109/TSMC.2021.3103842}, doi = {10.1109/TSMC.2021.3103842}, timestamp = {Mon, 08 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/ChenZLCLZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/LiangLFZLZ22, author = {Xu Liang and Zhaoqun Li and Dandan Fan and Bob Zhang and Guangming Lu and David Zhang}, title = {Innovative Contactless Palmprint Recognition System Based on Dual-Camera Alignment}, journal = {{IEEE} Trans. Syst. Man Cybern. Syst.}, volume = {52}, number = {10}, pages = {6464--6476}, year = {2022}, url = {https://doi.org/10.1109/TSMC.2022.3146777}, doi = {10.1109/TSMC.2022.3146777}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/LiangLFZLZ22.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/LinLMLLXL022, author = {Xinyu Lin and Jinxing Li and Zeyu Ma and Huafeng Li and Shuang Li and Kaixiong Xu and Guangming Lu and David Zhang}, title = {Learning Modal-Invariant and Temporal-Memory for Video-based Visible-Infrared Person Re-Identification}, booktitle = {{IEEE/CVF} Conference on Computer Vision and Pattern Recognition, {CVPR} 2022, New Orleans, LA, USA, June 18-24, 2022}, pages = {20941--20950}, publisher = {{IEEE}}, year = {2022}, url = {https://doi.org/10.1109/CVPR52688.2022.02030}, doi = {10.1109/CVPR52688.2022.02030}, timestamp = {Wed, 05 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cvpr/LinLMLLXL022.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2203-10247, author = {Qing Cai and Yiming Qian and Jinxing Li and Jun Lv and Yee{-}Hong Yang and Feng Wu and David Zhang}, title = {{HIPA:} Hierarchical Patch Transformer for Single Image Super Resolution}, journal = {CoRR}, volume = {abs/2203.10247}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2203.10247}, doi = {10.48550/ARXIV.2203.10247}, eprinttype = {arXiv}, eprint = {2203.10247}, timestamp = {Wed, 14 Jun 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2203-10247.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2205-14548, author = {Chunwei Tian and Yixuan Yuan and Shichao Zhang and Chia{-}Wen Lin and Wangmeng Zuo and David Zhang}, title = {Image Super-resolution with An Enhanced Group Convolutional Neural Network}, journal = {CoRR}, volume = {abs/2205.14548}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2205.14548}, doi = {10.48550/ARXIV.2205.14548}, eprinttype = {arXiv}, eprint = {2205.14548}, timestamp = {Wed, 01 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2205-14548.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2207-08808, author = {Xin Feng and Haobo Ji and Wenjie Pei and Fanglin Chen and David Zhang and Guangming Lu}, title = {Global-Local Stepwise Generative Network for Ultra High-Resolution Image Restoration}, journal = {CoRR}, volume = {abs/2207.08808}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2207.08808}, doi = {10.48550/ARXIV.2207.08808}, eprinttype = {arXiv}, eprint = {2207.08808}, timestamp = {Mon, 25 Jul 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2207-08808.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2208-02450, author = {Xinyu Lin and Jinxing Li and Zeyu Ma and Huafeng Li and Shuang Li and Kaixiong Xu and Guangming Lu and David Zhang}, title = {Learning Modal-Invariant and Temporal-Memory for Video-based Visible-Infrared Person Re-Identification}, journal = {CoRR}, volume = {abs/2208.02450}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2208.02450}, doi = {10.48550/ARXIV.2208.02450}, eprinttype = {arXiv}, eprint = {2208.02450}, timestamp = {Tue, 09 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2208-02450.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2209-12394, author = {Chunwei Tian and Menghua Zheng and Wangmeng Zuo and Bob Zhang and Yanning Zhang and David Zhang}, title = {Multi-stage image denoising with the wavelet transform}, journal = {CoRR}, volume = {abs/2209.12394}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2209.12394}, doi = {10.48550/ARXIV.2209.12394}, eprinttype = {arXiv}, eprint = {2209.12394}, timestamp = {Mon, 14 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2209-12394.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2209-12406, author = {Chunwei Tian and Yanning Zhang and Wangmeng Zuo and Chia{-}Wen Lin and David Zhang and Yixuan Yuan}, title = {A heterogeneous group {CNN} for image super-resolution}, journal = {CoRR}, volume = {abs/2209.12406}, year = {2022}, url = {https://doi.org/10.48550/arXiv.2209.12406}, doi = {10.48550/ARXIV.2209.12406}, eprinttype = {arXiv}, eprint = {2209.12406}, timestamp = {Thu, 06 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2209-12406.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/LuLZLXZ21, author = {Yao Lu and Guangming Lu and Yicong Zhou and Jinxing Li and Yuanrong Xu and David Zhang}, title = {Highly shared Convolutional Neural Networks}, journal = {Expert Syst. Appl.}, volume = {175}, pages = {114782}, year = {2021}, url = {https://doi.org/10.1016/j.eswa.2021.114782}, doi = {10.1016/J.ESWA.2021.114782}, timestamp = {Fri, 25 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/eswa/LuLZLXZ21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/inffus/LiLLXZZ21, author = {Jinxing Li and Zhaoqun Li and Guangming Lu and Yong Xu and Bob Zhang and David Zhang}, title = {Asymmetric Gaussian Process multi-view learning for visual classification}, journal = {Inf. Fusion}, volume = {65}, pages = {108--118}, year = {2021}, url = {https://doi.org/10.1016/j.inffus.2020.08.020}, doi = {10.1016/J.INFFUS.2020.08.020}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/inffus/LiLLXZZ21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/kbs/TianXZDLZ21, author = {Chunwei Tian and Yong Xu and Wangmeng Zuo and Bo Du and Chia{-}Wen Lin and David Zhang}, title = {Designing and training of a dual {CNN} for image denoising}, journal = {Knowl. Based Syst.}, volume = {226}, pages = {106949}, year = {2021}, url = {https://doi.org/10.1016/j.knosys.2021.106949}, doi = {10.1016/J.KNOSYS.2021.106949}, timestamp = {Tue, 11 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/kbs/TianXZDLZ21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pami/RenZZZY21, author = {Dongwei Ren and Wangmeng Zuo and David Zhang and Lei Zhang and Ming{-}Hsuan Yang}, title = {Simultaneous Fidelity and Regularization Learning for Image Restoration}, journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.}, volume = {43}, number = {1}, pages = {284--299}, year = {2021}, url = {https://doi.org/10.1109/TPAMI.2019.2926357}, doi = {10.1109/TPAMI.2019.2926357}, timestamp = {Thu, 04 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pami/RenZZZY21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pami/0005ZGY021, author = {Mu Li and Wangmeng Zuo and Shuhang Gu and Jane You and David Zhang}, title = {Learning Content-Weighted Deep Image Compression}, journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.}, volume = {43}, number = {10}, pages = {3446--3461}, year = {2021}, url = {https://doi.org/10.1109/TPAMI.2020.2983926}, doi = {10.1109/TPAMI.2020.2983926}, timestamp = {Wed, 16 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pami/0005ZGY021.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/FeiZWTLZ21, author = {Lunke Fei and Bob Zhang and Jie Wen and Shaohua Teng and Shuyi Li and David Zhang}, title = {Jointly learning compact multi-view hash codes for few-shot {FKP} recognition}, journal = {Pattern Recognit.}, volume = {115}, pages = {107894}, year = {2021}, url = {https://doi.org/10.1016/j.patcog.2021.107894}, doi = {10.1016/J.PATCOG.2021.107894}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/FeiZWTLZ21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/spl/LiangYLZ21, author = {Xu Liang and Jinyang Yang and Guangming Lu and David Zhang}, title = {CompNet: Competitive Neural Network for Palmprint Recognition Using Learnable Gabor Kernels}, journal = {{IEEE} Signal Process. Lett.}, volume = {28}, pages = {1739--1743}, year = {2021}, url = {https://doi.org/10.1109/LSP.2021.3103475}, doi = {10.1109/LSP.2021.3103475}, timestamp = {Tue, 05 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/spl/LiangYLZ21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/taslp/ChenCHZLZ21, author = {Bingzhi Chen and Qi Cao and Mixiao Hou and Zheng Zhang and Guangming Lu and David Zhang}, title = {Multimodal Emotion Recognition With Temporal and Semantic Consistency}, journal = {{IEEE} {ACM} Trans. Audio Speech Lang. Process.}, volume = {29}, pages = {3592--3603}, year = {2021}, url = {https://doi.org/10.1109/TASLP.2021.3129331}, doi = {10.1109/TASLP.2021.3129331}, timestamp = {Sat, 09 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/taslp/ChenCHZLZ21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/WuZ0021, author = {Jian Wu and Bob Zhang and Yong Xu and David Zhang}, title = {Illuminance Compensation and Texture Enhancement via the Hodge Decomposition}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {31}, number = {3}, pages = {956--971}, year = {2021}, url = {https://doi.org/10.1109/TCSVT.2020.2997856}, doi = {10.1109/TCSVT.2020.2997856}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcsv/WuZ0021.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/ZhangLZ21, author = {Lei Zhang and Fangyi Liu and David Zhang}, title = {Adversarial View Confusion Feature Learning for Person Re-Identification}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {31}, number = {4}, pages = {1490--1502}, year = {2021}, url = {https://doi.org/10.1109/TCSVT.2020.3002956}, doi = {10.1109/TCSVT.2020.3002956}, timestamp = {Thu, 29 Apr 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcsv/ZhangLZ21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcyb/LiLZYZ21, author = {Jinxing Li and Guangming Lu and Bob Zhang and Jane You and David Zhang}, title = {Shared Linear Encoder-Based Multikernel Gaussian Process Latent Variable Model for Visual Classification}, journal = {{IEEE} Trans. Cybern.}, volume = {51}, number = {2}, pages = {534--547}, year = {2021}, url = {https://doi.org/10.1109/TCYB.2019.2915789}, doi = {10.1109/TCYB.2019.2915789}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcyb/LiLZYZ21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcyb/XuYSZMZZ21, author = {Jun Xu and Mengyang Yu and Ling Shao and Wangmeng Zuo and Deyu Meng and Lei Zhang and David Zhang}, title = {Scaled Simplex Representation for Subspace Clustering}, journal = {{IEEE} Trans. Cybern.}, volume = {51}, number = {3}, pages = {1493--1505}, year = {2021}, url = {https://doi.org/10.1109/TCYB.2019.2943691}, doi = {10.1109/TCYB.2019.2943691}, timestamp = {Tue, 01 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcyb/XuYSZMZZ21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcyb/ZhangDZJW21, author = {Lei Zhang and Qingyan Duan and David Zhang and Wei Jia and Xizhao Wang}, title = {AdvKin: Adversarial Convolutional Network for Kinship Verification}, journal = {{IEEE} Trans. Cybern.}, volume = {51}, number = {12}, pages = {5883--5896}, year = {2021}, url = {https://doi.org/10.1109/TCYB.2019.2959403}, doi = {10.1109/TCYB.2019.2959403}, timestamp = {Wed, 16 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcyb/ZhangDZJW21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/LiFYGLXZ21, author = {Jinxing Li and Dandan Fan and Lingxiao Yang and Shuhang Gu and Guangming Lu and Yong Xu and David Zhang}, title = {Layer-Output Guided Complementary Attention Learning for Image Defocus Blur Detection}, journal = {{IEEE} Trans. Image Process.}, volume = {30}, pages = {3748--3763}, year = {2021}, url = {https://doi.org/10.1109/TIP.2021.3065171}, doi = {10.1109/TIP.2021.3065171}, timestamp = {Wed, 07 Apr 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/LiFYGLXZ21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/FengPJCZL21, author = {Xin Feng and Wenjie Pei and Zihui Jia and Fanglin Chen and David Zhang and Guangming Lu}, title = {Deep-Masking Generative Network: {A} Unified Framework for Background Restoration From Superimposed Images}, journal = {{IEEE} Trans. Image Process.}, volume = {30}, pages = {4867--4882}, year = {2021}, url = {https://doi.org/10.1109/TIP.2021.3076589}, doi = {10.1109/TIP.2021.3076589}, timestamp = {Tue, 16 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/FengPJCZL21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/LiZLXWZ21, author = {Jinxing Li and Bob Zhang and Guangming Lu and Yong Xu and Feng Wu and David Zhang}, title = {Harmonization Shared Autoencoder Gaussian Process Latent Variable Model With Relaxed Hamming Distance}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {32}, number = {11}, pages = {5093--5107}, year = {2021}, url = {https://doi.org/10.1109/TNNLS.2020.3026876}, doi = {10.1109/TNNLS.2020.3026876}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tnn/LiZLXWZ21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/LiangZLGL21, author = {Xu Liang and David Zhang and Guangming Lu and Zhenhua Guo and Nan Luo}, title = {A Novel Multicamera System for High-Speed Touchless Palm Recognition}, journal = {{IEEE} Trans. Syst. Man Cybern. Syst.}, volume = {51}, number = {3}, pages = {1534--1548}, year = {2021}, url = {https://doi.org/10.1109/TSMC.2019.2898684}, doi = {10.1109/TSMC.2019.2898684}, timestamp = {Wed, 07 Apr 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/LiangZLGL21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/XuLLLZ21, author = {Yuanrong Xu and Yao Lu and Guangming Lu and Jinxing Li and David Zhang}, title = {Fast Pore Comparison for High Resolution Fingerprint Images Based on Multiple Co-Occurrence Descriptors and Local Topology Similarities}, journal = {{IEEE} Trans. Syst. Man Cybern. Syst.}, volume = {51}, number = {9}, pages = {5721--5731}, year = {2021}, url = {https://doi.org/10.1109/TSMC.2019.2957411}, doi = {10.1109/TSMC.2019.2957411}, timestamp = {Tue, 05 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/XuLLLZ21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acpr/LiangLFYLZ21, author = {Xu Liang and Zhaoqun Li and Dandan Fan and Jinyang Yang and Guangming Lu and David Zhang}, editor = {Christian Wallraven and Qingshan Liu and Hajime Nagahara}, title = {SaME: Sharpness-aware Matching Ensemble for Robust Palmprint Recognition}, booktitle = {Pattern Recognition - 6th Asian Conference, {ACPR} 2021, Jeju Island, South Korea, November 9-12, 2021, Revised Selected Papers, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {13188}, pages = {488--500}, publisher = {Springer}, year = {2021}, url = {https://doi.org/10.1007/978-3-031-02375-0\_36}, doi = {10.1007/978-3-031-02375-0\_36}, timestamp = {Fri, 13 May 2022 16:17:44 +0200}, biburl = {https://dblp.org/rec/conf/acpr/LiangLFYLZ21.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iconip/LiLFL021, author = {Zhaoqun Li and Xu Liang and Dandan Fan and Jinxing Li and David Zhang}, editor = {Teddy Mantoro and Minho Lee and Media Anugerah Ayu and Kok Wai Wong and Achmad Nizar Hidayanto}, title = {BPFNet: {A} Unified Framework for Bimodal Palmprint Alignment and Fusion}, booktitle = {Neural Information Processing - 28th International Conference, {ICONIP} 2021, Sanur, Bali, Indonesia, December 8-12, 2021, Proceedings, Part {VI}}, series = {Communications in Computer and Information Science}, volume = {1517}, pages = {28--36}, publisher = {Springer}, year = {2021}, url = {https://doi.org/10.1007/978-3-030-92310-5\_4}, doi = {10.1007/978-3-030-92310-5\_4}, timestamp = {Thu, 23 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iconip/LiLFL021.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2103-02167, author = {Zhaoqun Li and Xu Liang and Dandan Fan and Jinxing Li and Wei Jia and David Zhang}, title = {Touchless Palmprint Recognition based on 3D Gabor Template and Block Feature Refinement}, journal = {CoRR}, volume = {abs/2103.02167}, year = {2021}, url = {https://arxiv.org/abs/2103.02167}, eprinttype = {arXiv}, eprint = {2103.02167}, timestamp = {Thu, 06 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2103-02167.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2103-13634, author = {Chunwei Tian and Yong Xu and Wangmeng Zuo and Chia{-}Wen Lin and David Zhang}, title = {Asymmetric {CNN} for image super-resolution}, journal = {CoRR}, volume = {abs/2103.13634}, year = {2021}, url = {https://arxiv.org/abs/2103.13634}, eprinttype = {arXiv}, eprint = {2103.13634}, timestamp = {Tue, 22 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2103-13634.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2106-13929, author = {Huafeng Li and Kaixiong Xu and Jinxing Li and Guangming Lu and Yong Xu and Zhengtao Yu and David Zhang}, title = {Dual-Stream Reciprocal Disentanglement Learning for Domain Adaption Person Re-Identification}, journal = {CoRR}, volume = {abs/2106.13929}, year = {2021}, url = {https://arxiv.org/abs/2106.13929}, eprinttype = {arXiv}, eprint = {2106.13929}, timestamp = {Wed, 30 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2106-13929.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2107-05274, author = {Bingzhi Chen and Yishu Liu and Zheng Zhang and Guangming Lu and David Zhang}, title = {TransAttUnet: Multi-level Attention-guided U-Net with Transformer for Medical Image Segmentation}, journal = {CoRR}, volume = {abs/2107.05274}, year = {2021}, url = {https://arxiv.org/abs/2107.05274}, eprinttype = {arXiv}, eprint = {2107.05274}, timestamp = {Tue, 10 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2107-05274.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2110-00261, author = {Xin Feng and Wenjie Pei and Fengjun Li and Fanglin Chen and David Zhang and Guangming Lu}, title = {Generative Memory-Guided Semantic Reasoning Model for Image Inpainting}, journal = {CoRR}, volume = {abs/2110.00261}, year = {2021}, url = {https://arxiv.org/abs/2110.00261}, eprinttype = {arXiv}, eprint = {2110.00261}, timestamp = {Fri, 08 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2110-00261.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2110-01179, author = {Zhaoqun Li and Xu Liang and Dandan Fan and Jinxing Li and David Zhang}, title = {BPFNet: {A} Unified Framework for Bimodal Palmprint Alignment and Fusion}, journal = {CoRR}, volume = {abs/2110.01179}, year = {2021}, url = {https://arxiv.org/abs/2110.01179}, eprinttype = {arXiv}, eprint = {2110.01179}, timestamp = {Fri, 08 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2110-01179.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2110-04791, author = {Zengwei Yao and Wenjie Pei and Fanglin Chen and Guangming Lu and David Zhang}, title = {Stepwise-Refining Speech Separation Network via Fine-Grained Encoding in High-order Latent Domain}, journal = {CoRR}, volume = {abs/2110.04791}, year = {2021}, url = {https://arxiv.org/abs/2110.04791}, eprinttype = {arXiv}, eprint = {2110.04791}, timestamp = {Mon, 25 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2110-04791.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2110-08080, author = {Chun{-}Mei Feng and Huazhu Fu and Tianfei Zhou and Yong Xu and Ling Shao and David Zhang}, title = {Multi-modal Aggregation Network for Fast {MR} Imaging}, journal = {CoRR}, volume = {abs/2110.08080}, year = {2021}, url = {https://arxiv.org/abs/2110.08080}, eprinttype = {arXiv}, eprint = {2110.08080}, timestamp = {Tue, 26 Jul 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2110-08080.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2111-08974, author = {Zebin Lin and Wenjie Pei and Fanglin Chen and David Zhang and Guangming Lu}, title = {Pedestrian Detection by Exemplar-Guided Contrastive Learning}, journal = {CoRR}, volume = {abs/2111.08974}, year = {2021}, url = {https://arxiv.org/abs/2111.08974}, eprinttype = {arXiv}, eprint = {2111.08974}, timestamp = {Mon, 22 Nov 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2111-08974.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2112-13227, author = {Mu Li and Kede Ma and Jinxing Li and David Zhang}, title = {Pseudocylindrical Convolutions for Learned Omnidirectional Image Compression}, journal = {CoRR}, volume = {abs/2112.13227}, year = {2021}, url = {https://arxiv.org/abs/2112.13227}, eprinttype = {arXiv}, eprint = {2112.13227}, timestamp = {Wed, 05 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2112-13227.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@book{DBLP:books/sp/LiuZZ20, author = {Feng Liu and Qijun Zhao and David Zhang}, title = {Advanced Fingerprint Recognition: From 3D Shape to Ridge Detail, 2}, publisher = {Springer}, year = {2020}, url = {https://doi.org/10.1007/978-981-15-4128-5}, doi = {10.1007/978-981-15-4128-5}, isbn = {978-981-15-4127-8}, timestamp = {Fri, 17 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/books/sp/LiuZZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@book{DBLP:books/sp/ZhangW20, author = {David Zhang and Kebin Wu}, title = {Pathological Voice Analysis}, publisher = {Springer}, year = {2020}, url = {https://doi.org/10.1007/978-981-32-9196-6}, doi = {10.1007/978-981-32-9196-6}, isbn = {978-981-32-9195-9}, timestamp = {Sat, 25 Dec 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/books/sp/ZhangW20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/WuZXZ20, author = {Jian Wu and Bob Zhang and Yong Xu and David Zhang}, title = {Tongue Image Alignment via Conformal Mapping for Disease Detection}, journal = {{IEEE} Access}, volume = {8}, pages = {9796--9808}, year = {2020}, url = {https://doi.org/10.1109/ACCESS.2019.2960578}, doi = {10.1109/ACCESS.2019.2960578}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/access/WuZXZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bspc/JiangGZLZ20, author = {Zhixing Jiang and Chaoxun Guo and Jin Zang and Guangming Lu and David Zhang}, title = {Features fusion of multichannel wrist pulse signal based on {KL-MGDCCA} and decision level combination}, journal = {Biomed. Signal Process. Control.}, volume = {57}, year = {2020}, url = {https://doi.org/10.1016/j.bspc.2019.101751}, doi = {10.1016/J.BSPC.2019.101751}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/bspc/JiangGZLZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/isci/LiLLZYZ20, author = {Jinxing Li and Mu Li and Guangming Lu and Bob Zhang and Hongpeng Yin and David Zhang}, title = {Similarity and diversity induced paired projection for cross-modal retrieval}, journal = {Inf. Sci.}, volume = {539}, pages = {215--228}, year = {2020}, url = {https://doi.org/10.1016/j.ins.2020.06.032}, doi = {10.1016/J.INS.2020.06.032}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/isci/LiLLZYZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nca/LuLLXZ20, author = {Yao Lu and Guangming Lu and Jinxing Li and Yuanrong Xu and David Zhang}, title = {High-parameter-efficiency convolutional neural networks}, journal = {Neural Comput. Appl.}, volume = {32}, number = {14}, pages = {10633--10644}, year = {2020}, url = {https://doi.org/10.1007/s00521-019-04596-w}, doi = {10.1007/S00521-019-04596-W}, timestamp = {Thu, 10 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nca/LuLLXZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nca/BaiMGZZ20, author = {Xuefei Bai and Zhaozong Meng and Nan Gao and Zonghua Zhang and David Zhang}, title = {3D palmprint identification using blocked histogram and improved sparse representation-based classifier}, journal = {Neural Comput. Appl.}, volume = {32}, number = {16}, pages = {12547--12560}, year = {2020}, url = {https://doi.org/10.1007/s00521-020-04711-2}, doi = {10.1007/S00521-020-04711-2}, timestamp = {Thu, 10 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nca/BaiMGZZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/ZhangLYHNZ20, author = {Lei Zhang and Ji Liu and Yang Yang and Fuxiang Huang and Feiping Nie and David Zhang}, title = {Optimal Projection Guided Transfer Hashing for Image Retrieval}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {30}, number = {10}, pages = {3788--3802}, year = {2020}, url = {https://doi.org/10.1109/TCSVT.2019.2943902}, doi = {10.1109/TCSVT.2019.2943902}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcsv/ZhangLYHNZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/FeiZJWZ20, author = {Lunke Fei and Bob Zhang and Wei Jia and Jie Wen and David Zhang}, title = {Feature Extraction for 3-D Palmprint Recognition: {A} Survey}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {69}, number = {3}, pages = {645--656}, year = {2020}, url = {https://doi.org/10.1109/TIM.2020.2964076}, doi = {10.1109/TIM.2020.2964076}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tim/FeiZJWZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/ZhangLZZZ20, author = {Lei Zhang and Ji Liu and Bob Zhang and David Zhang and Ce Zhu}, title = {Deep Cascade Model-Based Face Recognition: When Deep-Layered Learning Meets Small Data}, journal = {{IEEE} Trans. Image Process.}, volume = {29}, pages = {1016--1029}, year = {2020}, url = {https://doi.org/10.1109/TIP.2019.2938307}, doi = {10.1109/TIP.2019.2938307}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/ZhangLZZZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/LiGLZXWZ20, author = {Jinxing Li and Xiaobao Guo and Guangming Lu and Bob Zhang and Yong Xu and Feng Wu and David Zhang}, title = {{DRPL:} Deep Regression Pair Learning for Multi-Focus Image Fusion}, journal = {{IEEE} Trans. Image Process.}, volume = {29}, pages = {4816--4831}, year = {2020}, url = {https://doi.org/10.1109/TIP.2020.2976190}, doi = {10.1109/TIP.2020.2976190}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/LiGLZXWZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/LiMYZZ20, author = {Mu Li and Kede Ma and Jane You and David Zhang and Wangmeng Zuo}, title = {Efficient and Effective Context-Based Convolutional Entropy Modeling for Image Compression}, journal = {{IEEE} Trans. Image Process.}, volume = {29}, pages = {5900--5911}, year = {2020}, url = {https://doi.org/10.1109/TIP.2020.2985225}, doi = {10.1109/TIP.2020.2985225}, timestamp = {Tue, 22 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/LiMYZZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/LiWZZZ20, author = {Feng Li and Xiaohe Wu and Wangmeng Zuo and David Zhang and Lei Zhang}, title = {Remove Cosine Window From Correlation Filter-Based Visual Trackers: When and How}, journal = {{IEEE} Trans. Image Process.}, volume = {29}, pages = {7045--7060}, year = {2020}, url = {https://doi.org/10.1109/TIP.2020.2997521}, doi = {10.1109/TIP.2020.2997521}, timestamp = {Wed, 25 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tip/LiWZZZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/ZhangLHYZ20, author = {Lei Zhang and Ji Liu and Fuxiang Huang and Yang Yang and David Zhang}, title = {Deep-Like Hashing-in-Hash for Visual Retrieval: An Embarrassingly Simple Method}, journal = {{IEEE} Trans. Image Process.}, volume = {29}, pages = {8149--8162}, year = {2020}, url = {https://doi.org/10.1109/TIP.2020.3011796}, doi = {10.1109/TIP.2020.3011796}, timestamp = {Fri, 25 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tip/ZhangLHYZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/titb/ChenLL020, author = {Bingzhi Chen and Jinxing Li and Guangming Lu and David Zhang}, title = {Lesion Location Attention Guided Network for Multi-Label Thoracic Disease Classification in Chest X-Rays}, journal = {{IEEE} J. Biomed. Health Informatics}, volume = {24}, number = {7}, pages = {2016--2027}, year = {2020}, url = {https://doi.org/10.1109/JBHI.2019.2952597}, doi = {10.1109/JBHI.2019.2952597}, timestamp = {Thu, 13 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/titb/ChenLL020.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/titb/ChenLLYZ20, author = {Bingzhi Chen and Jinxing Li and Guangming Lu and Hongbing Yu and David Zhang}, title = {Label Co-Occurrence Learning With Graph Convolutional Networks for Multi-Label Chest X-Ray Image Classification}, journal = {{IEEE} J. Biomed. Health Informatics}, volume = {24}, number = {8}, pages = {2292--2302}, year = {2020}, url = {https://doi.org/10.1109/JBHI.2020.2967084}, doi = {10.1109/JBHI.2020.2967084}, timestamp = {Thu, 04 Mar 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/titb/ChenLLYZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/LuLLLZ20, author = {Yao Lu and Guangming Lu and Rui Lin and Jinxing Li and David Zhang}, title = {SRGC-Nets: Sparse Repeated Group Convolutional Neural Networks}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {31}, number = {8}, pages = {2889--2902}, year = {2020}, url = {https://doi.org/10.1109/TNNLS.2019.2933665}, doi = {10.1109/TNNLS.2019.2933665}, timestamp = {Thu, 04 Mar 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tnn/LuLLLZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/ZhangFWZDC20, author = {Lei Zhang and Jingru Fu and Shanshan Wang and David Zhang and Zhaoyang Dong and C. L. Philip Chen}, title = {Guide Subspace Learning for Unsupervised Domain Adaptation}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {31}, number = {9}, pages = {3374--3388}, year = {2020}, url = {https://doi.org/10.1109/TNNLS.2019.2944455}, doi = {10.1109/TNNLS.2019.2944455}, timestamp = {Tue, 03 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tnn/ZhangFWZDC20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/LiZLYXWZ20, author = {Jinxing Li and Bob Zhang and Guangming Lu and Jane You and Yong Xu and Feng Wu and David Zhang}, title = {Relaxed Asymmetric Deep Hashing Learning: Point-to-Angle Matching}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {31}, number = {11}, pages = {4791--4805}, year = {2020}, url = {https://doi.org/10.1109/TNNLS.2019.2958061}, doi = {10.1109/TNNLS.2019.2958061}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tnn/LiZLYXWZ20.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2005-04661, author = {Mu Li and Kai Zhang and Wangmeng Zuo and Radu Timofte and David Zhang}, title = {Learning Context-Based Non-local Entropy Modeling for Image Compression}, journal = {CoRR}, volume = {abs/2005.04661}, year = {2020}, url = {https://arxiv.org/abs/2005.04661}, eprinttype = {arXiv}, eprint = {2005.04661}, timestamp = {Thu, 04 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2005-04661.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2007-03951, author = {Chunwei Tian and Yong Xu and Wangmeng Zuo and Bo Du and Chia{-}Wen Lin and David Zhang}, title = {Designing and Training of {A} Dual {CNN} for Image Denoising}, journal = {CoRR}, volume = {abs/2007.03951}, year = {2020}, url = {https://arxiv.org/abs/2007.03951}, eprinttype = {arXiv}, eprint = {2007.03951}, timestamp = {Tue, 24 Jan 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-2007-03951.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-2010-04324, author = {Xin Feng and Wenjie Pei and Zihui Jia and David Zhang and Guangming Lu}, title = {Deep-Masking Generative Network: {A} Unified Framework for Background Restoration from Superimposed Images}, journal = {CoRR}, volume = {abs/2010.04324}, year = {2020}, url = {https://arxiv.org/abs/2010.04324}, eprinttype = {arXiv}, eprint = {2010.04324}, timestamp = {Tue, 25 May 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-2010-04324.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/WuCCZZY19, author = {Guangbin Wu and Weishan Chen and Hui Cheng and Wangmeng Zuo and David Zhang and Jane You}, title = {Multi-Object Grasping Detection With Hierarchical Feature Fusion}, journal = {{IEEE} Access}, volume = {7}, pages = {43884--43894}, year = {2019}, url = {https://doi.org/10.1109/ACCESS.2019.2908281}, doi = {10.1109/ACCESS.2019.2908281}, timestamp = {Thu, 17 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/access/WuCCZZY19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/LiZLZ19, author = {Jinxing Li and Bob Zhang and Guangming Lu and David Zhang}, title = {Dual Asymmetric Deep Hashing Learning}, journal = {{IEEE} Access}, volume = {7}, pages = {113372--113384}, year = {2019}, url = {https://doi.org/10.1109/ACCESS.2019.2927524}, doi = {10.1109/ACCESS.2019.2927524}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/access/LiZLZ19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cmpb/JiangZL19, author = {Zhixing Jiang and David Zhang and Guangming Lu}, title = {Radial artery pulse waveform analysis based on curve fitting using discrete Fourier series}, journal = {Comput. Methods Programs Biomed.}, volume = {174}, pages = {25--31}, year = {2019}, url = {https://doi.org/10.1016/j.cmpb.2018.04.019}, doi = {10.1016/J.CMPB.2018.04.019}, timestamp = {Sat, 30 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cmpb/JiangZL19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijprai/WuZCZX19, author = {Guangbin Wu and David Zhang and Weishan Chen and Wangmeng Zuo and Zhuang Xia}, title = {Robust Deep Softmax Regression Against Label Noise for Unsupervised Domain Adaptation}, journal = {Int. J. Pattern Recognit. Artif. Intell.}, volume = {33}, number = {7}, pages = {1940002:1--1940002:30}, year = {2019}, url = {https://doi.org/10.1142/S0218001419400020}, doi = {10.1142/S0218001419400020}, timestamp = {Mon, 11 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijprai/WuZCZX19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/inffus/LiZLZ19, author = {Jinxing Li and Bob Zhang and Guangming Lu and David Zhang}, title = {Generative multi-view and multi-feature learning for classification}, journal = {Inf. Fusion}, volume = {45}, pages = {215--226}, year = {2019}, url = {https://doi.org/10.1016/j.inffus.2018.02.005}, doi = {10.1016/J.INFFUS.2018.02.005}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/inffus/LiZLZ19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/isci/LiZLYZ19, author = {Jinxing Li and Bob Zhang and Guangming Lu and Jane You and David Zhang}, title = {Body surface feature-based multi-modal Learning for Diabetes Mellitus detection}, journal = {Inf. Sci.}, volume = {472}, pages = {1--14}, year = {2019}, url = {https://doi.org/10.1016/j.ins.2018.09.010}, doi = {10.1016/J.INS.2018.09.010}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/isci/LiZLYZ19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/WuZLG19, author = {Kebin Wu and David Zhang and Guangming Lu and Zhenhua Guo}, title = {Joint learning for voice based disease detection}, journal = {Pattern Recognit.}, volume = {87}, pages = {130--139}, year = {2019}, url = {https://doi.org/10.1016/j.patcog.2018.09.013}, doi = {10.1016/J.PATCOG.2018.09.013}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/WuZLG19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/XuAZZ19, author = {Jun Xu and Wangpeng An and Lei Zhang and David Zhang}, title = {Sparse, collaborative, or nonnegative representation: Which helps pattern classification?}, journal = {Pattern Recognit.}, volume = {88}, pages = {679--688}, year = {2019}, url = {https://doi.org/10.1016/j.patcog.2018.12.023}, doi = {10.1016/J.PATCOG.2018.12.023}, timestamp = {Thu, 04 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/XuAZZ19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/XuLL019, author = {Yuanrong Xu and Guangming Lu and Yao Lu and David Zhang}, title = {High resolution fingerprint recognition using pore and edge descriptors}, journal = {Pattern Recognit. Lett.}, volume = {125}, pages = {773--779}, year = {2019}, url = {https://doi.org/10.1016/j.patrec.2019.08.006}, doi = {10.1016/J.PATREC.2019.08.006}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/prl/XuLL019.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/LuYLLZW19, author = {Yuwu Lu and Chun Yuan and Zhihui Lai and Xuelong Li and David Zhang and Wai Keung Wong}, title = {Horizontal and Vertical Nuclear Norm-Based 2DLDA for Image Representation}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {29}, number = {4}, pages = {941--955}, year = {2019}, url = {https://doi.org/10.1109/TCSVT.2018.2822761}, doi = {10.1109/TCSVT.2018.2822761}, timestamp = {Mon, 14 Feb 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcsv/LuYLLZW19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/LuYLLZS19, author = {Yuwu Lu and Chun Yuan and Xuelong Li and Zhihui Lai and David Zhang and Linlin Shen}, title = {Structurally Incoherent Low-Rank 2DLPP for Image Classification}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {29}, number = {6}, pages = {1701--1714}, year = {2019}, url = {https://doi.org/10.1109/TCSVT.2018.2849757}, doi = {10.1109/TCSVT.2018.2849757}, timestamp = {Mon, 14 Feb 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcsv/LuYLLZS19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/XuLLLZ19, author = {Yuanrong Xu and Guangming Lu and Yao Lu and Feng Liu and David Zhang}, title = {Fingerprint Pore Comparison Using Local Features and Spatial Relations}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {29}, number = {10}, pages = {2927--2940}, year = {2019}, url = {https://doi.org/10.1109/TCSVT.2018.2875147}, doi = {10.1109/TCSVT.2018.2875147}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcsv/XuLLLZ19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcyb/LuLLWYZ19, author = {Yuwu Lu and Zhihui Lai and Xuelong Li and Wai Keung Wong and Chun Yuan and David Zhang}, title = {Low-Rank 2-D Neighborhood Preserving Projection for Enhanced Robust Image Representation}, journal = {{IEEE} Trans. Cybern.}, volume = {49}, number = {5}, pages = {1859--1872}, year = {2019}, url = {https://doi.org/10.1109/TCYB.2018.2815559}, doi = {10.1109/TCYB.2018.2815559}, timestamp = {Mon, 14 Feb 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcyb/LuLLWYZ19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcyb/LiZLRZ19, author = {Jinxing Li and Bob Zhang and Guangming Lu and Hu Ren and David Zhang}, title = {Visual Classification With Multikernel Shared Gaussian Process Latent Variable Model}, journal = {{IEEE} Trans. Cybern.}, volume = {49}, number = {8}, pages = {2886--2899}, year = {2019}, url = {https://doi.org/10.1109/TCYB.2018.2831457}, doi = {10.1109/TCYB.2018.2831457}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcyb/LiZLRZ19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/BaiGZZ19, author = {Xuefei Bai and Nan Gao and Zonghua Zhang and David Zhang}, title = {Person Recognition Using 3-D Palmprint Data Based on Full-Field Sinusoidal Fringe Projection}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {68}, number = {9}, pages = {3287--3298}, year = {2019}, url = {https://doi.org/10.1109/TIM.2018.2877226}, doi = {10.1109/TIM.2018.2877226}, timestamp = {Mon, 08 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tim/BaiGZZ19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/JiangZL19, author = {Zhixing Jiang and David Zhang and Guangming Lu}, title = {A Robust Wrist Pulse Acquisition System Based on Multisensor Collaboration and Signal Quality Assessment}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {68}, number = {12}, pages = {4807--4816}, year = {2019}, url = {https://doi.org/10.1109/TIM.2019.2899514}, doi = {10.1109/TIM.2019.2899514}, timestamp = {Mon, 08 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tim/JiangZL19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/ZhangWHZYZ19, author = {Lei Zhang and Shanshan Wang and Guang{-}Bin Huang and Wangmeng Zuo and Jian Yang and David Zhang}, title = {Manifold Criterion Guided Transfer Learning via Intermediate Domain Generation}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {30}, number = {12}, pages = {3759--3773}, year = {2019}, url = {https://doi.org/10.1109/TNNLS.2019.2899037}, doi = {10.1109/TNNLS.2019.2899037}, timestamp = {Tue, 03 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tnn/ZhangWHZYZ19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/FeiLJTZ19, author = {Lunke Fei and Guangming Lu and Wei Jia and Shaohua Teng and David Zhang}, title = {Feature Extraction Methods for Palmprint Recognition: {A} Survey and Evaluation}, journal = {{IEEE} Trans. Syst. Man Cybern. Syst.}, volume = {49}, number = {2}, pages = {346--363}, year = {2019}, url = {https://doi.org/10.1109/TSMC.2018.2795609}, doi = {10.1109/TSMC.2018.2795609}, timestamp = {Wed, 20 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/FeiLJTZ19.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/YangZ019, author = {Lingxiao Yang and David Zhang and Lei Zhang}, title = {Learning a Visual Tracker from a Single Movie without Annotation}, booktitle = {The Thirty-Third {AAAI} Conference on Artificial Intelligence, {AAAI} 2019, The Thirty-First Innovative Applications of Artificial Intelligence Conference, {IAAI} 2019, The Ninth {AAAI} Symposium on Educational Advances in Artificial Intelligence, {EAAI} 2019, Honolulu, Hawaii, USA, January 27 - February 1, 2019}, pages = {9095--9102}, publisher = {{AAAI} Press}, year = {2019}, url = {https://doi.org/10.1609/aaai.v33i01.33019095}, doi = {10.1609/AAAI.V33I01.33019095}, timestamp = {Mon, 04 Sep 2023 12:29:24 +0200}, biburl = {https://dblp.org/rec/conf/aaai/YangZ019.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1903-10211, author = {Lei Zhang and Shanshan Wang and Guang{-}Bin Huang and Wangmeng Zuo and Jian Yang and David Zhang}, title = {Manifold Criterion Guided Transfer Learning via Intermediate Domain Generation}, journal = {CoRR}, volume = {abs/1903.10211}, year = {2019}, url = {http://arxiv.org/abs/1903.10211}, eprinttype = {arXiv}, eprint = {1903.10211}, timestamp = {Tue, 03 May 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1903-10211.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1904-00664, author = {Mu Li and Wangmeng Zuo and Shuhang Gu and Jane You and David Zhang}, title = {Learning Content-Weighted Deep Image Compression}, journal = {CoRR}, volume = {abs/1904.00664}, year = {2019}, url = {http://arxiv.org/abs/1904.00664}, eprinttype = {arXiv}, eprint = {1904.00664}, timestamp = {Tue, 22 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1904-00664.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1905-06648, author = {Feng Li and Xiaohe Wu and Wangmeng Zuo and David Zhang and Lei Zhang}, title = {Remove Cosine Window from Correlation Filter-based Visual Trackers: When and How}, journal = {CoRR}, volume = {abs/1905.06648}, year = {2019}, url = {http://arxiv.org/abs/1905.06648}, eprinttype = {arXiv}, eprint = {1905.06648}, timestamp = {Thu, 04 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1905-06648.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1906-10057, author = {Mu Li and Kede Ma and Jane You and David Zhang and Wangmeng Zuo}, title = {Efficient and Effective Context-Based Convolutional Entropy Modeling for Image Compression}, journal = {CoRR}, volume = {abs/1906.10057}, year = {2019}, url = {http://arxiv.org/abs/1906.10057}, eprinttype = {arXiv}, eprint = {1906.10057}, timestamp = {Tue, 22 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1906-10057.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1912-00271, author = {Shervin Minaee and AmirAli Abdolrashidi and Hang Su and Mohammed Bennamoun and David Zhang}, title = {Biometric Recognition Using Deep Learning: {A} Survey}, journal = {CoRR}, volume = {abs/1912.00271}, year = {2019}, url = {http://arxiv.org/abs/1912.00271}, eprinttype = {arXiv}, eprint = {1912.00271}, timestamp = {Thu, 06 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1912-00271.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@book{DBLP:books/sp/ZhangZW18, author = {David Zhang and Wangmeng Zuo and Peng Wang}, title = {Computational Pulse Signal Analysis}, publisher = {Springer}, year = {2018}, url = {https://doi.org/10.1007/978-981-10-4044-3}, doi = {10.1007/978-981-10-4044-3}, isbn = {978-981-10-4043-6}, timestamp = {Tue, 17 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/books/sp/ZhangZW18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@book{DBLP:books/sp/ZhangTZ18, author = {Lei Zhang and Fengchun Tian and David Zhang}, title = {Electronic Nose: Algorithmic Challenges}, publisher = {Springer}, year = {2018}, url = {https://doi.org/10.1007/978-981-13-2167-2}, doi = {10.1007/978-981-13-2167-2}, isbn = {978-981-13-2166-5}, timestamp = {Wed, 12 Sep 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/books/sp/ZhangTZ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/GouYZZSD18, author = {Jianping Gou and Zhang Yi and David Zhang and Yongzhao Zhan and Xiangjun Shen and Lan Du}, title = {Sparsity and Geometry Preserving Graph Embedding for Dimensionality Reduction}, journal = {{IEEE} Access}, volume = {6}, pages = {75748--75766}, year = {2018}, url = {https://doi.org/10.1109/ACCESS.2018.2884027}, doi = {10.1109/ACCESS.2018.2884027}, timestamp = {Thu, 23 Jun 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/access/GouYZZSD18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/WuZLG18, author = {Kebin Wu and David Zhang and Guangming Lu and Zhenhua Guo}, title = {Learning acoustic features to detect Parkinson's disease}, journal = {Neurocomputing}, volume = {318}, pages = {102--108}, year = {2018}, url = {https://doi.org/10.1016/j.neucom.2018.08.036}, doi = {10.1016/J.NEUCOM.2018.08.036}, timestamp = {Thu, 17 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijon/WuZLG18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/isci/GouXZMDZ18, author = {Jianping Gou and Yong Xu and David Zhang and Qirong Mao and Lan Du and Yongzhao Zhan}, title = {Two-phase linear reconstruction measure-based classification for face recognition}, journal = {Inf. Sci.}, volume = {433-434}, pages = {17--36}, year = {2018}, url = {https://doi.org/10.1016/j.ins.2017.12.025}, doi = {10.1016/J.INS.2017.12.025}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/isci/GouXZMDZ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ZhaoWMWZ0018, author = {Cairong Zhao and Xuekuan Wang and Duoqian Miao and Hanli Wang and Wei{-}Shi Zheng and Yong Xu and David Zhang}, title = {Maximal granularity structure and generalized multi-view discriminant analysis for person re-identification}, journal = {Pattern Recognit.}, volume = {79}, pages = {79--96}, year = {2018}, url = {https://doi.org/10.1016/j.patcog.2018.01.033}, doi = {10.1016/J.PATCOG.2018.01.033}, timestamp = {Thu, 12 Jan 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/ZhaoWMWZ0018.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/taffco/ChenXZ18, author = {Fangmei Chen and Xihua Xiao and David Zhang}, title = {Data-Driven Facial Beauty Analysis: Prediction, Retrieval and Manipulation}, journal = {{IEEE} Trans. Affect. Comput.}, volume = {9}, number = {2}, pages = {205--216}, year = {2018}, url = {https://doi.org/10.1109/TAFFC.2016.2599534}, doi = {10.1109/TAFFC.2016.2599534}, timestamp = {Fri, 24 Apr 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/taffco/ChenXZ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/LuLL0WY18, author = {Yuwu Lu and Zhihui Lai and Xuelong Li and David Zhang and Wai Keung Wong and Chun Yuan}, title = {Learning Parts-Based and Global Representation for Image Classification}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {28}, number = {12}, pages = {3345--3360}, year = {2018}, url = {https://doi.org/10.1109/TCSVT.2017.2749980}, doi = {10.1109/TCSVT.2017.2749980}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcsv/LuLL0WY18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcyb/YanKZ18, author = {Ke Yan and Lu Kou and David Zhang}, title = {Learning Domain-Invariant Subspace Using Domain Features and Independence Maximization}, journal = {{IEEE} Trans. Cybern.}, volume = {48}, number = {1}, pages = {288--299}, year = {2018}, url = {https://doi.org/10.1109/TCYB.2016.2633306}, doi = {10.1109/TCYB.2016.2633306}, timestamp = {Tue, 30 Nov 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcyb/YanKZ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcyb/LaiMWXMZ18, author = {Zhihui Lai and Dongmei Mo and Wai Keung Wong and Yong Xu and Duoqian Miao and David Zhang}, title = {Robust Discriminant Regression for Feature Extraction}, journal = {{IEEE} Trans. Cybern.}, volume = {48}, number = {8}, pages = {2472--2484}, year = {2018}, url = {https://doi.org/10.1109/TCYB.2017.2740949}, doi = {10.1109/TCYB.2017.2740949}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcyb/LaiMWXMZ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/FeiLJWZ18, author = {Lunke Fei and Guangming Lu and Wei Jia and Jie Wen and David Zhang}, title = {Complete Binary Representation for 3-D Palmprint Recognition}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {67}, number = {12}, pages = {2761--2771}, year = {2018}, url = {https://doi.org/10.1109/TIM.2018.2830858}, doi = {10.1109/TIM.2018.2830858}, timestamp = {Sat, 22 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tim/FeiLJWZ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/RenZZXZ18, author = {Dongwei Ren and Wangmeng Zuo and David Zhang and Jun Xu and Lei Zhang}, title = {Partial Deconvolution With Inaccurate Blur Kernel}, journal = {{IEEE} Trans. Image Process.}, volume = {27}, number = {1}, pages = {511--524}, year = {2018}, url = {https://doi.org/10.1109/TIP.2017.2764261}, doi = {10.1109/TIP.2017.2764261}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tip/RenZZXZ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/XuZZ18, author = {Jun Xu and Lei Zhang and David Zhang}, title = {External Prior Guided Internal Prior Learning for Real-World Noisy Image Denoising}, journal = {{IEEE} Trans. Image Process.}, volume = {27}, number = {6}, pages = {2996--3010}, year = {2018}, url = {https://doi.org/10.1109/TIP.2018.2811546}, doi = {10.1109/TIP.2018.2811546}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/XuZZ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/LiZZ18, author = {Jinxing Li and Bob Zhang and David Zhang}, title = {Shared Autoencoder Gaussian Process Latent Variable Model for Visual Classification}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {29}, number = {9}, pages = {4272--4286}, year = {2018}, url = {https://doi.org/10.1109/TNNLS.2017.2761401}, doi = {10.1109/TNNLS.2017.2761401}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tnn/LiZZ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/WuZLJZ18, author = {Xiaohe Wu and Wangmeng Zuo and Liang Lin and Wei Jia and David Zhang}, title = {{F-SVM:} Combination of Feature Transformation and {SVM} Learning via Convex Relaxation}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {29}, number = {11}, pages = {5185--5199}, year = {2018}, url = {https://doi.org/10.1109/TNNLS.2018.2791507}, doi = {10.1109/TNNLS.2018.2791507}, timestamp = {Sat, 30 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tnn/WuZLJZ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/XuFWZ18, author = {Yong Xu and Lunke Fei and Jie Wen and David Zhang}, title = {Discriminative and Robust Competitive Code for Palmprint Recognition}, journal = {{IEEE} Trans. Syst. Man Cybern. Syst.}, volume = {48}, number = {2}, pages = {232--241}, year = {2018}, url = {https://doi.org/10.1109/TSMC.2016.2597291}, doi = {10.1109/TSMC.2016.2597291}, timestamp = {Sat, 05 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/XuFWZ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/ZhangZ18, author = {Lei Zhang and David Zhang}, title = {Efficient Solutions for Discreteness, Drift, and Disturbance {(3D)} in Electronic Olfaction}, journal = {{IEEE} Trans. Syst. Man Cybern. Syst.}, volume = {48}, number = {2}, pages = {242--254}, year = {2018}, url = {https://doi.org/10.1109/TSMC.2016.2597800}, doi = {10.1109/TSMC.2016.2597800}, timestamp = {Wed, 20 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/ZhangZ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/LiYZLZZ18, author = {Jinxing Li and Hongwei Yong and Bob Zhang and Mu Li and Lei Zhang and David Zhang}, editor = {Sheila A. McIlraith and Kilian Q. Weinberger}, title = {A Probabilistic Hierarchical Model for Multi-View and Multi-Feature Classification}, booktitle = {Proceedings of the Thirty-Second {AAAI} Conference on Artificial Intelligence, (AAAI-18), the 30th innovative Applications of Artificial Intelligence (IAAI-18), and the 8th {AAAI} Symposium on Educational Advances in Artificial Intelligence (EAAI-18), New Orleans, Louisiana, USA, February 2-7, 2018}, pages = {3498--3505}, publisher = {{AAAI} Press}, year = {2018}, url = {https://doi.org/10.1609/aaai.v32i1.11611}, doi = {10.1609/AAAI.V32I1.11611}, timestamp = {Mon, 04 Sep 2023 12:29:24 +0200}, biburl = {https://dblp.org/rec/conf/aaai/LiYZLZZ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/LiZGZ018, author = {Mu Li and Wangmeng Zuo and Shuhang Gu and Debin Zhao and David Zhang}, title = {Learning Convolutional Networks for Content-Weighted Image Compression}, booktitle = {2018 {IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR} 2018, Salt Lake City, UT, USA, June 18-22, 2018}, pages = {3214--3223}, publisher = {Computer Vision Foundation / {IEEE} Computer Society}, year = {2018}, url = {http://openaccess.thecvf.com/content\_cvpr\_2018/html/Li\_Learning\_Convolutional\_Networks\_CVPR\_2018\_paper.html}, doi = {10.1109/CVPR.2018.00339}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/LiZGZ018.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/Liang0ZC018, author = {Zhetong Liang and Jun Xu and David Zhang and Zisheng Cao and Lei Zhang}, title = {A Hybrid l1-l0 Layer Decomposition Model for Tone Mapping}, booktitle = {2018 {IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR} 2018, Salt Lake City, UT, USA, June 18-22, 2018}, pages = {4758--4766}, publisher = {Computer Vision Foundation / {IEEE} Computer Society}, year = {2018}, url = {http://openaccess.thecvf.com/content\_cvpr\_2018/html/Liang\_A\_Hybrid\_l1-l0\_CVPR\_2018\_paper.html}, doi = {10.1109/CVPR.2018.00500}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/Liang0ZC018.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eccv/XuZZ18, author = {Jun Xu and Lei Zhang and David Zhang}, editor = {Vittorio Ferrari and Martial Hebert and Cristian Sminchisescu and Yair Weiss}, title = {A Trilateral Weighted Sparse Coding Scheme for Real-World Image Denoising}, booktitle = {Computer Vision - {ECCV} 2018 - 15th European Conference, Munich, Germany, September 8-14, 2018, Proceedings, Part {VIII}}, series = {Lecture Notes in Computer Science}, volume = {11212}, pages = {21--38}, publisher = {Springer}, year = {2018}, url = {https://doi.org/10.1007/978-3-030-01237-3\_2}, doi = {10.1007/978-3-030-01237-3\_2}, timestamp = {Mon, 30 Sep 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/eccv/XuZZ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iscide/YaoWZZ18, author = {Yingjie Yao and Xiaohe Wu and Wangmeng Zuo and David Zhang}, editor = {Yuxin Peng and Kai Yu and Jiwen Lu and Xingpeng Jiang}, title = {Learning Siamese Network with Top-Down Modulation for Visual Tracking}, booktitle = {Intelligence Science and Big Data Engineering - 8th International Conference, IScIDE 2018, Lanzhou, China, August 18-19, 2018, Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {11266}, pages = {378--388}, publisher = {Springer}, year = {2018}, url = {https://doi.org/10.1007/978-3-030-02698-1\_33}, doi = {10.1007/978-3-030-02698-1\_33}, timestamp = {Thu, 17 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iscide/YaoWZZ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mm/LiZLZ18, author = {Jinxing Li and Bob Zhang and Guangming Lu and David Zhang}, editor = {Susanne Boll and Kyoung Mu Lee and Jiebo Luo and Wenwu Zhu and Hyeran Byun and Chang Wen Chen and Rainer Lienhart and Tao Mei}, title = {Shared Linear Encoder-based Gaussian Process Latent Variable Model for Visual Classification}, booktitle = {2018 {ACM} Multimedia Conference on Multimedia Conference, {MM} 2018, Seoul, Republic of Korea, October 22-26, 2018}, pages = {26--34}, publisher = {{ACM}}, year = {2018}, url = {https://doi.org/10.1145/3240508.3240520}, doi = {10.1145/3240508.3240520}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/mm/LiZLZ18.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1801-04662, author = {Mu Li and Shuhang Gu and David Zhang and Wangmeng Zuo}, title = {Efficient Trimmed Convolutional Arithmetic Encoding for Lossless Image Compression}, journal = {CoRR}, volume = {abs/1801.04662}, year = {2018}, url = {http://arxiv.org/abs/1801.04662}, eprinttype = {arXiv}, eprint = {1801.04662}, timestamp = {Tue, 22 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1801-04662.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1801-08360, author = {Jinxing Li and Bob Zhang and Guangming Lu and David Zhang}, title = {Dual Asymmetric Deep Hashing Learning}, journal = {CoRR}, volume = {abs/1801.08360}, year = {2018}, url = {http://arxiv.org/abs/1801.08360}, eprinttype = {arXiv}, eprint = {1801.08360}, timestamp = {Mon, 14 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1801-08360.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1804-02603, author = {Jun Xu and Hui Li and Zhetong Liang and David Zhang and Lei Zhang}, title = {Real-world Noisy Image Denoising: {A} New Benchmark}, journal = {CoRR}, volume = {abs/1804.02603}, year = {2018}, url = {http://arxiv.org/abs/1804.02603}, eprinttype = {arXiv}, eprint = {1804.02603}, timestamp = {Thu, 17 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1804-02603.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1804-04522, author = {Dongwei Ren and Wangmeng Zuo and David Zhang and Lei Zhang and Ming{-}Hsuan Yang}, title = {Simultaneous Fidelity and Regularization Learning for Image Restoration}, journal = {CoRR}, volume = {abs/1804.04522}, year = {2018}, url = {http://arxiv.org/abs/1804.04522}, eprinttype = {arXiv}, eprint = {1804.04522}, timestamp = {Thu, 04 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1804-04522.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1806-04329, author = {Jun Xu and Wangpeng An and Lei Zhang and David Zhang}, title = {Sparse, Collaborative, or Nonnegative Representation: Which Helps Pattern Classification?}, journal = {CoRR}, volume = {abs/1806.04329}, year = {2018}, url = {http://arxiv.org/abs/1806.04329}, eprinttype = {arXiv}, eprint = {1806.04329}, timestamp = {Tue, 19 Feb 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1806-04329.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1807-04364, author = {Jun Xu and Lei Zhang and David Zhang}, title = {A Trilateral Weighted Sparse Coding Scheme for Real-World Image Denoising}, journal = {CoRR}, volume = {abs/1807.04364}, year = {2018}, url = {http://arxiv.org/abs/1807.04364}, eprinttype = {arXiv}, eprint = {1807.04364}, timestamp = {Tue, 19 Feb 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1807-04364.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@book{DBLP:books/sp/ZhangGYZGY17, author = {David Zhang and Dongmin Guo and Ke Yan}, title = {Breath Analysis for Medical Applications}, publisher = {Springer}, year = {2017}, url = {https://doi.org/10.1007/978-981-10-4322-2}, doi = {10.1007/978-981-10-4322-2}, isbn = {978-981-10-4321-5}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/books/sp/ZhangGYZGY17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@book{DBLP:books/sp/ZhangZZ17, author = {David Zhang and Hongzhi Zhang and Bob Zhang}, title = {Tongue Image Analysis}, publisher = {Springer}, year = {2017}, url = {https://doi.org/10.1007/978-981-10-2167-1}, doi = {10.1007/978-981-10-2167-1}, isbn = {978-981-10-2166-4}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/books/sp/ZhangZZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/XuLYZ17, author = {Yong Xu and Zhengming Li and Jian Yang and David Zhang}, title = {A Survey of Dictionary Learning Algorithms for Face Recognition}, journal = {{IEEE} Access}, volume = {5}, pages = {8502--8514}, year = {2017}, url = {https://doi.org/10.1109/ACCESS.2017.2695239}, doi = {10.1109/ACCESS.2017.2695239}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/access/XuLYZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/dsp/WuZL17, author = {Kebin Wu and David Zhang and Guangming Lu}, title = {{GMAT:} Glottal closure instants detection based on the Multiresolution Absolute Teager-Kaiser energy operator}, journal = {Digit. Signal Process.}, volume = {69}, pages = {286--299}, year = {2017}, url = {https://doi.org/10.1016/j.dsp.2017.07.006}, doi = {10.1016/J.DSP.2017.07.006}, timestamp = {Thu, 20 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/dsp/WuZL17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/ZhangZSC17, author = {Lei Zhang and David Zhang and Ming{-}ming Sun and Fangmei Chen}, title = {Facial beauty analysis based on geometric feature: Toward attractiveness assessment application}, journal = {Expert Syst. Appl.}, volume = {82}, pages = {252--265}, year = {2017}, url = {https://doi.org/10.1016/j.eswa.2017.04.021}, doi = {10.1016/J.ESWA.2017.04.021}, timestamp = {Fri, 30 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/eswa/ZhangZSC17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/LiZZ17, author = {Jinxing Li and Bob Zhang and David Zhang}, title = {Joint discriminative and collaborative representation for fatty liver disease diagnosis}, journal = {Expert Syst. Appl.}, volume = {89}, pages = {31--40}, year = {2017}, url = {https://doi.org/10.1016/j.eswa.2017.07.023}, doi = {10.1016/J.ESWA.2017.07.023}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/eswa/LiZZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/isci/LiZLWZ17, author = {Jinxing Li and David Zhang and Yongcheng Li and Jian Wu and Bob Zhang}, title = {Joint similar and specific learning for diabetes mellitus and impaired glucose regulation detection}, journal = {Inf. Sci.}, volume = {384}, pages = {191--204}, year = {2017}, url = {https://doi.org/10.1016/j.ins.2016.09.031}, doi = {10.1016/J.INS.2016.09.031}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/isci/LiZLWZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/isci/LiWZLZ17, author = {Mu Li and Qilong Wang and David Zhang and Peihua Li and Wangmeng Zuo}, title = {Joint distance and similarity measure learning based on triplet-based constraints}, journal = {Inf. Sci.}, volume = {406}, pages = {119--132}, year = {2017}, url = {https://doi.org/10.1016/j.ins.2017.04.027}, doi = {10.1016/J.INS.2017.04.027}, timestamp = {Tue, 22 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/isci/LiWZLZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/isci/ZhangYZ17, author = {Lei Zhang and Jian Yang and David Zhang}, title = {Domain class consistency based transfer learning for image classification across domains}, journal = {Inf. Sci.}, volume = {418}, pages = {242--257}, year = {2017}, url = {https://doi.org/10.1016/j.ins.2017.08.034}, doi = {10.1016/J.INS.2017.08.034}, timestamp = {Mon, 22 Aug 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/isci/ZhangYZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ZhangHZZ17, author = {Kunai Zhang and Da Huang and Bob Zhang and David Zhang}, title = {Improving texture analysis performance in biometrics by adjusting image sharpness}, journal = {Pattern Recognit.}, volume = {66}, pages = {16--25}, year = {2017}, url = {https://doi.org/10.1016/j.patcog.2016.11.025}, doi = {10.1016/J.PATCOG.2016.11.025}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/ZhangHZZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/ZhangHZ17, author = {Kunai Zhang and Da Huang and David Zhang}, title = {An optimized palmprint recognition approach based on image sharpness}, journal = {Pattern Recognit. Lett.}, volume = {85}, pages = {65--71}, year = {2017}, url = {https://doi.org/10.1016/j.patrec.2016.11.014}, doi = {10.1016/J.PATREC.2016.11.014}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/prl/ZhangHZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/BaiGZZ17, author = {Xuefei Bai and Nan Gao and Zonghua Zhang and David Zhang}, title = {3D palmprint identification combining blocked {ST} and {PCA}}, journal = {Pattern Recognit. Lett.}, volume = {100}, pages = {89--95}, year = {2017}, url = {https://doi.org/10.1016/j.patrec.2017.10.008}, doi = {10.1016/J.PATREC.2017.10.008}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/prl/BaiGZZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/KouZL17, author = {Lu Kou and David Zhang and Dongxu Liu}, title = {A Novel Medical E-Nose Signal Analysis System}, journal = {Sensors}, volume = {17}, number = {4}, pages = {402}, year = {2017}, url = {https://doi.org/10.3390/s17040402}, doi = {10.3390/S17040402}, timestamp = {Fri, 30 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/sensors/KouZL17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/LuLXLZY17, author = {Yuwu Lu and Zhihui Lai and Yong Xu and Xuelong Li and David Zhang and Chun Yuan}, title = {Nonnegative Discriminant Matrix Factorization}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {27}, number = {7}, pages = {1392--1405}, year = {2017}, url = {https://doi.org/10.1109/TCSVT.2016.2539779}, doi = {10.1109/TCSVT.2016.2539779}, timestamp = {Mon, 14 Feb 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcsv/LuLXLZY17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcyb/LaiXYSZ17, author = {Zhihui Lai and Yong Xu and Jian Yang and Linlin Shen and David Zhang}, title = {Rotational Invariant Dimensionality Reduction Algorithms}, journal = {{IEEE} Trans. Cybern.}, volume = {47}, number = {11}, pages = {3733--3746}, year = {2017}, url = {https://doi.org/10.1109/TCYB.2016.2578642}, doi = {10.1109/TCYB.2016.2578642}, timestamp = {Fri, 22 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcyb/LaiXYSZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/ZhangZ17, author = {Lei Zhang and David Zhang}, title = {Evolutionary Cost-Sensitive Discriminative Learning With Application to Vision and Olfaction}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {66}, number = {2}, pages = {198--211}, year = {2017}, url = {https://doi.org/10.1109/TIM.2016.2631878}, doi = {10.1109/TIM.2016.2631878}, timestamp = {Mon, 08 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tim/ZhangZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/YanZX17, author = {Ke Yan and David Zhang and Yong Xu}, title = {Correcting Instrumental Variation and Time-Varying Drift Using Parallel and Serial Multitask Learning}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {66}, number = {9}, pages = {2306--2316}, year = {2017}, url = {https://doi.org/10.1109/TIM.2017.2707898}, doi = {10.1109/TIM.2017.2707898}, timestamp = {Mon, 08 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tim/YanZX17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/ZuoWZLHMZ17, author = {Wangmeng Zuo and Faqiang Wang and David Zhang and Liang Lin and Yuchi Huang and Deyu Meng and Lei Zhang}, title = {Distance Metric Learning via Iterated Support Vector Machines}, journal = {{IEEE} Trans. Image Process.}, volume = {26}, number = {10}, pages = {4937--4950}, year = {2017}, url = {https://doi.org/10.1109/TIP.2017.2725578}, doi = {10.1109/TIP.2017.2725578}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/ZuoWZLHMZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/titb/WangZL17, author = {Dimin Wang and David Zhang and Guangming Lu}, title = {Generalized Feature Extraction for Wrist Pulse Analysis: From 1-D Time Series to 2-D Matrix}, journal = {{IEEE} J. Biomed. Health Informatics}, volume = {21}, number = {4}, pages = {978--985}, year = {2017}, url = {https://doi.org/10.1109/JBHI.2016.2628238}, doi = {10.1109/JBHI.2016.2628238}, timestamp = {Fri, 13 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/titb/WangZL17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tmm/LuYLLWZ17, author = {Yuwu Lu and Chun Yuan and Zhihui Lai and Xuelong Li and Wai Keung Wong and David Zhang}, title = {Nuclear Norm-Based 2DLPP for Image Classification}, journal = {{IEEE} Trans. Multim.}, volume = {19}, number = {11}, pages = {2391--2403}, year = {2017}, url = {https://doi.org/10.1109/TMM.2017.2703130}, doi = {10.1109/TMM.2017.2703130}, timestamp = {Mon, 14 Feb 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tmm/LuYLLWZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/LiLXYZ17, author = {Zhengming Li and Zhihui Lai and Yong Xu and Jian Yang and David Zhang}, title = {A Locality-Constrained and Label Embedding Dictionary Learning Algorithm for Image Classification}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {28}, number = {2}, pages = {278--293}, year = {2017}, url = {https://doi.org/10.1109/TNNLS.2015.2508025}, doi = {10.1109/TNNLS.2015.2508025}, timestamp = {Mon, 09 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tnn/LiLXYZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/XuZYYZ17, author = {Yong Xu and Zuofeng Zhong and Jian Yang and Jane You and David Zhang}, title = {A New Discriminative Sparse Representation Method for Robust Face Recognition via l\({}_{\mbox{2}}\) Regularization}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {28}, number = {10}, pages = {2233--2242}, year = {2017}, url = {https://doi.org/10.1109/TNNLS.2016.2580572}, doi = {10.1109/TNNLS.2016.2580572}, timestamp = {Mon, 09 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tnn/XuZYYZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/ZhangZ17, author = {Lei Zhang and David Zhang}, title = {Evolutionary Cost-Sensitive Extreme Learning Machine}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {28}, number = {12}, pages = {3045--3060}, year = {2017}, url = {https://doi.org/10.1109/TNNLS.2016.2607757}, doi = {10.1109/TNNLS.2016.2607757}, timestamp = {Mon, 09 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tnn/ZhangZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/QuZLG17, author = {Xiaofeng Qu and David Zhang and Guangming Lu and Zhenhua Guo}, title = {Door Knob Hand Recognition System}, journal = {{IEEE} Trans. Syst. Man Cybern. Syst.}, volume = {47}, number = {11}, pages = {2870--2881}, year = {2017}, url = {https://doi.org/10.1109/TSMC.2016.2531675}, doi = {10.1109/TSMC.2016.2531675}, timestamp = {Wed, 20 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/QuZLG17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ccbr/Chen0WD17, author = {Fangmei Chen and David Zhang and Cunrui Wang and Xiaodong Duan}, editor = {Jie Zhou and Yunhong Wang and Zhenan Sun and Yong Xu and Linlin Shen and Jianjiang Feng and Shiguang Shan and Yu Qiao and Zhenhua Guo and Shiqi Yu}, title = {Comparison and Fusion of Multiple Types of Features for Image-Based Facial Beauty Prediction}, booktitle = {Biometric Recognition - 12th Chinese Conference, {CCBR} 2017, Shenzhen, China, October 28-29, 2017, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {10568}, pages = {23--30}, publisher = {Springer}, year = {2017}, url = {https://doi.org/10.1007/978-3-319-69923-3\_3}, doi = {10.1007/978-3-319-69923-3\_3}, timestamp = {Tue, 04 Oct 2022 18:09:04 +0200}, biburl = {https://dblp.org/rec/conf/ccbr/Chen0WD17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccv/XuZ0F17, author = {Jun Xu and Lei Zhang and David Zhang and Xiangchu Feng}, title = {Multi-channel Weighted Nuclear Norm Minimization for Real Color Image Denoising}, booktitle = {{IEEE} International Conference on Computer Vision, {ICCV} 2017, Venice, Italy, October 22-29, 2017}, pages = {1105--1113}, publisher = {{IEEE} Computer Society}, year = {2017}, url = {https://doi.org/10.1109/ICCV.2017.125}, doi = {10.1109/ICCV.2017.125}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iccv/XuZ0F17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccvw/KristanLMFPZVHL17, author = {Matej Kristan and Ales Leonardis and Jiri Matas and Michael Felsberg and Roman P. Pflugfelder and Luka Cehovin Zajc and Tomas Vojir and Gustav H{\"{a}}ger and Alan Lukezic and Abdelrahman Eldesokey and Gustavo Fern{\'{a}}ndez and {\'{A}}lvaro Garc{\'{\i}}a{-}Mart{\'{\i}}n and Andrej Muhic and Alfredo Petrosino and Alireza Memarmoghadam and Andrea Vedaldi and Antoine Manzanera and Antoine Tran and A. Aydin Alatan and Bogdan Mocanu and Boyu Chen and Chang Huang and Changsheng Xu and Chong Sun and Dalong Du and David Zhang and Dawei Du and Deepak Mishra and Erhan Gundogdu and Erik Velasco{-}Salido and Fahad Shahbaz Khan and Francesco Battistone and Gorthi R. K. Sai Subrahmanyam and Goutam Bhat and Guan Huang and Guilherme Sousa Bastos and Guna Seetharaman and Hongliang Zhang and Houqiang Li and Huchuan Lu and Isabela Drummond and Jack Valmadre and Jae{-}chan Jeong and Jaeil Cho and Jae{-}Yeong Lee and Jana Noskova and Jianke Zhu and Jin Gao and Jingyu Liu and Ji{-}Wan Kim and Jo{\~{a}}o F. Henriques and Jos{\'{e}} M. Mart{\'{\i}}nez and Junfei Zhuang and Junliang Xing and Junyu Gao and Kai Chen and Kannappan Palaniappan and Karel Lebeda and Ke Gao and Kris M. Kitani and Lei Zhang and Lijun Wang and Lingxiao Yang and Longyin Wen and Luca Bertinetto and Mahdieh Poostchi and Martin Danelljan and Matthias Mueller and Mengdan Zhang and Ming{-}Hsuan Yang and Nianhao Xie and Ning Wang and Ondrej Miksik and Payman Moallem and Pallavi M. Venugopal and Pedro Senna and Philip H. S. Torr and Qiang Wang and Qifeng Yu and Qingming Huang and Rafael Martin Nieto and Richard Bowden and Risheng Liu and Ruxandra Tapu and Simon Hadfield and Siwei Lyu and Stuart Golodetz and Sunglok Choi and Tianzhu Zhang and Titus B. Zaharia and Vincenzo Santopietro and Wei Zou and Weiming Hu and Wenbing Tao and Wenbo Li and Wengang Zhou and Xianguo Yu and Xiao Bian and Yang Li and Yifan Xing and Yingruo Fan and Zheng Zhu and Zhipeng Zhang and Zhiqun He}, title = {The Visual Object Tracking {VOT2017} Challenge Results}, booktitle = {2017 {IEEE} International Conference on Computer Vision Workshops, {ICCV} Workshops 2017, Venice, Italy, October 22-29, 2017}, pages = {1949--1972}, publisher = {{IEEE} Computer Society}, year = {2017}, url = {https://doi.org/10.1109/ICCVW.2017.230}, doi = {10.1109/ICCVW.2017.230}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iccvw/KristanLMFPZVHL17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccvw/LiYLZZY17, author = {Feng Li and Yingjie Yao and Peihua Li and David Zhang and Wangmeng Zuo and Ming{-}Hsuan Yang}, title = {Integrating Boundary and Center Correlation Filters for Visual Tracking with Aspect Ratio Variation}, booktitle = {2017 {IEEE} International Conference on Computer Vision Workshops, {ICCV} Workshops 2017, Venice, Italy, October 22-29, 2017}, pages = {2001--2009}, publisher = {{IEEE} Computer Society}, year = {2017}, url = {https://doi.org/10.1109/ICCVW.2017.234}, doi = {10.1109/ICCVW.2017.234}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iccvw/LiYLZZY17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/YangXLZZ17, author = {Lingxiao Yang and Xiaohua Xie and Peihua Li and David Zhang and Lei Zhang}, title = {Part-based convolutional neural network for visual recognition}, booktitle = {2017 {IEEE} International Conference on Image Processing, {ICIP} 2017, Beijing, China, September 17-20, 2017}, pages = {1772--1776}, publisher = {{IEEE}}, year = {2017}, url = {https://doi.org/10.1109/ICIP.2017.8296586}, doi = {10.1109/ICIP.2017.8296586}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/icip/YangXLZZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icmcs/ZhuYZZ17, author = {Linnan Zhu and Lingxiao Yang and David Zhang and Lei Zhang}, title = {Learning a real-time generic tracker using convolutional neural networks}, booktitle = {2017 {IEEE} International Conference on Multimedia and Expo, {ICME} 2017, Hong Kong, China, July 10-14, 2017}, pages = {1219--1224}, publisher = {{IEEE} Computer Society}, year = {2017}, url = {https://doi.org/10.1109/ICME.2017.8019381}, doi = {10.1109/ICME.2017.8019381}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icmcs/ZhuYZZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mm/YangL0Z17, author = {Lingxiao Yang and Risheng Liu and David Zhang and Lei Zhang}, editor = {Qiong Liu and Rainer Lienhart and Haohong Wang and Sheng{-}Wei "Kuan{-}Ta" Chen and Susanne Boll and Yi{-}Ping Phoebe Chen and Gerald Friedland and Jia Li and Shuicheng Yan}, title = {Deep Location-Specific Tracking}, booktitle = {Proceedings of the 2017 {ACM} on Multimedia Conference, {MM} 2017, Mountain View, CA, USA, October 23-27, 2017}, pages = {1309--1317}, publisher = {{ACM}}, year = {2017}, url = {https://doi.org/10.1145/3123266.3123381}, doi = {10.1145/3123266.3123381}, timestamp = {Tue, 19 Feb 2019 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/mm/YangL0Z17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/psivt/WuCZZ17, author = {Guangbin Wu and Weishan Chen and Wangmeng Zuo and David Zhang}, editor = {Manoranjan Paul and Carlos Hitoshi Morimoto and Qingming Huang}, title = {Unsupervised Domain Adaptation with Robust Deep Logistic Regression}, booktitle = {Image and Video Technology - 8th Pacific-Rim Symposium, {PSIVT} 2017, Wuhan, China, November 20-24, 2017, Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {10749}, pages = {199--211}, publisher = {Springer}, year = {2017}, url = {https://doi.org/10.1007/978-3-319-75786-5\_17}, doi = {10.1007/978-3-319-75786-5\_17}, timestamp = {Thu, 17 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/psivt/WuCZZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icbea/2017, editor = {David Zhang and Gautam Sethi and Raymond N. J. Veldhuis and Yasushi Yagi and Andrew Beng Jin Teoh}, title = {Proceedings of the 2017 International Conference on Biometrics Engineering and Application, {ICBEA} 2017, Hong Kong, Hong Kong, April 21-23, 2017}, publisher = {{ACM}}, year = {2017}, url = {https://doi.org/10.1145/3077829}, doi = {10.1145/3077829}, isbn = {978-1-4503-4871-3}, timestamp = {Tue, 06 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icbea/2017.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/premi/2017, editor = {B. Uma Shankar and Kuntal Ghosh and Deba Prasad Mandal and Shubhra Sankar Ray and David Zhang and Sankar K. Pal}, title = {Pattern Recognition and Machine Intelligence - 7th International Conference, PReMI 2017, Kolkata, India, December 5-8, 2017, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {10597}, publisher = {Springer}, year = {2017}, url = {https://doi.org/10.1007/978-3-319-69900-4}, doi = {10.1007/978-3-319-69900-4}, isbn = {978-3-319-69899-1}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/premi/2017.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/LiZGZZ17, author = {Mu Li and Wangmeng Zuo and Shuhang Gu and Debin Zhao and David Zhang}, title = {Learning Convolutional Networks for Content-weighted Image Compression}, journal = {CoRR}, volume = {abs/1703.10553}, year = {2017}, url = {http://arxiv.org/abs/1703.10553}, eprinttype = {arXiv}, eprint = {1703.10553}, timestamp = {Tue, 22 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/LiZGZZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/XuZZ17, author = {Jun Xu and Lei Zhang and David Zhang}, title = {External Prior Guided Internal Prior Learning for Real Noisy Image Denoising}, journal = {CoRR}, volume = {abs/1705.04505}, year = {2017}, url = {http://arxiv.org/abs/1705.04505}, eprinttype = {arXiv}, eprint = {1705.04505}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/XuZZ17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/XuZZF17, author = {Jun Xu and Lei Zhang and David Zhang and Xiangchu Feng}, title = {Multi-channel Weighted Nuclear Norm Minimization for Real Color Image Denoising}, journal = {CoRR}, volume = {abs/1705.09912}, year = {2017}, url = {http://arxiv.org/abs/1705.09912}, eprinttype = {arXiv}, eprint = {1705.09912}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/XuZZF17.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1710-02039, author = {Feng Li and Yingjie Yao and Peihua Li and David Zhang and Wangmeng Zuo and Ming{-}Hsuan Yang}, title = {Integrating Boundary and Center Correlation Filters for Visual Tracking with Aspect Ratio Variation}, journal = {CoRR}, volume = {abs/1710.02039}, year = {2017}, url = {http://arxiv.org/abs/1710.02039}, eprinttype = {arXiv}, eprint = {1710.02039}, timestamp = {Thu, 26 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1710-02039.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@book{DBLP:books/sp/ZhangXZ16, author = {David Zhang and Yong Xu and Wangmeng Zuo}, title = {Discriminative Learning in Biometrics}, publisher = {Springer}, year = {2016}, url = {https://doi.org/10.1007/978-981-10-2056-8}, doi = {10.1007/978-981-10-2056-8}, isbn = {978-981-10-2055-1}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/books/sp/ZhangXZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@book{DBLP:books/sp/ZhangCX16, author = {David Zhang and Fangmei Chen and Yong Xu}, title = {Computer Models for Facial Beauty Analysis}, publisher = {Springer}, year = {2016}, url = {https://doi.org/10.1007/978-3-319-32598-9}, doi = {10.1007/978-3-319-32598-9}, isbn = {978-3-319-32596-5}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/books/sp/ZhangCX16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/bspc/WangZL16, author = {Dimin Wang and David Zhang and Guangming Lu}, title = {A robust signal preprocessing framework for wrist pulse analysis}, journal = {Biomed. Signal Process. Control.}, volume = {23}, pages = {62--75}, year = {2016}, url = {https://doi.org/10.1016/j.bspc.2015.08.002}, doi = {10.1016/J.BSPC.2015.08.002}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/bspc/WangZL16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ejasp/DengRZZZW16, author = {Hong Deng and Dongwei Ren and David Zhang and Wangmeng Zuo and Hongzhi Zhang and Kuanquan Wang}, title = {Efficient non-uniform deblurring based on generalized additive convolution model}, journal = {{EURASIP} J. Adv. Signal Process.}, volume = {2016}, pages = {22}, year = {2016}, url = {https://doi.org/10.1186/s13634-016-0318-2}, doi = {10.1186/S13634-016-0318-2}, timestamp = {Thu, 12 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ejasp/DengRZZZW16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/WuZL16, author = {Kebin Wu and David Zhang and Guangming Lu}, title = {iPEEH: Improving pitch estimation by enhancing harmonics}, journal = {Expert Syst. Appl.}, volume = {64}, pages = {317--329}, year = {2016}, url = {https://doi.org/10.1016/j.eswa.2016.08.018}, doi = {10.1016/J.ESWA.2016.08.018}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/eswa/WuZL16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/ChenZ16a, author = {Fangmei Chen and David Zhang}, title = {Combining a causal effect criterion for evaluation of facial attractiveness models}, journal = {Neurocomputing}, volume = {177}, pages = {98--109}, year = {2016}, url = {https://doi.org/10.1016/j.neucom.2015.11.010}, doi = {10.1016/J.NEUCOM.2015.11.010}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/ChenZ16a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/HuangZWZ16, author = {Di Huang and Xiangrong Zhu and Yunhong Wang and David Zhang}, title = {Dorsal hand vein recognition via hierarchical combination of texture and shape clues}, journal = {Neurocomputing}, volume = {214}, pages = {815--828}, year = {2016}, url = {https://doi.org/10.1016/j.neucom.2016.06.057}, doi = {10.1016/J.NEUCOM.2016.06.057}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/HuangZWZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/inffus/ZhangZ16, author = {Lei Zhang and David Zhang}, title = {MetricFusion: Generalized metric swarm learning for similarity measure}, journal = {Inf. Fusion}, volume = {30}, pages = {80--90}, year = {2016}, url = {https://doi.org/10.1016/j.inffus.2015.12.004}, doi = {10.1016/J.INFFUS.2015.12.004}, timestamp = {Thu, 20 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/inffus/ZhangZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/FeiXTZ16, author = {Lunke Fei and Yong Xu and Wenliang Tang and David Zhang}, title = {Double-orientation code and nonlinear matching scheme for palmprint recognition}, journal = {Pattern Recognit.}, volume = {49}, pages = {89--101}, year = {2016}, url = {https://doi.org/10.1016/j.patcog.2015.08.001}, doi = {10.1016/J.PATCOG.2015.08.001}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/FeiXTZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/LiLZX16, author = {Zuoyong Li and Guanghai Liu and David Zhang and Yong Xu}, title = {Robust single-object image segmentation based on salient transition region}, journal = {Pattern Recognit.}, volume = {52}, pages = {317--331}, year = {2016}, url = {https://doi.org/10.1016/j.patcog.2015.10.009}, doi = {10.1016/J.PATCOG.2015.10.009}, timestamp = {Tue, 29 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/LiLZX16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/YanWCCZ16, author = {Yan Yan and Hanzi Wang and Si Chen and Xiaochun Cao and David Zhang}, title = {Quadratic projection based feature extraction with its application to biometric recognition}, journal = {Pattern Recognit.}, volume = {56}, pages = {40--49}, year = {2016}, url = {https://doi.org/10.1016/j.patcog.2016.02.010}, doi = {10.1016/J.PATCOG.2016.02.010}, timestamp = {Tue, 15 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/YanWCCZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/FanXNFZ16, author = {Zizhu Fan and Yong Xu and Ming Ni and Xiaozhao Fang and David Zhang}, title = {Individualized learning for improving kernel Fisher discriminant analysis}, journal = {Pattern Recognit.}, volume = {58}, pages = {100--109}, year = {2016}, url = {https://doi.org/10.1016/j.patcog.2016.03.029}, doi = {10.1016/J.PATCOG.2016.03.029}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/FanXNFZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/LinCZZY16, author = {Liang Lin and Jason J. Corso and Wangmeng Zuo and David Zhang and Benjamin Z. Yao}, title = {Compositional models and Structured learning for visual recognition}, journal = {Pattern Recognit.}, volume = {59}, pages = {1--4}, year = {2016}, url = {https://doi.org/10.1016/j.patcog.2016.07.030}, doi = {10.1016/J.PATCOG.2016.07.030}, timestamp = {Sat, 30 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/LinCZZY16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/FeiXZ16, author = {Lunke Fei and Yong Xu and David Zhang}, title = {Half-orientation extraction of palmprint features}, journal = {Pattern Recognit. Lett.}, volume = {69}, pages = {35--41}, year = {2016}, url = {https://doi.org/10.1016/j.patrec.2015.10.003}, doi = {10.1016/J.PATREC.2015.10.003}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/prl/FeiXZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcyb/ZhangZLZ16, author = {Kaihua Zhang and Lei Zhang and Kin{-}Man Lam and David Zhang}, title = {A Level Set Approach to Image Segmentation With Intensity Inhomogeneity}, journal = {{IEEE} Trans. Cybern.}, volume = {46}, number = {2}, pages = {546--557}, year = {2016}, url = {https://doi.org/10.1109/TCYB.2015.2409119}, doi = {10.1109/TCYB.2015.2409119}, timestamp = {Wed, 16 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcyb/ZhangZLZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcyb/LuLXLZY16, author = {Yuwu Lu and Zhihui Lai and Yong Xu and Xuelong Li and David Zhang and Chun Yuan}, title = {Low-Rank Preserving Projections}, journal = {{IEEE} Trans. Cybern.}, volume = {46}, number = {8}, pages = {1900--1913}, year = {2016}, url = {https://doi.org/10.1109/TCYB.2015.2457611}, doi = {10.1109/TCYB.2015.2457611}, timestamp = {Mon, 14 Feb 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcyb/LuLXLZY16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/YanZ16, author = {Ke Yan and David Zhang}, title = {Correcting Instrumental Variation and Time-Varying Drift: {A} Transfer Learning Approach With Autoencoders}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {65}, number = {9}, pages = {2012--2022}, year = {2016}, url = {https://doi.org/10.1109/TIM.2016.2573078}, doi = {10.1109/TIM.2016.2573078}, timestamp = {Mon, 08 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tim/YanZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/XuFWLZ16, author = {Yong Xu and Xiaozhao Fang and Jian Wu and Xuelong Li and David Zhang}, title = {Discriminative Transfer Subspace Learning via Low-Rank and Sparse Representation}, journal = {{IEEE} Trans. Image Process.}, volume = {25}, number = {2}, pages = {850--863}, year = {2016}, url = {https://doi.org/10.1109/TIP.2015.2510498}, doi = {10.1109/TIP.2015.2510498}, timestamp = {Mon, 14 Feb 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tip/XuFWLZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/ZhangZZ16, author = {Lei Zhang and Wangmeng Zuo and David Zhang}, title = {{LSDT:} Latent Sparse Domain Transfer Learning for Visual Adaptation}, journal = {{IEEE} Trans. Image Process.}, volume = {25}, number = {3}, pages = {1177--1191}, year = {2016}, url = {https://doi.org/10.1109/TIP.2016.2516952}, doi = {10.1109/TIP.2016.2516952}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/ZhangZZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/ZuoRZG016, author = {Wangmeng Zuo and Dongwei Ren and David Zhang and Shuhang Gu and Lei Zhang}, title = {Learning Iteration-wise Generalized Shrinkage-Thresholding Operators for Blind Deconvolution}, journal = {{IEEE} Trans. Image Process.}, volume = {25}, number = {4}, pages = {1751--1764}, year = {2016}, url = {https://doi.org/10.1109/TIP.2016.2531905}, doi = {10.1109/TIP.2016.2531905}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tip/ZuoRZG016.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/JingWLHZ16, author = {Xiao{-}Yuan Jing and Fei Wu and Zhiqiang Li and Ruimin Hu and David Zhang}, title = {Multi-Label Dictionary Learning for Image Annotation}, journal = {{IEEE} Trans. Image Process.}, volume = {25}, number = {6}, pages = {2712--2725}, year = {2016}, url = {https://doi.org/10.1109/TIP.2016.2549459}, doi = {10.1109/TIP.2016.2549459}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/JingWLHZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/ZhangZ16, author = {Lei Zhang and David Zhang}, title = {Robust Visual Knowledge Transfer via Extreme Learning Machine-Based Domain Adaptation}, journal = {{IEEE} Trans. Image Process.}, volume = {25}, number = {10}, pages = {4959--4973}, year = {2016}, url = {https://doi.org/10.1109/TIP.2016.2598679}, doi = {10.1109/TIP.2016.2598679}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/ZhangZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/titb/ZuoWZ16, author = {Wangmeng Zuo and Peng Wang and David Zhang}, title = {Comparison of Three Different Types of Wrist Pulse Signals by Their Physical Meanings and Diagnosis Performance}, journal = {{IEEE} J. Biomed. Health Informatics}, volume = {20}, number = {1}, pages = {119--127}, year = {2016}, url = {https://doi.org/10.1109/JBHI.2014.2369821}, doi = {10.1109/JBHI.2014.2369821}, timestamp = {Tue, 17 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/titb/ZuoWZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/titb/WangZL16, author = {Dimin Wang and David Zhang and Guangming Lu}, title = {An Optimal Pulse System Design by Multichannel Sensors Fusion}, journal = {{IEEE} J. Biomed. Health Informatics}, volume = {20}, number = {2}, pages = {450--459}, year = {2016}, url = {https://doi.org/10.1109/JBHI.2015.2392132}, doi = {10.1109/JBHI.2015.2392132}, timestamp = {Fri, 13 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/titb/WangZL16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tmm/ZhangZ16, author = {Lei Zhang and David Zhang}, title = {Visual Understanding via Multi-Feature Shared Learning With Global Consistency}, journal = {{IEEE} Trans. Multim.}, volume = {18}, number = {2}, pages = {247--259}, year = {2016}, url = {https://doi.org/10.1109/TMM.2015.2510509}, doi = {10.1109/TMM.2015.2510509}, timestamp = {Thu, 01 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tmm/ZhangZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/LaiWXYZ16, author = {Zhihui Lai and Wai Keung Wong and Yong Xu and Jian Yang and David Zhang}, title = {Approximate Orthogonal Sparse Embedding for Dimensionality Reduction}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {27}, number = {4}, pages = {723--735}, year = {2016}, url = {https://doi.org/10.1109/TNNLS.2015.2422994}, doi = {10.1109/TNNLS.2015.2422994}, timestamp = {Mon, 09 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tnn/LaiWXYZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/QuZL16, author = {Xiaofeng Qu and David Zhang and Guangming Lu}, title = {A Novel Line-Scan Palmprint Acquisition System}, journal = {{IEEE} Trans. Syst. Man Cybern. Syst.}, volume = {46}, number = {11}, pages = {1481--1491}, year = {2016}, url = {https://doi.org/10.1109/TSMC.2015.2504036}, doi = {10.1109/TSMC.2015.2504036}, timestamp = {Wed, 20 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/QuZL16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/accv/XuRZZ16, author = {Jun Xu and Dongwei Ren and Lei Zhang and David Zhang}, editor = {Chu{-}Song Chen and Jiwen Lu and Kai{-}Kuang Ma}, title = {Patch Group Based Bayesian Learning for Blind Image Denoising}, booktitle = {Computer Vision - {ACCV} 2016 Workshops - {ACCV} 2016 International Workshops, Taipei, Taiwan, November 20-24, 2016, Revised Selected Papers, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {10116}, pages = {79--95}, publisher = {Springer}, year = {2016}, url = {https://doi.org/10.1007/978-3-319-54407-6\_6}, doi = {10.1007/978-3-319-54407-6\_6}, timestamp = {Tue, 14 May 2019 10:00:50 +0200}, biburl = {https://dblp.org/rec/conf/accv/XuRZZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/WangZLZZ16, author = {Faqiang Wang and Wangmeng Zuo and Liang Lin and David Zhang and Lei Zhang}, title = {Joint Learning of Single-Image and Cross-Image Representations for Person Re-identification}, booktitle = {2016 {IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR} 2016, Las Vegas, NV, USA, June 27-30, 2016}, pages = {1288--1296}, publisher = {{IEEE} Computer Society}, year = {2016}, url = {https://doi.org/10.1109/CVPR.2016.144}, doi = {10.1109/CVPR.2016.144}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/WangZLZZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/ZhangXYLZ16, author = {Zheng Zhang and Yong Xu and Jian Yang and Xuelong Li and David Zhang}, title = {A survey of sparse representation: algorithms and applications}, journal = {CoRR}, volume = {abs/1602.07017}, year = {2016}, url = {http://arxiv.org/abs/1602.07017}, eprinttype = {arXiv}, eprint = {1602.07017}, timestamp = {Wed, 16 Feb 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/ZhangXYLZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/YanKZ16, author = {Ke Yan and Lu Kou and David Zhang}, title = {Domain Adaptation via Maximum Independence of Domain Features}, journal = {CoRR}, volume = {abs/1603.04535}, year = {2016}, url = {http://arxiv.org/abs/1603.04535}, eprinttype = {arXiv}, eprint = {1603.04535}, timestamp = {Thu, 17 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/YanKZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/YanWCCZ16, author = {Yan Yan and Hanzi Wang and Si Chen and Xiaochun Cao and David Zhang}, title = {Quadratic Projection Based Feature Extraction with Its Application to Biometric Recognition}, journal = {CoRR}, volume = {abs/1603.07797}, year = {2016}, url = {http://arxiv.org/abs/1603.07797}, eprinttype = {arXiv}, eprint = {1603.07797}, timestamp = {Tue, 15 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/YanWCCZ16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/LiZLW16, author = {Jinxing Li and David Zhang and Yongcheng Li and Jian Wu}, title = {Multi-modal Fusion for Diabetes Mellitus and Impaired Glucose Regulation Detection}, journal = {CoRR}, volume = {abs/1604.03443}, year = {2016}, url = {http://arxiv.org/abs/1604.03443}, eprinttype = {arXiv}, eprint = {1604.03443}, timestamp = {Thu, 17 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/LiZLW16.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/LiZZ16c, author = {Mu Li and Wangmeng Zuo and David Zhang}, title = {Convolutional Network for Attribute-driven and Identity-preserving Human Face Generation}, journal = {CoRR}, volume = {abs/1608.06434}, year = {2016}, url = {http://arxiv.org/abs/1608.06434}, eprinttype = {arXiv}, eprint = {1608.06434}, timestamp = {Tue, 22 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/LiZZ16c.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/LiZZ16e, author = {Mu Li and Wangmeng Zuo and David Zhang}, title = {Deep Identity-aware Transfer of Facial Attributes}, journal = {CoRR}, volume = {abs/1610.05586}, year = {2016}, url = {http://arxiv.org/abs/1610.05586}, eprinttype = {arXiv}, eprint = {1610.05586}, timestamp = {Tue, 22 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/LiZZ16e.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/access/ZhangXYLZ15, author = {Zheng Zhang and Yong Xu and Jian Yang and Xuelong Li and David Zhang}, title = {A Survey of Sparse Representation: Algorithms and Applications}, journal = {{IEEE} Access}, volume = {3}, pages = {490--530}, year = {2015}, url = {https://doi.org/10.1109/ACCESS.2015.2430359}, doi = {10.1109/ACCESS.2015.2430359}, timestamp = {Tue, 21 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/access/ZhangXYLZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/dsp/YinHHZWZ15, author = {Xiao{-}Xia Yin and Sillas Hadjiloucas and Jing He and Yanchun Zhang and Y. Wang and David Dapeng Zhang}, title = {Application of complex extreme learning machine to multiclass classification problems with high dimensionality: {A} THz spectra classification problem}, journal = {Digit. Signal Process.}, volume = {40}, pages = {40--52}, year = {2015}, url = {https://doi.org/10.1016/j.dsp.2015.01.007}, doi = {10.1016/J.DSP.2015.01.007}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/dsp/YinHHZWZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/ChenXZC15, author = {Fangmei Chen and Yong Xu and David Zhang and Kai Chen}, title = {2D facial landmark model design by combining key points and inserted points}, journal = {Expert Syst. Appl.}, volume = {42}, number = {21}, pages = {7858--7868}, year = {2015}, url = {https://doi.org/10.1016/j.eswa.2015.06.015}, doi = {10.1016/J.ESWA.2015.06.015}, timestamp = {Mon, 05 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/eswa/ChenXZC15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/WuZ15, author = {Kebin Wu and David Zhang}, title = {Robust tongue segmentation by fusing region-based and edge-based approaches}, journal = {Expert Syst. Appl.}, volume = {42}, number = {21}, pages = {8027--8038}, year = {2015}, url = {https://doi.org/10.1016/j.eswa.2015.06.032}, doi = {10.1016/J.ESWA.2015.06.032}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/eswa/WuZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/LiCTXZ15, author = {Zuoyong Li and Yong Cheng and Kezong Tang and Yong Xu and David Zhang}, title = {A salt {\&} pepper noise filter based on local and global image information}, journal = {Neurocomputing}, volume = {159}, pages = {172--185}, year = {2015}, url = {https://doi.org/10.1016/j.neucom.2014.12.087}, doi = {10.1016/J.NEUCOM.2014.12.087}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/LiCTXZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/LiuZS15, author = {Feng Liu and David Zhang and LinLin Shen}, title = {Study on novel Curvature Features for 3D fingerprint recognition}, journal = {Neurocomputing}, volume = {168}, pages = {599--608}, year = {2015}, url = {https://doi.org/10.1016/j.neucom.2015.05.065}, doi = {10.1016/J.NEUCOM.2015.05.065}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/LiuZS15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/RenZZZ15, author = {Dongwei Ren and Hongzhi Zhang and David Zhang and Wangmeng Zuo}, title = {Fast total-variation based image restoration based on derivative alternated direction optimization methods}, journal = {Neurocomputing}, volume = {170}, pages = {201--212}, year = {2015}, url = {https://doi.org/10.1016/j.neucom.2014.08.101}, doi = {10.1016/J.NEUCOM.2014.08.101}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/RenZZZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/LiuZZ15, author = {Yahui Liu and Bob Zhang and David Zhang}, title = {Ear-parotic face angle: {A} unique feature for 3D ear recognition}, journal = {Pattern Recognit. Lett.}, volume = {53}, pages = {9--15}, year = {2015}, url = {https://doi.org/10.1016/j.patrec.2014.10.014}, doi = {10.1016/J.PATREC.2014.10.014}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/prl/LiuZZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/ZhangZ15, author = {Lei Zhang and David Zhang}, title = {Domain Adaptation Extreme Learning Machines for Drift Compensation in E-Nose Systems}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {64}, number = {7}, pages = {1790--1801}, year = {2015}, url = {https://doi.org/10.1109/TIM.2014.2367775}, doi = {10.1109/TIM.2014.2367775}, timestamp = {Mon, 08 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tim/ZhangZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/WangZL15, author = {Dimin Wang and David Zhang and Guangming Lu}, title = {A Novel Multichannel Wrist Pulse System With Different Sensor Arrays}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {64}, number = {7}, pages = {2020--2034}, year = {2015}, url = {https://doi.org/10.1109/TIM.2014.2357599}, doi = {10.1109/TIM.2014.2357599}, timestamp = {Mon, 08 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tim/WangZL15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/XuFZ15, author = {Yong Xu and Lunke Fei and David Zhang}, title = {Combining Left and Right Palmprint Images for More Accurate Personal Identification}, journal = {{IEEE} Trans. Image Process.}, volume = {24}, number = {2}, pages = {549--559}, year = {2015}, url = {https://doi.org/10.1109/TIP.2014.2380171}, doi = {10.1109/TIP.2014.2380171}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/XuFZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/ShiGLYBZ15, author = {Xiaoshuang Shi and Zhenhua Guo and Zhihui Lai and Yujiu Yang and Zhifeng Bao and David Zhang}, title = {A Framework of Joint Graph Embedding and Sparse Regression for Dimensionality Reduction}, journal = {{IEEE} Trans. Image Process.}, volume = {24}, number = {4}, pages = {1341--1355}, year = {2015}, url = {https://doi.org/10.1109/TIP.2015.2405474}, doi = {10.1109/TIP.2015.2405474}, timestamp = {Mon, 26 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tip/ShiGLYBZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/WangZ0MZ15, author = {Faqiang Wang and Wangmeng Zuo and Lei Zhang and Deyu Meng and David Zhang}, title = {A Kernel Classification Framework for Metric Learning}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {26}, number = {9}, pages = {1950--1962}, year = {2015}, url = {https://doi.org/10.1109/TNNLS.2014.2361142}, doi = {10.1109/TNNLS.2014.2361142}, timestamp = {Mon, 09 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tnn/WangZ0MZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cccv/LiuSZ15, author = {Feng Liu and Linlin Shen and David Zhang}, editor = {Hongbin Zha and Xilin Chen and Liang Wang and Qiguang Miao}, title = {Feature-Based 3D Reconstruction Model for Close-Range Objects and Its Application to Human Finger}, booktitle = {Computer Vision - {CCF} Chinese Conference, {CCCV} 2015, Xi'an, China, September 18-20, 2015, Proceedings, Part {II}}, series = {Communications in Computer and Information Science}, volume = {547}, pages = {379--393}, publisher = {Springer}, year = {2015}, url = {https://doi.org/10.1007/978-3-662-48570-5\_37}, doi = {10.1007/978-3-662-48570-5\_37}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cccv/LiuSZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccv/XuZZZF15, author = {Jun Xu and Lei Zhang and Wangmeng Zuo and David Zhang and Xiangchu Feng}, title = {Patch Group Based Nonlocal Self-Similarity Prior Learning for Image Denoising}, booktitle = {2015 {IEEE} International Conference on Computer Vision, {ICCV} 2015, Santiago, Chile, December 7-13, 2015}, pages = {244--252}, publisher = {{IEEE} Computer Society}, year = {2015}, url = {https://doi.org/10.1109/ICCV.2015.36}, doi = {10.1109/ICCV.2015.36}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iccv/XuZZZF15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icmlc/ZhuWXZZ15, author = {Yuanyuan Zhu and Xiaohe Wu and Jun Xu and David Zhang and Wangmeng Zuo}, title = {Radius-margin based support vector machine with LogDet regularizaron}, booktitle = {2015 International Conference on Machine Learning and Cybernetics, {ICMLC} 2015, Guangzhou, China, July 12-15, 2015}, pages = {277--282}, publisher = {{IEEE}}, year = {2015}, url = {https://doi.org/10.1109/ICMLC.2015.7340935}, doi = {10.1109/ICMLC.2015.7340935}, timestamp = {Wed, 16 Oct 2019 14:14:56 +0200}, biburl = {https://dblp.org/rec/conf/icmlc/ZhuWXZZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icycsee/LuoLZWZZ15, author = {Changchun Luo and Mu Li and Hongzhi Zhang and Faqiang Wang and David Zhang and Wangmeng Zuo}, editor = {Hongzhi Wang and Haoliang Qi and Wanxiang Che and Zhaowen Qiu and Leilei Kong and Zhongyuan Han and Junyu Lin and Zeguang Lu}, title = {Metric Learning with Relative Distance Constraints: {A} Modified {SVM} Approach}, booktitle = {Intelligent Computation in Big Data Era - International Conference of Young Computer Scientists, Engineers and Educators, {ICYCSEE} 2015, Harbin, China, January 10-12, 2015. Proceedings}, series = {Communications in Computer and Information Science}, volume = {503}, pages = {242--249}, publisher = {Springer}, year = {2015}, url = {https://doi.org/10.1007/978-3-662-46248-5\_30}, doi = {10.1007/978-3-662-46248-5\_30}, timestamp = {Wed, 06 Jan 2021 14:57:34 +0100}, biburl = {https://dblp.org/rec/conf/icycsee/LuoLZWZZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iscide/WangZZZZ15, author = {Weizhi Wang and Hongzhi Zhang and Pengfei Zhu and David Zhang and Wangmeng Zuo}, editor = {Xiaofei He and Xinbo Gao and Yanning Zhang and Zhi{-}Hua Zhou and Zhiyong Liu and Baochuan Fu and Fuyuan Hu and Zhancheng Zhang}, title = {Non-convex Regularized Self-representation for Unsupervised Feature Selection}, booktitle = {Intelligence Science and Big Data Engineering. Big Data and Machine Learning Techniques - 5th International Conference, IScIDE 2015, Suzhou, China, June 14-16, 2015, Revised Selected Papers, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {9243}, pages = {55--65}, publisher = {Springer}, year = {2015}, url = {https://doi.org/10.1007/978-3-319-23862-3\_6}, doi = {10.1007/978-3-319-23862-3\_6}, timestamp = {Mon, 04 Dec 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iscide/WangZZZZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iscide/HuangZZ15, author = {Da Huang and Kunai Zhang and David Zhang}, editor = {Xiaofei He and Xinbo Gao and Yanning Zhang and Zhi{-}Hua Zhou and Zhiyong Liu and Baochuan Fu and Fuyuan Hu and Zhancheng Zhang}, title = {Improvement on Gabor Texture Feature Based Biometric Analysis Using Image Blurring}, booktitle = {Intelligence Science and Big Data Engineering. Image and Video Data Engineering - 5th International Conference, IScIDE 2015, Suzhou, China, June 14-16, 2015, Revised Selected Papers, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {9242}, pages = {420--430}, publisher = {Springer}, year = {2015}, url = {https://doi.org/10.1007/978-3-319-23989-7\_43}, doi = {10.1007/978-3-319-23989-7\_43}, timestamp = {Mon, 19 Apr 2021 14:35:00 +0200}, biburl = {https://dblp.org/rec/conf/iscide/HuangZZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:reference/bio/ZhangL15, author = {David Zhang and Laura Li Liu}, editor = {Stan Z. Li and Anil K. Jain}, title = {Palmprint Features}, booktitle = {Encyclopedia of Biometrics, Second Edition}, pages = {1206--1213}, publisher = {Springer {US}}, year = {2015}, url = {https://doi.org/10.1007/978-1-4899-7488-4\_266}, doi = {10.1007/978-1-4899-7488-4\_266}, timestamp = {Fri, 27 Oct 2017 15:34:05 +0200}, biburl = {https://dblp.org/rec/reference/bio/ZhangL15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:reference/bio/ZhangK15, author = {David Zhang and Vivek Kanhangad}, editor = {Stan Z. Li and Anil K. Jain}, title = {Palmprint, 3D}, booktitle = {Encyclopedia of Biometrics, Second Edition}, pages = {1219--1226}, publisher = {Springer {US}}, year = {2015}, url = {https://doi.org/10.1007/978-1-4899-7488-4\_264}, doi = {10.1007/978-1-4899-7488-4\_264}, timestamp = {Mon, 18 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/reference/bio/ZhangK15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/ZuoWZLHMZ15, author = {Wangmeng Zuo and Faqiang Wang and David Zhang and Liang Lin and Yuchi Huang and Deyu Meng and Lei Zhang}, title = {Iterated Support Vector Machines for Distance Metric Learning}, journal = {CoRR}, volume = {abs/1502.00363}, year = {2015}, url = {http://arxiv.org/abs/1502.00363}, eprinttype = {arXiv}, eprint = {1502.00363}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/ZuoWZLHMZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/ZhangZ15, author = {Lei Zhang and David Zhang}, title = {Evolutionary Cost-sensitive Extreme Learning Machine and Subspace Extension}, journal = {CoRR}, volume = {abs/1505.04373}, year = {2015}, url = {http://arxiv.org/abs/1505.04373}, eprinttype = {arXiv}, eprint = {1505.04373}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/ZhangZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/ZhangZ15a, author = {Lei Zhang and David Zhang}, title = {Robust Visual Knowledge Transfer via {EDA}}, journal = {CoRR}, volume = {abs/1505.04382}, year = {2015}, url = {http://arxiv.org/abs/1505.04382}, eprinttype = {arXiv}, eprint = {1505.04382}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/ZhangZ15a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/ZhangZ15b, author = {Lei Zhang and David Zhang}, title = {Visual Understanding via Multi-Feature Jointly Sharing Learning}, journal = {CoRR}, volume = {abs/1505.05233}, year = {2015}, url = {http://arxiv.org/abs/1505.05233}, eprinttype = {arXiv}, eprint = {1505.05233}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/ZhangZ15b.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/ZhangZ15c, author = {Lei Zhang and David Zhang}, title = {Domain Adaptation Extreme Learning Machines for Drift Compensation in E-nose Systems}, journal = {CoRR}, volume = {abs/1505.06405}, year = {2015}, url = {http://arxiv.org/abs/1505.06405}, eprinttype = {arXiv}, eprint = {1505.06405}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/ZhangZ15c.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/ZhangZ15d, author = {Lei Zhang and David Zhang}, title = {{SVM} and {ELM:} Who Wins? Object Recognition with Deep Convolutional Features from ImageNet}, journal = {CoRR}, volume = {abs/1506.02509}, year = {2015}, url = {http://arxiv.org/abs/1506.02509}, eprinttype = {arXiv}, eprint = {1506.02509}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/ZhangZ15d.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/WangWZLZ15, author = {Da{-}Han Wang and Hanzi Wang and Dong Zhang and Jonathan Li and David Zhang}, title = {Robust Scene Text Recognition Using Sparse Coding based Features}, journal = {CoRR}, volume = {abs/1512.08669}, year = {2015}, url = {http://arxiv.org/abs/1512.08669}, eprinttype = {arXiv}, eprint = {1512.08669}, timestamp = {Tue, 02 Mar 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/WangWZLZ15.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijcm/DengZZZ14, author = {Hong Deng and Wangmeng Zuo and Hongzhi Zhang and David Zhang}, title = {An additive convolution model for fast restoration of nonuniform blurred images}, journal = {Int. J. Comput. Math.}, volume = {91}, number = {11}, pages = {2446--2466}, year = {2014}, url = {https://doi.org/10.1080/00207160.2013.811235}, doi = {10.1080/00207160.2013.811235}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijcm/DengZZZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijcv/YangZFZ14, author = {Meng Yang and Lei Zhang and Xiangchu Feng and David Zhang}, title = {Sparse Representation Based Fisher Discrimination Dictionary Learning for Image Classification}, journal = {Int. J. Comput. Vis.}, volume = {109}, number = {3}, pages = {209--232}, year = {2014}, url = {https://doi.org/10.1007/s11263-014-0722-8}, doi = {10.1007/S11263-014-0722-8}, timestamp = {Fri, 13 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijcv/YangZFZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/XuLYZ14, author = {Yong Xu and Xuelong Li and Jian Yang and David Zhang}, title = {Integrate the original face image and its mirror image for face recognition}, journal = {Neurocomputing}, volume = {131}, pages = {191--199}, year = {2014}, url = {https://doi.org/10.1016/j.neucom.2013.10.025}, doi = {10.1016/J.NEUCOM.2013.10.025}, timestamp = {Mon, 14 Feb 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/XuLYZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/isci/Zhang014, author = {David Zhang and Lei Zhang}, title = {Special issue on "New sensing and processing technologies for hand-based biometrics authentication"}, journal = {Inf. Sci.}, volume = {268}, pages = {1--2}, year = {2014}, url = {https://doi.org/10.1016/j.ins.2014.03.001}, doi = {10.1016/J.INS.2014.03.001}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/isci/Zhang014.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nca/ZhangWCZWL14, author = {Hongzhi Zhang and Faqiang Wang and Yan Chen and David Dapeng Zhang and Kuanquan Wang and Jingdong Liu}, title = {Combination of linear regression classification and collaborative representation classification}, journal = {Neural Comput. Appl.}, volume = {25}, number = {3-4}, pages = {833--838}, year = {2014}, url = {https://doi.org/10.1007/s00521-014-1564-6}, doi = {10.1007/S00521-014-1564-6}, timestamp = {Thu, 10 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nca/ZhangWCZWL14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/LiuZ14, author = {Feng Liu and David Zhang}, title = {3D fingerprint reconstruction system using feature correspondences and prior estimated finger model}, journal = {Pattern Recognit.}, volume = {47}, number = {1}, pages = {178--193}, year = {2014}, url = {https://doi.org/10.1016/j.patcog.2013.06.009}, doi = {10.1016/J.PATCOG.2013.06.009}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/LiuZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tap/ChenXZ14, author = {Fangmei Chen and Yong Xu and David Zhang}, title = {A New Hypothesis on Facial Beauty Perception}, journal = {{ACM} Trans. Appl. Percept.}, volume = {11}, number = {2}, pages = {8:1--8:20}, year = {2014}, url = {https://doi.org/10.1145/2622655}, doi = {10.1145/2622655}, timestamp = {Thu, 21 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tap/ChenXZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tbe/ZhangKZ14, author = {Bob Zhang and B. V. K. Vijaya Kumar and David Zhang}, title = {Detecting Diabetes Mellitus and Nonproliferative Diabetic Retinopathy Using Tongue Color, Texture, and Geometry Features}, journal = {{IEEE} Trans. Biomed. Eng.}, volume = {61}, number = {2}, pages = {491--501}, year = {2014}, url = {https://doi.org/10.1109/TBME.2013.2282625}, doi = {10.1109/TBME.2013.2282625}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tbe/ZhangKZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tbe/ZhangKZ14a, author = {Bob Zhang and B. V. K. Vijaya Kumar and David Zhang}, title = {Noninvasive Diabetes Mellitus Detection Using Facial Block Color With a Sparse Representation Classifier}, journal = {{IEEE} Trans. Biomed. Eng.}, volume = {61}, number = {4}, pages = {1027--1033}, year = {2014}, url = {https://doi.org/10.1109/TBME.2013.2292936}, doi = {10.1109/TBME.2013.2292936}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tbe/ZhangKZ14a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tbe/YanZWWL14, author = {Ke Yan and David Zhang and Darong Wu and Hua Wei and Guangming Lu}, title = {Design of a Breath Analysis System for Diabetes Screening and Blood Glucose Level Prediction}, journal = {{IEEE} Trans. Biomed. Eng.}, volume = {61}, number = {11}, pages = {2787--2795}, year = {2014}, url = {https://doi.org/10.1109/TBME.2014.2329753}, doi = {10.1109/TBME.2014.2329753}, timestamp = {Wed, 02 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tbe/YanZWWL14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/LaiXJZ14, author = {Zhihui Lai and Yong Xu and Zhong Jin and David Zhang}, title = {Human Gait Recognition via Sparse Discriminant Projection Learning}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {24}, number = {10}, pages = {1651--1662}, year = {2014}, url = {https://doi.org/10.1109/TCSVT.2014.2305495}, doi = {10.1109/TCSVT.2014.2305495}, timestamp = {Tue, 25 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcsv/LaiXJZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcyb/XuLYLZ14, author = {Yong Xu and Xuelong Li and Jian Yang and Zhihui Lai and David Zhang}, title = {Integrating Conventional and Inverse Representation for Face Recognition}, journal = {{IEEE} Trans. Cybern.}, volume = {44}, number = {10}, pages = {1738--1746}, year = {2014}, url = {https://doi.org/10.1109/TCYB.2013.2293391}, doi = {10.1109/TCYB.2013.2293391}, timestamp = {Mon, 14 Feb 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcyb/XuLYLZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tifs/ZhuZZSZ14, author = {Pengfei Zhu and Wangmeng Zuo and Lei Zhang and Simon Chi{-}Keung Shiu and David Zhang}, title = {Image Set-Based Collaborative Representation for Face Recognition}, journal = {{IEEE} Trans. Inf. Forensics Secur.}, volume = {9}, number = {7}, pages = {1120--1132}, year = {2014}, url = {https://doi.org/10.1109/TIFS.2014.2324277}, doi = {10.1109/TIFS.2014.2324277}, timestamp = {Mon, 04 Dec 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tifs/ZhuZZSZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/WangZZ14, author = {Peng Wang and Wangmeng Zuo and David Zhang}, title = {A Compound Pressure Signal Acquisition System for Multichannel Wrist Pulse Signal Analysis}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {63}, number = {6}, pages = {1556--1565}, year = {2014}, url = {https://doi.org/10.1109/TIM.2013.2267458}, doi = {10.1109/TIM.2013.2267458}, timestamp = {Tue, 17 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tim/WangZZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/Zuo0SZG14, author = {Wangmeng Zuo and Lei Zhang and Chunwei Song and David Zhang and Huijun Gao}, title = {Gradient Histogram Estimation and Preservation for Texture Enhanced Image Denoising}, journal = {{IEEE} Trans. Image Process.}, volume = {23}, number = {6}, pages = {2459--2472}, year = {2014}, url = {https://doi.org/10.1109/TIP.2014.2316423}, doi = {10.1109/TIP.2014.2316423}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/Zuo0SZG14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/FanXZYTLZ14, author = {Zizhu Fan and Yong Xu and Wangmeng Zuo and Jian Yang and Jinhui Tang and Zhihui Lai and David Zhang}, title = {Modified Principal Component Analysis: An Integration of Multiple Similarity Subspace Models}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {25}, number = {8}, pages = {1538--1552}, year = {2014}, url = {https://doi.org/10.1109/TNNLS.2013.2294492}, doi = {10.1109/TNNLS.2013.2294492}, timestamp = {Tue, 08 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tnn/FanXZYTLZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/LaiXCYZ14, author = {Zhihui Lai and Yong Xu and Qingcai Chen and Jian Yang and David Zhang}, title = {Multilinear Sparse Principal Component Analysis}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {25}, number = {10}, pages = {1942--1950}, year = {2014}, url = {https://doi.org/10.1109/TNNLS.2013.2297381}, doi = {10.1109/TNNLS.2013.2297381}, timestamp = {Mon, 09 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tnn/LaiXCYZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/NappiPTZ14, author = {Michele Nappi and Vincenzo Piuri and Tieniu Tan and David Zhang}, title = {Introduction to the Special Section on Biometric Systems and Applications}, journal = {{IEEE} Trans. Syst. Man Cybern. Syst.}, volume = {44}, number = {11}, pages = {1457--1460}, year = {2014}, url = {https://doi.org/10.1109/TSMC.2014.2337851}, doi = {10.1109/TSMC.2014.2337851}, timestamp = {Wed, 20 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/NappiPTZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ccpr/ChenZRZZ14, author = {Li Chen and Hongzhi Zhang and Dongwei Ren and David Zhang and Wangmeng Zuo}, editor = {Shutao Li and Chenglin Liu and Yaonan Wang}, title = {Fast Augmented Lagrangian Method for Image Smoothing with Hyper-Laplacian Gradient Prior}, booktitle = {Pattern Recognition - 6th Chinese Conference, {CCPR} 2014, Changsha, China, November 17-19, 2014. Proceedings, Part {II}}, series = {Communications in Computer and Information Science}, volume = {484}, pages = {12--21}, publisher = {Springer}, year = {2014}, url = {https://doi.org/10.1007/978-3-662-45643-9\_2}, doi = {10.1007/978-3-662-45643-9\_2}, timestamp = {Sat, 16 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ccpr/ChenZRZZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eccv/ZhangZLZY14, author = {Kaihua Zhang and Lei Zhang and Qingshan Liu and David Zhang and Ming{-}Hsuan Yang}, editor = {David J. Fleet and Tom{\'{a}}s Pajdla and Bernt Schiele and Tinne Tuytelaars}, title = {Fast Visual Tracking via Dense Spatio-temporal Context Learning}, booktitle = {Computer Vision - {ECCV} 2014 - 13th European Conference, Zurich, Switzerland, September 6-12, 2014, Proceedings, Part {V}}, series = {Lecture Notes in Computer Science}, volume = {8693}, pages = {127--141}, publisher = {Springer}, year = {2014}, url = {https://doi.org/10.1007/978-3-319-10602-1\_9}, doi = {10.1007/978-3-319-10602-1\_9}, timestamp = {Sat, 30 Sep 2023 09:39:19 +0200}, biburl = {https://dblp.org/rec/conf/eccv/ZhangZLZY14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/embc/YanZ14, author = {Ke Yan and David Zhang}, title = {Blood glucose prediction by breath analysis system with feature selection and model fusion}, booktitle = {36th Annual International Conference of the {IEEE} Engineering in Medicine and Biology Society, {EMBC} 2014, Chicago, IL, USA, August 26-30, 2014}, pages = {6406--6409}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1109/EMBC.2014.6945094}, doi = {10.1109/EMBC.2014.6945094}, timestamp = {Wed, 16 Oct 2019 14:14:50 +0200}, biburl = {https://dblp.org/rec/conf/embc/YanZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/medbiometrics/MaHLLZ14, author = {Lin Ma and Ying He and Haifeng Li and Naimin Li and David Zhang}, title = {A {CGA-MRF} Hybrid Method for Iris Texture Analysis and Modeling}, booktitle = {2014 International Conference on Medical Biometrics, Shenzhen, Guangdong, China, May 30 - June 1, 2014}, pages = {1--6}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1109/ICMB.2014.8}, doi = {10.1109/ICMB.2014.8}, timestamp = {Wed, 16 Oct 2019 14:14:49 +0200}, biburl = {https://dblp.org/rec/conf/medbiometrics/MaHLLZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/medbiometrics/WangHZZZ14, author = {Peng Wang and Shanpeng Hou and Hongzhi Zhang and Wangmeng Zuo and David Zhang}, title = {Wrist Pulse Diagnosis Using Complex Network}, booktitle = {2014 International Conference on Medical Biometrics, Shenzhen, Guangdong, China, May 30 - June 1, 2014}, pages = {15--20}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1109/ICMB.2014.10}, doi = {10.1109/ICMB.2014.10}, timestamp = {Tue, 17 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/medbiometrics/WangHZZZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/medbiometrics/YanZ14, author = {Ke Yan and David Zhang}, title = {Sensor Evaluation in a Breath Analysis System}, booktitle = {2014 International Conference on Medical Biometrics, Shenzhen, Guangdong, China, May 30 - June 1, 2014}, pages = {35--40}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1109/ICMB.2014.14}, doi = {10.1109/ICMB.2014.14}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/medbiometrics/YanZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/medbiometrics/WangZC14, author = {Dimin Wang and David Zhang and Juliana C. N. Chan}, title = {Feature Extraction of Radial Arterial Pulse}, booktitle = {2014 International Conference on Medical Biometrics, Shenzhen, Guangdong, China, May 30 - June 1, 2014}, pages = {41--46}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1109/ICMB.2014.15}, doi = {10.1109/ICMB.2014.15}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/medbiometrics/WangZC14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/medbiometrics/ChenZ14, author = {Fangmei Chen and David Zhang}, title = {Evaluation of the Putative Ratio Rules for Facial Beauty Indexing}, booktitle = {2014 International Conference on Medical Biometrics, Shenzhen, Guangdong, China, May 30 - June 1, 2014}, pages = {181--188}, publisher = {{IEEE}}, year = {2014}, url = {https://doi.org/10.1109/ICMB.2014.38}, doi = {10.1109/ICMB.2014.38}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/medbiometrics/ChenZ14.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ejasp/CuiZZLZ13, author = {Zhenchao Cui and Hongzhi Zhang and David Zhang and Naimin Li and Wangmeng Zuo}, title = {Fast marching over the 2D Gabor magnitude domain for tongue body segmentation}, journal = {{EURASIP} J. Adv. Signal Process.}, volume = {2013}, pages = {190}, year = {2013}, url = {https://doi.org/10.1186/1687-6180-2013-190}, doi = {10.1186/1687-6180-2013-190}, timestamp = {Thu, 12 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ejasp/CuiZZLZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/WangZGZ13, author = {Xingzheng Wang and Bob Zhang and Zhenhua Guo and David Zhang}, title = {Facial image medical analysis system using quantitative chromatic feature}, journal = {Expert Syst. Appl.}, volume = {40}, number = {9}, pages = {3738--3746}, year = {2013}, url = {https://doi.org/10.1016/j.eswa.2012.12.079}, doi = {10.1016/J.ESWA.2012.12.079}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/eswa/WangZGZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/WangZ13, author = {Xingzheng Wang and David Zhang}, title = {A high quality color imaging system for computerized tongue image analysis}, journal = {Expert Syst. Appl.}, volume = {40}, number = {15}, pages = {5854--5866}, year = {2013}, url = {https://doi.org/10.1016/j.eswa.2013.04.031}, doi = {10.1016/J.ESWA.2013.04.031}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/eswa/WangZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/XuFQZY13, author = {Yong Xu and Zizhu Fan and Minna Qiu and David Zhang and Jing{-}Yu Yang}, title = {A sparse representation method of bimodal biometrics and palmprint recognition experiments}, journal = {Neurocomputing}, volume = {103}, pages = {164--171}, year = {2013}, url = {https://doi.org/10.1016/j.neucom.2012.08.038}, doi = {10.1016/J.NEUCOM.2012.08.038}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijon/XuFQZY13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/GuoLZYZL13, author = {Zhenhua Guo and Qin Li and Lin Zhang and Jane You and David Zhang and Wenhuang Liu}, title = {Is local dominant orientation necessary for the classification of rotation invariant texture?}, journal = {Neurocomputing}, volume = {116}, pages = {182--191}, year = {2013}, url = {https://doi.org/10.1016/j.neucom.2011.11.038}, doi = {10.1016/J.NEUCOM.2011.11.038}, timestamp = {Fri, 30 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/GuoLZYZL13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/isci/ZhangWKYZ13, author = {Bob Zhang and Xingzheng Wang and Fakhri Karray and Zhimin Yang and David Zhang}, title = {Computerized facial diagnosis using both color and texture features}, journal = {Inf. Sci.}, volume = {221}, pages = {49--59}, year = {2013}, url = {https://doi.org/10.1016/j.ins.2012.09.011}, doi = {10.1016/J.INS.2012.09.011}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/isci/ZhangWKYZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/isci/XuZFZML13, author = {Yong Xu and Qi Zhu and Zizhu Fan and David Zhang and Jian{-}Xun Mi and Zhihui Lai}, title = {Using the idea of the sparse representation to perform coarse-to-fine face recognition}, journal = {Inf. Sci.}, volume = {238}, pages = {138--148}, year = {2013}, url = {https://doi.org/10.1016/j.ins.2013.02.051}, doi = {10.1016/J.INS.2013.02.051}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/isci/XuZFZML13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/PengZZ13, author = {Bo Peng and Lei Zhang and David Zhang}, title = {A survey of graph theoretical approaches to image segmentation}, journal = {Pattern Recognit.}, volume = {46}, number = {3}, pages = {1020--1038}, year = {2013}, url = {https://doi.org/10.1016/j.patcog.2012.09.015}, doi = {10.1016/J.PATCOG.2012.09.015}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/PengZZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ChenYZL13, author = {Xiaobo Chen and Jian Yang and David Zhang and Jun Liang}, title = {Complete large margin linear discriminant analysis using mathematical programming approach}, journal = {Pattern Recognit.}, volume = {46}, number = {6}, pages = {1579--1594}, year = {2013}, url = {https://doi.org/10.1016/j.patcog.2012.11.019}, doi = {10.1016/J.PATCOG.2012.11.019}, timestamp = {Wed, 26 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/ChenYZL13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/YangZSZ13, author = {Meng Yang and Lei Zhang and Simon C. K. Shiu and David Zhang}, title = {Gabor feature based robust representation and classification for face recognition with Gabor occlusion dictionary}, journal = {Pattern Recognit.}, volume = {46}, number = {7}, pages = {1865--1878}, year = {2013}, url = {https://doi.org/10.1016/j.patcog.2012.06.022}, doi = {10.1016/J.PATCOG.2012.06.022}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/YangZSZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/FengYZLZ13, author = {Zhizhao Feng and Meng Yang and Lei Zhang and Yan Liu and David Zhang}, title = {Joint discriminative dimensionality reduction and dictionary learning for face recognition}, journal = {Pattern Recognit.}, volume = {46}, number = {8}, pages = {2134--2143}, year = {2013}, url = {https://doi.org/10.1016/j.patcog.2013.01.016}, doi = {10.1016/J.PATCOG.2013.01.016}, timestamp = {Fri, 16 Apr 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/FengYZLZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/RenZZLZ13, author = {Dongwei Ren and Wangmeng Zuo and Xiaofei Zhao and Zhouchen Lin and David Zhang}, title = {Fast gradient vector flow computation based on augmented Lagrangian method}, journal = {Pattern Recognit. Lett.}, volume = {34}, number = {2}, pages = {219--225}, year = {2013}, url = {https://doi.org/10.1016/j.patrec.2012.09.017}, doi = {10.1016/J.PATREC.2012.09.017}, timestamp = {Tue, 29 Dec 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/prl/RenZZLZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/Ning0ZY13, author = {Jifeng Ning and Lei Zhang and David Zhang and Wei Yu}, title = {Joint Registration and Active Contour Segmentation for Object Tracking}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {23}, number = {9}, pages = {1589--1597}, year = {2013}, url = {https://doi.org/10.1109/TCSVT.2013.2254931}, doi = {10.1109/TCSVT.2013.2254931}, timestamp = {Tue, 25 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcsv/Ning0ZY13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tifs/GongZSY13, author = {Yazhuo Gong and David Zhang and Pengfei Shi and Jingqi Yan}, title = {An Optimized Wavelength Band Selection for Heavily Pigmented Iris Recognition}, journal = {{IEEE} Trans. Inf. Forensics Secur.}, volume = {8}, number = {1}, pages = {64--75}, year = {2013}, url = {https://doi.org/10.1109/TIFS.2012.2223682}, doi = {10.1109/TIFS.2012.2223682}, timestamp = {Thu, 06 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tifs/GongZSY13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tifs/LiuZG13, author = {Feng Liu and David Zhang and Zhenhua Guo}, title = {Distal-Interphalangeal-Crease-Based User Authentication System}, journal = {{IEEE} Trans. Inf. Forensics Secur.}, volume = {8}, number = {9}, pages = {1446--1455}, year = {2013}, url = {https://doi.org/10.1109/TIFS.2013.2272787}, doi = {10.1109/TIFS.2013.2272787}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tifs/LiuZG13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/LiuZSL13, author = {Feng Liu and David Zhang and Changjiang Song and Guangming Lu}, title = {Touchless Multiview Fingerprint Acquisition and Mosaicking}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {62}, number = {9}, pages = {2492--2502}, year = {2013}, url = {https://doi.org/10.1109/TIM.2013.2258248}, doi = {10.1109/TIM.2013.2258248}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tim/LiuZSL13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/ZhangZSZ13, author = {Kaihua Zhang and Lei Zhang and Huihui Song and David Zhang}, title = {Reinitialization-Free Level Set Evolution via Reaction Diffusion}, journal = {{IEEE} Trans. Image Process.}, volume = {22}, number = {1}, pages = {258--271}, year = {2013}, url = {https://doi.org/10.1109/TIP.2012.2214046}, doi = {10.1109/TIP.2012.2214046}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/ZhangZSZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/YangZYZ13, author = {Meng Yang and Lei Zhang and Jian Yang and David Zhang}, title = {Regularized Robust Coding for Face Recognition}, journal = {{IEEE} Trans. Image Process.}, volume = {22}, number = {5}, pages = {1753--1766}, year = {2013}, url = {https://doi.org/10.1109/TIP.2012.2235849}, doi = {10.1109/TIP.2012.2235849}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/YangZYZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/LaiXYTZ13, author = {Zhihui Lai and Yong Xu and Jian Yang and Jinhui Tang and David Zhang}, title = {Sparse Tensor Discriminant Analysis}, journal = {{IEEE} Trans. Image Process.}, volume = {22}, number = {10}, pages = {3904--3915}, year = {2013}, url = {https://doi.org/10.1109/TIP.2013.2264678}, doi = {10.1109/TIP.2013.2264678}, timestamp = {Tue, 08 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tip/LaiXYTZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/GaoZYZZ13, author = {Guangwei Gao and Lei Zhang and Jian Yang and Lin Zhang and David Zhang}, title = {Reconstruction Based Finger-Knuckle-Print Verification With Score Level Adaptive Binary Fusion}, journal = {{IEEE} Trans. Image Process.}, volume = {22}, number = {12}, pages = {5050--5062}, year = {2013}, url = {https://doi.org/10.1109/TIP.2013.2281429}, doi = {10.1109/TIP.2013.2281429}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/GaoZYZZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/WangZYWZ13, author = {Xingzheng Wang and Bob Zhang and Zhimin Yang and Haoqian Wang and David Zhang}, title = {Statistical Analysis of Tongue Images for Feature Extraction and Diagnostics}, journal = {{IEEE} Trans. Image Process.}, volume = {22}, number = {12}, pages = {5336--5347}, year = {2013}, url = {https://doi.org/10.1109/TIP.2013.2284070}, doi = {10.1109/TIP.2013.2284070}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/WangZYWZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/titb/MaZLCZW13, author = {Lin Ma and David Zhang and Naimin Li and Yan Cai and Wangmeng Zuo and Kuanquan Wang}, title = {Iris-Based Medical Analysis by Geometric Deformation Features}, journal = {{IEEE} J. Biomed. Health Informatics}, volume = {17}, number = {1}, pages = {223--231}, year = {2013}, url = {https://doi.org/10.1109/TITB.2012.2222655}, doi = {10.1109/TITB.2012.2222655}, timestamp = {Fri, 24 Feb 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/titb/MaZLCZW13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/titb/WangZ13, author = {Xingzheng Wang and David Zhang}, title = {A New Tongue Colorchecker Design by Space Representation for Precise Correction}, journal = {{IEEE} J. Biomed. Health Informatics}, volume = {17}, number = {2}, pages = {381--391}, year = {2013}, url = {https://doi.org/10.1109/TITB.2012.2226736}, doi = {10.1109/TITB.2012.2226736}, timestamp = {Fri, 13 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/titb/WangZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/YangZSZ13, author = {Meng Yang and Lei Zhang and Simon Chi{-}Keung Shiu and David Zhang}, title = {Robust Kernel Representation With Statistical Local Features for Face Recognition}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {24}, number = {6}, pages = {900--912}, year = {2013}, url = {https://doi.org/10.1109/TNNLS.2013.2245340}, doi = {10.1109/TNNLS.2013.2245340}, timestamp = {Mon, 09 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tnn/YangZSZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/Zhang0QZ13, author = {Bob Zhang and Wei Li and Pei Qing and David Zhang}, title = {Palm-Print Classification by Global Features}, journal = {{IEEE} Trans. Syst. Man Cybern. Syst.}, volume = {43}, number = {2}, pages = {370--378}, year = {2013}, url = {https://doi.org/10.1109/TSMCA.2012.2201465}, doi = {10.1109/TSMCA.2012.2201465}, timestamp = {Sun, 13 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/Zhang0QZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/GongZSY13, author = {Yazhuo Gong and David Zhang and Pengfei Shi and Jingqi Yan}, title = {Handheld System Design for Dual-Eye Multispectral Iris Capture With One Camera}, journal = {{IEEE} Trans. Syst. Man Cybern. Syst.}, volume = {43}, number = {5}, pages = {1154--1166}, year = {2013}, url = {https://doi.org/10.1109/TSMCA.2012.2227958}, doi = {10.1109/TSMCA.2012.2227958}, timestamp = {Wed, 20 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/GongZSY13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/bmei/WangZZZW13, author = {Peng Wang and Hongzhi Zhang and Wangmeng Zuo and David Zhang and Qiufeng Wu}, editor = {Jean X. Gao and Dongrong Xu and Xiaoyan Sun and Yingfei Wu}, title = {A comparison of three types of pulse signals: Physical meaning and diagnosis performance}, booktitle = {6th International Conference on Biomedical Engineering and Informatics, {BMEI} 2013, Hangzhou, China, December 16-18, 2013}, pages = {352--357}, publisher = {{IEEE}}, year = {2013}, url = {https://doi.org/10.1109/BMEI.2013.6746962}, doi = {10.1109/BMEI.2013.6746962}, timestamp = {Tue, 17 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/bmei/WangZZZW13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/ZuoZSZ13, author = {Wangmeng Zuo and Lei Zhang and Chunwei Song and David Zhang}, title = {Texture Enhanced Image Denoising via Gradient Histogram Preservation}, booktitle = {2013 {IEEE} Conference on Computer Vision and Pattern Recognition, Portland, OR, USA, June 23-28, 2013}, pages = {1203--1210}, publisher = {{IEEE} Computer Society}, year = {2013}, url = {https://doi.org/10.1109/CVPR.2013.159}, doi = {10.1109/CVPR.2013.159}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/ZuoZSZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccv/ZuoM0FZ13, author = {Wangmeng Zuo and Deyu Meng and Lei Zhang and Xiangchu Feng and David Zhang}, title = {A Generalized Iterated Shrinkage Algorithm for Non-convex Sparse Coding}, booktitle = {{IEEE} International Conference on Computer Vision, {ICCV} 2013, Sydney, Australia, December 1-8, 2013}, pages = {217--224}, publisher = {{IEEE} Computer Society}, year = {2013}, url = {https://doi.org/10.1109/ICCV.2013.34}, doi = {10.1109/ICCV.2013.34}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iccv/ZuoM0FZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccv/ZhuZZZ13, author = {Pengfei Zhu and Lei Zhang and Wangmeng Zuo and David Zhang}, title = {From Point to Set: Extend the Learning of Distance Metrics}, booktitle = {{IEEE} International Conference on Computer Vision, {ICCV} 2013, Sydney, Australia, December 1-8, 2013}, pages = {2664--2671}, publisher = {{IEEE} Computer Society}, year = {2013}, url = {https://doi.org/10.1109/ICCV.2013.331}, doi = {10.1109/ICCV.2013.331}, timestamp = {Mon, 04 Dec 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iccv/ZhuZZZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iscide/RenZZZ13, author = {Dongwei Ren and Wangmeng Zuo and Hongzhi Zhang and David Zhang}, editor = {Changyin Sun and Fang Fang and Zhi{-}Hua Zhou and Wankou Yang and Zhiyong Liu}, title = {A Derivative Augmented Lagrangian Method for Fast Total Variation Based Image Restoration}, booktitle = {Intelligence Science and Big Data Engineering - 4th International Conference, IScIDE 2013, Beijing, China, July 31 - August 2, 2013, Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {8261}, pages = {287--294}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-42057-3\_37}, doi = {10.1007/978-3-642-42057-3\_37}, timestamp = {Tue, 14 May 2019 10:00:39 +0200}, biburl = {https://dblp.org/rec/conf/iscide/RenZZZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iscide/CuiZZZ13, author = {Zhenchao Cui and Wangmeng Zuo and Hongzhi Zhang and David Zhang}, editor = {Changyin Sun and Fang Fang and Zhi{-}Hua Zhou and Wankou Yang and Zhiyong Liu}, title = {Automated Tongue Segmentation Based on 2D Gabor Filters and Fast Marching}, booktitle = {Intelligence Science and Big Data Engineering - 4th International Conference, IScIDE 2013, Beijing, China, July 31 - August 2, 2013, Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {8261}, pages = {328--335}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-3-642-42057-3\_42}, doi = {10.1007/978-3-642-42057-3\_42}, timestamp = {Sat, 16 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iscide/CuiZZZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sigmod/QiaoSDQSGCSZABBGGIJLPRSSSSTTWZ13, author = {Lin Qiao and Kapil Surlaker and Shirshanka Das and Tom Quiggle and Bob Schulman and Bhaskar Ghosh and Antony Curtis and Oliver Seeliger and Zhen Zhang and Aditya Auradkar and Chris Beaver and Gregory Brandt and Mihir Gandhi and Kishore Gopalakrishna and Wai Ip and Swaroop Jagadish and Shi Lu and Alexander Pachev and Aditya Ramesh and Abraham Sebastian and Rupa Shanbhag and Subbu Subramaniam and Yun Sun and Sajid Topiwala and Cuong Tran and Jemiah Westerman and David Zhang}, editor = {Kenneth A. Ross and Divesh Srivastava and Dimitris Papadias}, title = {On brewing fresh espresso: LinkedIn's distributed data serving platform}, booktitle = {Proceedings of the {ACM} {SIGMOD} International Conference on Management of Data, {SIGMOD} 2013, New York, NY, USA, June 22-27, 2013}, pages = {1135--1146}, publisher = {{ACM}}, year = {2013}, url = {https://doi.org/10.1145/2463676.2465298}, doi = {10.1145/2463676.2465298}, timestamp = {Wed, 28 Sep 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/sigmod/QiaoSDQSGCSZABBGGIJLPRSSSSTTWZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:series/acvpr/KongZK13, author = {Adams Wai{-}Kin Kong and David Zhang and Mohamed Kamel}, editor = {Mark James Burge and Kevin W. Bowyer}, title = {An Introduction to the IrisCode Theory}, booktitle = {Handbook of Iris Recognition}, series = {Advances in Computer Vision and Pattern Recognition}, pages = {321--336}, publisher = {Springer}, year = {2013}, url = {https://doi.org/10.1007/978-1-4471-4402-1\_16}, doi = {10.1007/978-1-4471-4402-1\_16}, timestamp = {Fri, 10 Jul 2020 09:25:44 +0200}, biburl = {https://dblp.org/rec/series/acvpr/KongZK13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1305-7053, author = {Kaihua Zhang and Lei Zhang and Kin{-}Man Lam and David Zhang}, title = {A Local Active Contour Model for Image Segmentation with Intensity Inhomogeneity}, journal = {CoRR}, volume = {abs/1305.7053}, year = {2013}, url = {http://arxiv.org/abs/1305.7053}, eprinttype = {arXiv}, eprint = {1305.7053}, timestamp = {Wed, 16 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1305-7053.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/ZhuZ0SZ13, author = {Pengfei Zhu and Wangmeng Zuo and Lei Zhang and Simon C. K. Shiu and David Zhang}, title = {Image Set based Collaborative Representation for Face Recognition}, journal = {CoRR}, volume = {abs/1308.6687}, year = {2013}, url = {http://arxiv.org/abs/1308.6687}, eprinttype = {arXiv}, eprint = {1308.6687}, timestamp = {Mon, 04 Dec 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/ZhuZ0SZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/WangZZMZ13, author = {Faqiang Wang and Wangmeng Zuo and Lei Zhang and Deyu Meng and David Zhang}, title = {A Kernel Classification Framework for Metric Learning}, journal = {CoRR}, volume = {abs/1309.5823}, year = {2013}, url = {http://arxiv.org/abs/1309.5823}, eprinttype = {arXiv}, eprint = {1309.5823}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/WangZZMZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/ZhangZYZ13, author = {Kaihua Zhang and Lei Zhang and Ming{-}Hsuan Yang and David Zhang}, title = {Fast Tracking via Spatio-Temporal Context Learning}, journal = {CoRR}, volume = {abs/1311.1939}, year = {2013}, url = {http://arxiv.org/abs/1311.1939}, eprinttype = {arXiv}, eprint = {1311.1939}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/ZhangZYZ13.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/csur/ZhangZY12, author = {David Zhang and Wangmeng Zuo and Feng Yue}, title = {A Comparative Study of Palmprint Recognition Algorithms}, journal = {{ACM} Comput. Surv.}, volume = {44}, number = {1}, pages = {2:1--2:37}, year = {2012}, url = {https://doi.org/10.1145/2071389.2071391}, doi = {10.1145/2071389.2071391}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/csur/ZhangZY12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/LiYZ12, author = {Qin Li and Jane You and David Zhang}, title = {Vessel segmentation and width estimation in retinal images using multiscale production of matched filter responses}, journal = {Expert Syst. Appl.}, volume = {39}, number = {9}, pages = {7600--7610}, year = {2012}, url = {https://doi.org/10.1016/j.eswa.2011.12.046}, doi = {10.1016/J.ESWA.2011.12.046}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/eswa/LiYZ12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ieicet/LiuLJGZY12, author = {Qian Liu and Chao Lan and Xiao{-}Yuan Jing and Shi{-}Qiang Gao and David Zhang and Jing{-}Yu Yang}, title = {Sparsity Preserving Embedding with Manifold Learning and Discriminant Analysis}, journal = {{IEICE} Trans. Inf. Syst.}, volume = {95-D}, number = {1}, pages = {271--274}, year = {2012}, url = {https://doi.org/10.1587/transinf.E95.D.271}, doi = {10.1587/TRANSINF.E95.D.271}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ieicet/LiuLJGZY12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijprai/SongYZX12, author = {Fengxi Song and Jane You and David Zhang and Yong Xu}, title = {Impact of Full Rank Principal Component Analysis on Classification Algorithms for Face Recognition}, journal = {Int. J. Pattern Recognit. Artif. Intell.}, volume = {26}, number = {3}, year = {2012}, url = {https://doi.org/10.1142/S0218001412560058}, doi = {10.1142/S0218001412560058}, timestamp = {Mon, 11 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijprai/SongYZX12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nca/NingZWY12, author = {Jifeng Ning and David Zhang and Chengke Wu and Feng Yue}, title = {Automatic tongue image segmentation based on gradient vector flow and region merging}, journal = {Neural Comput. Appl.}, volume = {21}, number = {8}, pages = {1819--1826}, year = {2012}, url = {https://doi.org/10.1007/s00521-010-0484-3}, doi = {10.1007/S00521-010-0484-3}, timestamp = {Thu, 10 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nca/NingZWY12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nca/GuoLYZL12, author = {Zhenhua Guo and Qin Li and Jane You and David Zhang and Wenhuang Liu}, title = {Local directional derivative pattern for rotation invariant texture classification}, journal = {Neural Comput. Appl.}, volume = {21}, number = {8}, pages = {1893--1904}, year = {2012}, url = {https://doi.org/10.1007/s00521-011-0586-6}, doi = {10.1007/S00521-011-0586-6}, timestamp = {Thu, 10 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nca/GuoLYZL12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ZhangZZG12, author = {Lin Zhang and Lei Zhang and David Zhang and Zhenhua Guo}, title = {Phase congruency induced local features for finger-knuckle-print recognition}, journal = {Pattern Recognit.}, volume = {45}, number = {7}, pages = {2522--2531}, year = {2012}, url = {https://doi.org/10.1016/j.patcog.2012.01.017}, doi = {10.1016/J.PATCOG.2012.01.017}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/ZhangZZG12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/HuJZGS12, author = {Rong{-}Xiang Hu and Wei Jia and David Zhang and Jie Gui and Liang{-}Tu Song}, title = {Hand shape recognition based on coherent distance shape contexts}, journal = {Pattern Recognit.}, volume = {45}, number = {9}, pages = {3348--3359}, year = {2012}, url = {https://doi.org/10.1016/j.patcog.2012.02.018}, doi = {10.1016/J.PATCOG.2012.02.018}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/HuJZGS12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/JingLZLY12, author = {Xiao{-}Yuan Jing and Sheng Li and David Zhang and Chao Lan and Jingyu Yang}, title = {Optimal subset-division based discrimination and its kernelization for face and palmprint recognition}, journal = {Pattern Recognit.}, volume = {45}, number = {10}, pages = {3590--3602}, year = {2012}, url = {https://doi.org/10.1016/j.patcog.2012.04.001}, doi = {10.1016/J.PATCOG.2012.04.001}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/JingLZLY12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/JingLZYLLZ12, author = {Xiao{-}Yuan Jing and Chao Lan and David Zhang and Jing{-}Yu Yang and Min Li and Sheng Li and Songhao Zhu}, title = {Face feature extraction and recognition based on discriminant subclass-center manifold preserving projection}, journal = {Pattern Recognit. Lett.}, volume = {33}, number = {6}, pages = {709--717}, year = {2012}, url = {https://doi.org/10.1016/j.patrec.2012.01.001}, doi = {10.1016/J.PATREC.2012.01.001}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/prl/JingLZYLLZ12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sensors/Xie0YZQ12, author = {Jin Xie and Lei Zhang and Jane You and David Zhang and Xiaofeng Qu}, title = {A Study of Hand Back Skin Texture Patterns for Personal Identification and Gender Classification}, journal = {Sensors}, volume = {12}, number = {7}, pages = {8691--8709}, year = {2012}, url = {https://doi.org/10.3390/s120708691}, doi = {10.3390/S120708691}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/sensors/Xie0YZQ12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/JingLZYY12, author = {Xiao{-}Yuan Jing and Sheng Li and David Zhang and Jian Yang and Jing{-}Yu Yang}, title = {Supervised and Unsupervised Parallel Subspace Learning for Large-Scale Image Recognition}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {22}, number = {10}, pages = {1497--1511}, year = {2012}, url = {https://doi.org/10.1109/TCSVT.2012.2202079}, doi = {10.1109/TCSVT.2012.2202079}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcsv/JingLZYY12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tfs/HuPZZSGY12, author = {Qinghua Hu and Weiwei Pan and Lei Zhang and David Zhang and Yanping Song and Maozu Guo and Daren Yu}, title = {Feature Selection for Monotonic Classification}, journal = {{IEEE} Trans. Fuzzy Syst.}, volume = {20}, number = {1}, pages = {69--81}, year = {2012}, url = {https://doi.org/10.1109/TFUZZ.2011.2167235}, doi = {10.1109/TFUZZ.2011.2167235}, timestamp = {Thu, 12 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tfs/HuPZZSGY12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tfs/HuZAZY12, author = {Qinghua Hu and Lei Zhang and Shuang An and David Zhang and Daren Yu}, title = {On Robust Fuzzy Rough Set Models}, journal = {{IEEE} Trans. Fuzzy Syst.}, volume = {20}, number = {4}, pages = {636--651}, year = {2012}, url = {https://doi.org/10.1109/TFUZZ.2011.2181180}, doi = {10.1109/TFUZZ.2011.2181180}, timestamp = {Tue, 12 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tfs/HuZAZY12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tifs/GuoZZL12, author = {Zhenhua Guo and David Zhang and Lei Zhang and Wenhuang Liu}, title = {Feature Band Selection for Online Multispectral Palmprint Recognition}, journal = {{IEEE} Trans. Inf. Forensics Secur.}, volume = {7}, number = {3}, pages = {1094--1099}, year = {2012}, url = {https://doi.org/10.1109/TIFS.2012.2189206}, doi = {10.1109/TIFS.2012.2189206}, timestamp = {Thu, 06 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tifs/GuoZZL12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tifs/YangZSZ12, author = {Meng Yang and Lei Zhang and Simon Chi{-}Keung Shiu and David Zhang}, title = {Monogenic Binary Coding: An Efficient Local Feature Extraction Approach to Face Recognition}, journal = {{IEEE} Trans. Inf. Forensics Secur.}, volume = {7}, number = {6}, pages = {1738--1751}, year = {2012}, url = {https://doi.org/10.1109/TIFS.2012.2217332}, doi = {10.1109/TIFS.2012.2217332}, timestamp = {Thu, 06 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tifs/YangZSZ12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/GongZSY12, author = {Yazhuo Gong and David Zhang and Pengfei Shi and Jingqi Yan}, title = {High-Speed Multispectral Iris Capture System Design}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {61}, number = {7}, pages = {1966--1978}, year = {2012}, url = {https://doi.org/10.1109/TIM.2012.2183036}, doi = {10.1109/TIM.2012.2183036}, timestamp = {Mon, 08 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tim/GongZSY12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/LianZZ12, author = {Wei Lian and Lei Zhang and David Zhang}, title = {Rotation-Invariant Nonrigid Point Set Matching in Cluttered Scenes}, journal = {{IEEE} Trans. Image Process.}, volume = {21}, number = {5}, pages = {2786--2797}, year = {2012}, url = {https://doi.org/10.1109/TIP.2012.2186309}, doi = {10.1109/TIP.2012.2186309}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/LianZZ12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/titb/LiuZZLZ12, author = {Lei Liu and Wangmeng Zuo and David Zhang and Naimin Li and Hongzhi Zhang}, title = {Combination of Heterogeneous Features for Wrist Pulse Blood Flow Signal Diagnosis via Multiple Kernel Learning}, journal = {{IEEE} Trans. Inf. Technol. Biomed.}, volume = {16}, number = {4}, pages = {598--606}, year = {2012}, url = {https://doi.org/10.1109/TITB.2012.2195188}, doi = {10.1109/TITB.2012.2195188}, timestamp = {Wed, 13 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/titb/LiuZZLZ12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tkde/HuCZZGY12, author = {Qinghua Hu and Xunjian Che and Lei Zhang and David Zhang and Maozu Guo and Daren Yu}, title = {Rank Entropy-Based Decision Trees for Monotonic Classification}, journal = {{IEEE} Trans. Knowl. Data Eng.}, volume = {24}, number = {11}, pages = {2052--2064}, year = {2012}, url = {https://doi.org/10.1109/TKDE.2011.149}, doi = {10.1109/TKDE.2011.149}, timestamp = {Thu, 12 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tkde/HuCZZGY12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/LiZLL12, author = {Wei Li and David Zhang and Guangming Lu and Nan Luo}, title = {A Novel 3-D Palmprint Acquisition System}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {A}}, volume = {42}, number = {2}, pages = {443--452}, year = {2012}, url = {https://doi.org/10.1109/TSMCA.2011.2164066}, doi = {10.1109/TSMCA.2011.2164066}, timestamp = {Mon, 25 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/LiZLL12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/bmei/WangZZZ12, author = {Peng Wang and Wangmeng Zuo and Hongzhi Zhang and David Zhang}, editor = {Tianqi Zhang}, title = {Design and implementation of a multi-channel pulse signal acquisition system}, booktitle = {5th International Conference on BioMedical Engineering and Informatics, {BMEI} 2012, Chongqing, China, October 16-18, 2012}, pages = {1063--1067}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/BMEI.2012.6512884}, doi = {10.1109/BMEI.2012.6512884}, timestamp = {Tue, 17 Nov 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/bmei/WangZZZ12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ccpr/RenZZZZ12, author = {Dongwei Ren and Wangmeng Zuo and Xiaofei Zhao and Hongzhi Zhang and David Zhang}, editor = {Cheng{-}Lin Liu and Changshui Zhang and Liang Wang}, title = {An Algorithm Based on Augmented Lagrangian Method for Generalized Gradient Vector Flow Computation}, booktitle = {Pattern Recognition - Chinese Conference, {CCPR} 2012, Beijing, China, September 24-26, 2012. Proceedings}, series = {Communications in Computer and Information Science}, volume = {321}, pages = {170--177}, publisher = {Springer}, year = {2012}, url = {https://doi.org/10.1007/978-3-642-33506-8\_22}, doi = {10.1007/978-3-642-33506-8\_22}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ccpr/RenZZZZ12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cloud/DasBSGVNZGWGSTPSS12, author = {Shirshanka Das and Chavdar Botev and Kapil Surlaker and Bhaskar Ghosh and Balaji Varadarajan and Sunil Nagaraj and David Zhang and Lei Gao and Jemiah Westerman and Phanindra Ganti and Boris Shkolnik and Sajid Topiwala and Alexander Pachev and Naveen Somasundaram and Subbu Subramaniam}, editor = {Michael J. Carey and Steven Hand}, title = {All aboard the Databus!: Linkedin's scalable consistent change data capture platform}, booktitle = {{ACM} Symposium on Cloud Computing, {SOCC} '12, San Jose, CA, USA, October 14-17, 2012}, pages = {18}, publisher = {{ACM}}, year = {2012}, url = {https://doi.org/10.1145/2391229.2391247}, doi = {10.1145/2391229.2391247}, timestamp = {Mon, 20 Feb 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cloud/DasBSGVNZGWGSTPSS12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/YangZZW12, author = {Meng Yang and Lei Zhang and David Zhang and Shenlong Wang}, title = {Relaxed collaborative representation for pattern classification}, booktitle = {2012 {IEEE} Conference on Computer Vision and Pattern Recognition, Providence, RI, USA, June 16-21, 2012}, pages = {2224--2231}, publisher = {{IEEE} Computer Society}, year = {2012}, url = {https://doi.org/10.1109/CVPR.2012.6247931}, doi = {10.1109/CVPR.2012.6247931}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/YangZZW12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eccv/YangZZ12, author = {Meng Yang and Lei Zhang and David Zhang}, editor = {Andrew W. Fitzgibbon and Svetlana Lazebnik and Pietro Perona and Yoichi Sato and Cordelia Schmid}, title = {Efficient Misalignment-Robust Representation for Real-Time Face Recognition}, booktitle = {Computer Vision - {ECCV} 2012 - 12th European Conference on Computer Vision, Florence, Italy, October 7-13, 2012, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {7572}, pages = {850--863}, publisher = {Springer}, year = {2012}, url = {https://doi.org/10.1007/978-3-642-33718-5\_61}, doi = {10.1007/978-3-642-33718-5\_61}, timestamp = {Thu, 27 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/eccv/YangZZ12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icch/YanZ12, author = {Ke Yan and David Zhang}, title = {A novel breath analysis system for diabetes diagnosis}, booktitle = {International Conference on Computerized Healthcare, {ICCH} 2012, Hong Kong, China, December 17-18, 2012}, pages = {166--170}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/ICCH.2012.6724490}, doi = {10.1109/ICCH.2012.6724490}, timestamp = {Wed, 16 Oct 2019 14:14:48 +0200}, biburl = {https://dblp.org/rec/conf/icch/YanZ12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icch/WangZ12, author = {Dimin Wang and David Zhang}, title = {Analysis of pulse waveforms preprocessing}, booktitle = {International Conference on Computerized Healthcare, {ICCH} 2012, Hong Kong, China, December 17-18, 2012}, pages = {175--180}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/ICCH.2012.6724492}, doi = {10.1109/ICCH.2012.6724492}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icch/WangZ12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icde/AuradkarBDMFGGGGHKKKLNNPPQQRSSSSSSSSTTVWWZZ12, author = {Aditya Auradkar and Chavdar Botev and Shirshanka Das and Dave De Maagd and Alex Feinberg and Phanindra Ganti and Lei Gao and Bhaskar Ghosh and Kishore Gopalakrishna and Brendan Harris and Joel Koshy and Kevin Krawez and Jay Kreps and Shi Lu and Sunil Nagaraj and Neha Narkhede and Sasha Pachev and Igor Perisic and Lin Qiao and Tom Quiggle and Jun Rao and Bob Schulman and Abraham Sebastian and Oliver Seeliger and Adam Silberstein and Boris Shkolnik and Chinmay Soman and Roshan Sumbaly and Kapil Surlaker and Sajid Topiwala and Cuong Tran and Balaji Varadarajan and Jemiah Westerman and Zach White and David Zhang and Jason Zhang}, editor = {Anastasios Kementsietsidis and Marcos Antonio Vaz Salles}, title = {Data Infrastructure at LinkedIn}, booktitle = {{IEEE} 28th International Conference on Data Engineering {(ICDE} 2012), Washington, DC, {USA} (Arlington, Virginia), 1-5 April, 2012}, pages = {1370--1381}, publisher = {{IEEE} Computer Society}, year = {2012}, url = {https://doi.org/10.1109/ICDE.2012.147}, doi = {10.1109/ICDE.2012.147}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icde/AuradkarBDMFGGGGHKKKLNNPPQQRSSSSSSSSTTVWWZZ12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/ZhangZMZ12, author = {Lin Zhang and Lei Zhang and Xuanqin Mou and David Zhang}, title = {A comprehensive evaluation of full reference image quality assessment algorithms}, booktitle = {19th {IEEE} International Conference on Image Processing, {ICIP} 2012, Lake Buena Vista, Orlando, FL, USA, September 30 - October 3, 2012}, pages = {1477--1480}, publisher = {{IEEE}}, year = {2012}, url = {https://doi.org/10.1109/ICIP.2012.6467150}, doi = {10.1109/ICIP.2012.6467150}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/icip/ZhangZMZ12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ifip12/ZhangL12, author = {David Dapeng Zhang and Xi Liu}, editor = {Zhongzhi Shi and David B. Leake and Sunil Vadera}, title = {Ensemble of k-Labelset Classifiers for Multi-label Image Classification}, booktitle = {Intelligent Information Processing {VI} - 7th {IFIP} {TC} 12 International Conference, {IIP} 2012, Guilin, China, October 12-15, 2012. Proceedings}, series = {{IFIP} Advances in Information and Communication Technology}, volume = {385}, pages = {364--371}, publisher = {Springer}, year = {2012}, url = {https://doi.org/10.1007/978-3-642-32891-6\_45}, doi = {10.1007/978-3-642-32891-6\_45}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/ifip12/ZhangL12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iscide/LiuLZZZ12, author = {Lei Liu and Naimin Li and Wangmeng Zuo and David Zhang and Hongzhi Zhang}, editor = {Jian Yang and Fang Fang and Changyin Sun}, title = {Multiscale Sample Entropy Analysis of Wrist Pulse Blood Flow Signal for Disease Diagnosis}, booktitle = {Intelligent Science and Intelligent Data Engineering - Third Sino-foreign-interchange Workshop, IScIDE 2012, Nanjing, China, October 15-17, 2012. Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {7751}, pages = {475--482}, publisher = {Springer}, year = {2012}, url = {https://doi.org/10.1007/978-3-642-36669-7\_58}, doi = {10.1007/978-3-642-36669-7\_58}, timestamp = {Tue, 14 May 2019 10:00:39 +0200}, biburl = {https://dblp.org/rec/conf/iscide/LiuLZZZ12.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1202-4207, author = {Meng Yang and Lei Zhang and Jian Yang and David Zhang}, title = {Regularized Robust Coding for Face Recognition}, journal = {CoRR}, volume = {abs/1202.4207}, year = {2012}, url = {http://arxiv.org/abs/1202.4207}, eprinttype = {arXiv}, eprint = {1202.4207}, timestamp = {Wed, 15 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1202-4207.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1204-2358, author = {Lei Zhang and Meng Yang and Xiangchu Feng and Yi Ma and David Zhang}, title = {Collaborative Representation based Classification for Face Recognition}, journal = {CoRR}, volume = {abs/1204.2358}, year = {2012}, url = {http://arxiv.org/abs/1204.2358}, eprinttype = {arXiv}, eprint = {1204.2358}, timestamp = {Wed, 15 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/corr/abs-1204-2358.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/asc/LiZXL11, author = {Zuoyong Li and David Zhang and Yong Xu and Chuancai Liu}, title = {Modified local entropy-based transition region extraction and thresholding}, journal = {Appl. Soft Comput.}, volume = {11}, number = {8}, pages = {5630--5638}, year = {2011}, url = {https://doi.org/10.1016/j.asoc.2011.04.001}, doi = {10.1016/J.ASOC.2011.04.001}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/asc/LiZXL11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/ZhangGLZLZ11, author = {David Zhang and Zhenhua Guo and Guangming Lu and Lei Zhang and Yahui Liu and Wangmeng Zuo}, title = {Online joint palmprint and palmvein verification}, journal = {Expert Syst. Appl.}, volume = {38}, number = {3}, pages = {2621--2631}, year = {2011}, url = {https://doi.org/10.1016/j.eswa.2010.08.052}, doi = {10.1016/J.ESWA.2010.08.052}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/eswa/ZhangGLZLZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/HuZZPAP11, author = {Qinghua Hu and Lei Zhang and David Zhang and Wei Pan and Shuang An and Witold Pedrycz}, title = {Measuring relevance between discrete and continuous features based on neighborhood mutual information}, journal = {Expert Syst. Appl.}, volume = {38}, number = {9}, pages = {10737--10750}, year = {2011}, url = {https://doi.org/10.1016/j.eswa.2011.01.023}, doi = {10.1016/J.ESWA.2011.01.023}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/eswa/HuZZPAP11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijitdm/YongZYZY11, author = {Xu Yong and David Zhang and Jian Yang and Jin Zhong and Jingyu Yang}, title = {Evaluate Dissimilarity of Samples in Feature Space for Improving {KPCA}}, journal = {Int. J. Inf. Technol. Decis. Mak.}, volume = {10}, number = {3}, pages = {479--495}, year = {2011}, url = {https://doi.org/10.1142/S0219622011004415}, doi = {10.1142/S0219622011004415}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijitdm/YongZYZY11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/XuZZ11, author = {Yong Xu and Qi Zhu and David Zhang}, title = {Combine crossing matching scores with conventional matching scores for bimodal biometrics and face and palmprint recognition experiments}, journal = {Neurocomputing}, volume = {74}, number = {18}, pages = {3946--3952}, year = {2011}, url = {https://doi.org/10.1016/j.neucom.2011.08.011}, doi = {10.1016/J.NEUCOM.2011.08.011}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/XuZZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jms/ChenZZZ11, author = {Yinghui Chen and Lei Zhang and David Zhang and Dongyu Zhang}, title = {Computerized Wrist Pulse Signal Diagnosis Using Modified Auto-Regressive Models}, journal = {J. Medical Syst.}, volume = {35}, number = {3}, pages = {321--328}, year = {2011}, url = {https://doi.org/10.1007/s10916-009-9368-4}, doi = {10.1007/S10916-009-9368-4}, timestamp = {Mon, 08 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jms/ChenZZZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/nca/XuZ11, author = {Yong Xu and David Zhang}, title = {Accelerating the kernel-method-based feature extraction procedure from the viewpoint of numerical approximation}, journal = {Neural Comput. Appl.}, volume = {20}, number = {7}, pages = {1087--1096}, year = {2011}, url = {https://doi.org/10.1007/s00521-011-0534-5}, doi = {10.1007/S00521-011-0534-5}, timestamp = {Thu, 10 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/nca/XuZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/XiaoZZS11, author = {Rui Xiao and Qijun Zhao and David Zhang and Pengfei Shi}, title = {Facial expression recognition on multiple manifolds}, journal = {Pattern Recognit.}, volume = {44}, number = {1}, pages = {107--116}, year = {2011}, url = {https://doi.org/10.1016/j.patcog.2010.07.017}, doi = {10.1016/J.PATCOG.2010.07.017}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/XiaoZZS11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ZhangZC11, author = {David Zhang and Qijun Zhao and Fangmei Chen}, title = {Quantitative analysis of human facial beauty using geometric features}, journal = {Pattern Recognit.}, volume = {44}, number = {4}, pages = {940--950}, year = {2011}, url = {https://doi.org/10.1016/j.patcog.2010.10.013}, doi = {10.1016/J.PATCOG.2010.10.013}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/ZhangZC11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ZuoYZ11, author = {Wangmeng Zuo and Feng Yue and David Zhang}, title = {On accurate orientation extraction and appropriate distance measure for low-resolution palmprint recognition}, journal = {Pattern Recognit.}, volume = {44}, number = {4}, pages = {964--972}, year = {2011}, url = {https://doi.org/10.1016/j.patcog.2010.09.017}, doi = {10.1016/J.PATCOG.2010.09.017}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/ZuoYZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/YangZYZ11, author = {Jian Yang and Lei Zhang and Jing{-}Yu Yang and David Zhang}, title = {From classifiers to discriminators: {A} nearest neighbor rule induced discriminant analysis}, journal = {Pattern Recognit.}, volume = {44}, number = {7}, pages = {1387--1402}, year = {2011}, url = {https://doi.org/10.1016/j.patcog.2011.01.009}, doi = {10.1016/J.PATCOG.2011.01.009}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/YangZYZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/LiuZZ11, author = {Feng Liu and Qijun Zhao and David Zhang}, title = {A novel hierarchical fingerprint matching approach}, journal = {Pattern Recognit.}, volume = {44}, number = {8}, pages = {1604--1613}, year = {2011}, url = {https://doi.org/10.1016/j.patcog.2011.02.010}, doi = {10.1016/J.PATCOG.2011.02.010}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/LiuZZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ZhangZZZ11, author = {Lin Zhang and Lei Zhang and David Zhang and Hailong Zhu}, title = {Ensemble of local and global information for finger-knuckle-print recognition}, journal = {Pattern Recognit.}, volume = {44}, number = {9}, pages = {1990--1998}, year = {2011}, url = {https://doi.org/10.1016/j.patcog.2010.06.007}, doi = {10.1016/J.PATCOG.2010.06.007}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/ZhangZZZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/PengZZY11, author = {Bo Peng and Lei Zhang and David Zhang and Jian Yang}, title = {Image segmentation by iterated region merging with localized graph cuts}, journal = {Pattern Recognit.}, volume = {44}, number = {10-11}, pages = {2527--2538}, year = {2011}, url = {https://doi.org/10.1016/j.patcog.2011.03.024}, doi = {10.1016/J.PATCOG.2011.03.024}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/PengZZY11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/GuoZZZL11, author = {Zhenhua Guo and David Zhang and Lei Zhang and Wangmeng Zuo and Guangming Lu}, title = {Empirical study of light source selection for palmprint recognition}, journal = {Pattern Recognit. Lett.}, volume = {32}, number = {2}, pages = {120--126}, year = {2011}, url = {https://doi.org/10.1016/j.patrec.2010.09.026}, doi = {10.1016/J.PATREC.2010.09.026}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/prl/GuoZZZL11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/YueZZL11, author = {Feng Yue and Wangmeng Zuo and David Zhang and Bin Li}, title = {Fast palmprint identification with multiple templates per subject}, journal = {Pattern Recognit. Lett.}, volume = {32}, number = {8}, pages = {1108--1118}, year = {2011}, url = {https://doi.org/10.1016/j.patrec.2011.02.019}, doi = {10.1016/J.PATREC.2011.02.019}, timestamp = {Tue, 25 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/prl/YueZZL11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigpro/JingLLZYL11, author = {Xiao{-}Yuan Jing and Sheng Li and Chao Lan and David Zhang and Jingyu Yang and Qian Liu}, title = {Color image canonical correlation analysis for face feature extraction and recognition}, journal = {Signal Process.}, volume = {91}, number = {8}, pages = {2132--2140}, year = {2011}, url = {https://doi.org/10.1016/j.sigpro.2011.02.016}, doi = {10.1016/J.SIGPRO.2011.02.016}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sigpro/JingLLZYL11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/XuZYY11, author = {Yong Xu and David Zhang and Jian Yang and Jing{-}Yu Yang}, title = {A Two-Phase Test Sample Sparse Representation Method for Use With Face Recognition}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {21}, number = {9}, pages = {1255--1262}, year = {2011}, url = {https://doi.org/10.1109/TCSVT.2011.2138790}, doi = {10.1109/TCSVT.2011.2138790}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcsv/XuZYY11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tifs/KanhangadKZ11, author = {Vivek Kanhangad and Ajay Kumar and David Zhang}, title = {A Unified Framework for Contactless Hand Verification}, journal = {{IEEE} Trans. Inf. Forensics Secur.}, volume = {6}, number = {3-2}, pages = {1014--1027}, year = {2011}, url = {https://doi.org/10.1109/TIFS.2011.2121062}, doi = {10.1109/TIFS.2011.2121062}, timestamp = {Thu, 06 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tifs/KanhangadKZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/ZhangLZLL11, author = {David Zhang and Feng Liu and Qijun Zhao and Guangming Lu and Nan Luo}, title = {Selecting a Reference High Resolution for Fingerprint Recognition Using Minutiae and Pores}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {60}, number = {3}, pages = {863--871}, year = {2011}, url = {https://doi.org/10.1109/TIM.2010.2062610}, doi = {10.1109/TIM.2010.2062610}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tim/ZhangLZLL11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/KanhangadKZ11, author = {Vivek Kanhangad and Ajay Kumar and David Zhang}, title = {Contactless and Pose Invariant Biometric Identification Using Hand Surface}, journal = {{IEEE} Trans. Image Process.}, volume = {20}, number = {5}, pages = {1415--1424}, year = {2011}, url = {https://doi.org/10.1109/TIP.2010.2090888}, doi = {10.1109/TIP.2010.2090888}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/KanhangadKZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/ZhangZMZ11, author = {Lin Zhang and Lei Zhang and Xuanqin Mou and David Zhang}, title = {{FSIM:} {A} Feature Similarity Index for Image Quality Assessment}, journal = {{IEEE} Trans. Image Process.}, volume = {20}, number = {8}, pages = {2378--2386}, year = {2011}, url = {https://doi.org/10.1109/TIP.2011.2109730}, doi = {10.1109/TIP.2011.2109730}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/ZhangZMZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/PengZZ11, author = {Bo Peng and Lei Zhang and David Zhang}, title = {Automatic Image Segmentation by Dynamic Region Merging}, journal = {{IEEE} Trans. Image Process.}, volume = {20}, number = {12}, pages = {3592--3605}, year = {2011}, url = {https://doi.org/10.1109/TIP.2011.2157512}, doi = {10.1109/TIP.2011.2157512}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/PengZZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/FanXZ11, author = {Zizhu Fan and Yong Xu and David Dapeng Zhang}, title = {Local Linear Discriminant Analysis Framework Using Sample Neighbors}, journal = {{IEEE} Trans. Neural Networks}, volume = {22}, number = {7}, pages = {1119--1132}, year = {2011}, url = {https://doi.org/10.1109/TNN.2011.2152852}, doi = {10.1109/TNN.2011.2152852}, timestamp = {Tue, 13 Sep 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tnn/FanXZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/LiZZLY11, author = {Wei Li and David Zhang and Lei Zhang and Guangming Lu and Jingqi Yan}, title = {3-D Palmprint Recognition With Joint Line and Orientation Features}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {C}}, volume = {41}, number = {2}, pages = {274--279}, year = {2011}, url = {https://doi.org/10.1109/TSMCC.2010.2055849}, doi = {10.1109/TSMCC.2010.2055849}, timestamp = {Thu, 21 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/LiZZLY11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acpr/SunZY11, author = {Mingming Sun and David Zhang and Jingyu Yang}, title = {Face attractiveness improvement using beauty prototypes and decision}, booktitle = {First Asian Conference on Pattern Recognition, {ACPR} 2011, Beijing, China, 28-28 November, 2011}, pages = {283--287}, publisher = {{IEEE}}, year = {2011}, url = {https://doi.org/10.1109/ACPR.2011.6166544}, doi = {10.1109/ACPR.2011.6166544}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acpr/SunZY11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acpr/YanCZ11, author = {Ke Yan and Youbin Chen and David Zhang}, title = {Gabor Surface Feature for face recognition}, booktitle = {First Asian Conference on Pattern Recognition, {ACPR} 2011, Beijing, China, 28-28 November, 2011}, pages = {288--292}, publisher = {{IEEE}}, year = {2011}, url = {https://doi.org/10.1109/ACPR.2011.6166553}, doi = {10.1109/ACPR.2011.6166553}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/acpr/YanCZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/acpr/JingLLYZY11, author = {Xiao{-}Yuan Jing and Chao Lan and Min Li and Yong{-}Fang Yao and David Zhang and Jingyu Yang}, title = {Class-imbalance learning based discriminant analysis}, booktitle = {First Asian Conference on Pattern Recognition, {ACPR} 2011, Beijing, China, 28-28 November, 2011}, pages = {545--549}, publisher = {{IEEE}}, year = {2011}, url = {https://doi.org/10.1109/ACPR.2011.6166659}, doi = {10.1109/ACPR.2011.6166659}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/acpr/JingLLYZY11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/YangZYZ11, author = {Meng Yang and Lei Zhang and Jian Yang and David Zhang}, title = {Robust sparse coding for face recognition}, booktitle = {The 24th {IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR} 2011, Colorado Springs, CO, USA, 20-25 June 2011}, pages = {625--632}, publisher = {{IEEE} Computer Society}, year = {2011}, url = {https://doi.org/10.1109/CVPR.2011.5995393}, doi = {10.1109/CVPR.2011.5995393}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/YangZYZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccv/YangZFZ11, author = {Meng Yang and Lei Zhang and Xiangchu Feng and David Zhang}, editor = {Dimitris N. Metaxas and Long Quan and Alberto Sanfeliu and Luc Van Gool}, title = {Fisher Discrimination Dictionary Learning for sparse representation}, booktitle = {{IEEE} International Conference on Computer Vision, {ICCV} 2011, Barcelona, Spain, November 6-13, 2011}, pages = {543--550}, publisher = {{IEEE} Computer Society}, year = {2011}, url = {https://doi.org/10.1109/ICCV.2011.6126286}, doi = {10.1109/ICCV.2011.6126286}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iccv/YangZFZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccv/ZhangZHZ11, author = {Lei Zhang and Pengfei Zhu and Qinghua Hu and David Zhang}, editor = {Dimitris N. Metaxas and Long Quan and Alberto Sanfeliu and Luc Van Gool}, title = {A linear subspace learning approach via sparse coding}, booktitle = {{IEEE} International Conference on Computer Vision, {ICCV} 2011, Barcelona, Spain, November 6-13, 2011}, pages = {755--761}, publisher = {{IEEE} Computer Society}, year = {2011}, url = {https://doi.org/10.1109/ICCV.2011.6126313}, doi = {10.1109/ICCV.2011.6126313}, timestamp = {Mon, 04 Dec 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iccv/ZhangZHZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icic/YangZLLZ11, author = {Shixin Yang and Wangmeng Zuo and Lei Liu and Yanlai Li and David Zhang}, editor = {De{-}Shuang Huang and Yong Gan and Vitoantonio Bevilacqua and Juan Carlos Figueroa Garc{\'{\i}}a}, title = {Adaptive Weighted Fusion of Local Kernel Classifiers for Effective Pattern Classification}, booktitle = {Advanced Intelligent Computing - 7th International Conference, {ICIC} 2011, Zhengzhou, China, August 11-14, 2011. Revised Selected Papers}, series = {Lecture Notes in Computer Science}, volume = {6838}, pages = {63--70}, publisher = {Springer}, year = {2011}, url = {https://doi.org/10.1007/978-3-642-24728-6\_9}, doi = {10.1007/978-3-642-24728-6\_9}, timestamp = {Tue, 14 May 2019 10:00:53 +0200}, biburl = {https://dblp.org/rec/conf/icic/YangZLLZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/LuZZZ11, author = {Jianfeng Lu and Wangmeng Zuo and Xiaofei Zhao and David Zhang}, editor = {Beno{\^{\i}}t Macq and Peter Schelkens}, title = {An augmented Lagrangian method for fast gradient vector flow computation}, booktitle = {18th {IEEE} International Conference on Image Processing, {ICIP} 2011, Brussels, Belgium, September 11-14, 2011}, pages = {1525--1528}, publisher = {{IEEE}}, year = {2011}, url = {https://doi.org/10.1109/ICIP.2011.6115735}, doi = {10.1109/ICIP.2011.6115735}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/icip/LuZZZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/ManJZL11, author = {Jiang{-}Yue Man and Xiao{-}Yuan Jing and David Zhang and Chao Lan}, editor = {Beno{\^{\i}}t Macq and Peter Schelkens}, title = {Sparse cost-sensitive classifier with application to face recognition}, booktitle = {18th {IEEE} International Conference on Image Processing, {ICIP} 2011, Brussels, Belgium, September 11-14, 2011}, pages = {1773--1776}, publisher = {{IEEE}}, year = {2011}, url = {https://doi.org/10.1109/ICIP.2011.6115804}, doi = {10.1109/ICIP.2011.6115804}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icip/ManJZL11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/LiJZYB11, author = {Sheng Li and Xiao{-}Yuan Jing and David Zhang and Yong{-}Fang Yao and Lu{-}Sha Bian}, editor = {Beno{\^{\i}}t Macq and Peter Schelkens}, title = {A novel kernel discriminant feature extraction framework based on mapped virtual samples for face recognition}, booktitle = {18th {IEEE} International Conference on Image Processing, {ICIP} 2011, Brussels, Belgium, September 11-14, 2011}, pages = {3005--3008}, publisher = {{IEEE}}, year = {2011}, url = {https://doi.org/10.1109/ICIP.2011.6116295}, doi = {10.1109/ICIP.2011.6116295}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icip/LiJZYB11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/LanJZGY11, author = {Chao Lan and Xiao{-}Yuan Jing and David Zhang and Shi{-}Qiang Gao and Jingyu Yang}, editor = {Beno{\^{\i}}t Macq and Peter Schelkens}, title = {Discriminant subclass-center manifold preserving projection for face feature extraction}, booktitle = {18th {IEEE} International Conference on Image Processing, {ICIP} 2011, Brussels, Belgium, September 11-14, 2011}, pages = {3013--3016}, publisher = {{IEEE}}, year = {2011}, url = {https://doi.org/10.1109/ICIP.2011.6116297}, doi = {10.1109/ICIP.2011.6116297}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icip/LanJZGY11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/JingLZY11, author = {Xiao{-}Yuan Jing and Sheng Li and David Zhang and Jingyu Yang}, editor = {Beno{\^{\i}}t Macq and Peter Schelkens}, title = {Face recognition based on local uncorrelated and weighted global uncorrelated discriminant transforms}, booktitle = {18th {IEEE} International Conference on Image Processing, {ICIP} 2011, Brussels, Belgium, September 11-14, 2011}, pages = {3049--3052}, publisher = {{IEEE}}, year = {2011}, url = {https://doi.org/10.1109/ICIP.2011.6116307}, doi = {10.1109/ICIP.2011.6116307}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icip/JingLZY11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:reference/crypt/ZhangK11, author = {David Zhang and Vivek Kanhangad}, editor = {Henk C. A. van Tilborg and Sushil Jajodia}, title = {Hand Geometry Recognition}, booktitle = {Encyclopedia of Cryptography and Security, 2nd Ed}, pages = {529--531}, publisher = {Springer}, year = {2011}, url = {https://doi.org/10.1007/978-1-4419-5906-5\_878}, doi = {10.1007/978-1-4419-5906-5\_878}, timestamp = {Mon, 18 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/reference/crypt/ZhangK11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:reference/crypt/ZhangYZ11, author = {David Zhang and Feng Yue and Wangmeng Zuo}, editor = {Henk C. A. van Tilborg and Sushil Jajodia}, title = {Palmprint Recognition}, booktitle = {Encyclopedia of Cryptography and Security, 2nd Ed}, pages = {909--913}, publisher = {Springer}, year = {2011}, url = {https://doi.org/10.1007/978-1-4419-5906-5\_744}, doi = {10.1007/978-1-4419-5906-5\_744}, timestamp = {Sat, 16 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/reference/crypt/ZhangYZ11.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1112-1496, author = {Kaihua Zhang and Lei Zhang and Huihui Song and David Zhang}, title = {Re-initialization Free Level Set Evolution via Reaction Diffusion}, journal = {CoRR}, volume = {abs/1112.1496}, year = {2011}, url = {http://arxiv.org/abs/1112.1496}, eprinttype = {arXiv}, eprint = {1112.1496}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1112-1496.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/chinaf/LiuZL10, author = {Zhiyong Liu and David Zhang and Yugang Li}, title = {Fast and convergence-guaranteed algorithm for linear separation}, journal = {Sci. China Inf. Sci.}, volume = {53}, number = {4}, pages = {729--737}, year = {2010}, url = {https://doi.org/10.1007/s11432-010-0037-5}, doi = {10.1007/S11432-010-0037-5}, timestamp = {Mon, 02 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/chinaf/LiuZL10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ejasp/ZhangZZZL10, author = {Dongyu Zhang and Wangmeng Zuo and David Zhang and Hongzhi Zhang and Naimin Li}, title = {Classification of Pulse Waveforms Using Edit Distance with Real Penalty}, journal = {{EURASIP} J. Adv. Signal Process.}, volume = {2010}, year = {2010}, url = {https://doi.org/10.1155/2010/303140}, doi = {10.1155/2010/303140}, timestamp = {Thu, 12 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ejasp/ZhangZZZL10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/GuoZZZ10, author = {Zhenhua Guo and Wangmeng Zuo and Lei Zhang and David Zhang}, title = {A unified distance measurement for orientation coding in palmprint verification}, journal = {Neurocomputing}, volume = {73}, number = {4-6}, pages = {944--950}, year = {2010}, url = {https://doi.org/10.1016/j.neucom.2009.09.009}, doi = {10.1016/J.NEUCOM.2009.09.009}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/GuoZZZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/WangXZY10, author = {Jinghua Wang and Yong Xu and David Zhang and Jane You}, title = {An efficient method for computing orthogonal discriminant vectors}, journal = {Neurocomputing}, volume = {73}, number = {10-12}, pages = {2168--2176}, year = {2010}, url = {https://doi.org/10.1016/j.neucom.2010.02.009}, doi = {10.1016/J.NEUCOM.2010.02.009}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/WangXZY10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/isci/HuangWZL10, author = {Bo Huang and Jinsong Wu and David Zhang and Naimin Li}, title = {Tongue shape classification by geometric features}, journal = {Inf. Sci.}, volume = {180}, number = {2}, pages = {312--324}, year = {2010}, url = {https://doi.org/10.1016/j.ins.2009.09.016}, doi = {10.1016/J.INS.2009.09.016}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/isci/HuangWZL10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ZhangKLK10, author = {David Zhang and Vivek Kanhangad and Nan Luo and Ajay Kumar}, title = {Robust palmprint verification using 2D and 3D features}, journal = {Pattern Recognit.}, volume = {43}, number = {1}, pages = {358--368}, year = {2010}, url = {https://doi.org/10.1016/j.patcog.2009.04.026}, doi = {10.1016/J.PATCOG.2009.04.026}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/ZhangKLK10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/NingZZW10, author = {Jifeng Ning and Lei Zhang and David Zhang and Chengke Wu}, title = {Interactive image segmentation by maximal similarity based region merging}, journal = {Pattern Recognit.}, volume = {43}, number = {2}, pages = {445--456}, year = {2010}, url = {https://doi.org/10.1016/j.patcog.2009.03.004}, doi = {10.1016/J.PATCOG.2009.03.004}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/NingZZW10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/GuoZZ10, author = {Zhenhua Guo and Lei Zhang and David Zhang}, title = {Rotation invariant texture classification using {LBP} variance {(LBPV)} with global matching}, journal = {Pattern Recognit.}, volume = {43}, number = {3}, pages = {706--719}, year = {2010}, url = {https://doi.org/10.1016/j.patcog.2009.08.017}, doi = {10.1016/J.PATCOG.2009.08.017}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/GuoZZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ZhaoZZL10, author = {Qijun Zhao and David Zhang and Lei Zhang and Nan Luo}, title = {High resolution partial fingerprint alignment using pore-valley descriptors}, journal = {Pattern Recognit.}, volume = {43}, number = {3}, pages = {1050--1061}, year = {2010}, url = {https://doi.org/10.1016/j.patcog.2009.08.004}, doi = {10.1016/J.PATCOG.2009.08.004}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/ZhaoZZL10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ZhangLY10, author = {David Zhang and Zhi Liu and Jingqi Yan}, title = {Dynamic tongueprint: {A} novel biometric identifier}, journal = {Pattern Recognit.}, volume = {43}, number = {3}, pages = {1071--1082}, year = {2010}, url = {https://doi.org/10.1016/j.patcog.2009.09.002}, doi = {10.1016/J.PATCOG.2009.09.002}, timestamp = {Mon, 22 Jan 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/ZhangLY10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/XuZY10, author = {Yong Xu and David Zhang and Jing{-}Yu Yang}, title = {A feature extraction method for use with bimodal biometrics}, journal = {Pattern Recognit.}, volume = {43}, number = {3}, pages = {1106--1115}, year = {2010}, url = {https://doi.org/10.1016/j.patcog.2009.09.013}, doi = {10.1016/J.PATCOG.2009.09.013}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/XuZY10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ZhangDZS10, author = {Lei Zhang and Weisheng Dong and David Zhang and Guangming Shi}, title = {Two-stage image denoising by principal component analysis with local pixel grouping}, journal = {Pattern Recognit.}, volume = {43}, number = {4}, pages = {1531--1549}, year = {2010}, url = {https://doi.org/10.1016/j.patcog.2009.09.023}, doi = {10.1016/J.PATCOG.2009.09.023}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/ZhangDZS10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ZhangZZZ10, author = {Lin Zhang and Lei Zhang and David Zhang and Hailong Zhu}, title = {Online finger-knuckle-print verification for personal authentication}, journal = {Pattern Recognit.}, volume = {43}, number = {7}, pages = {2560--2571}, year = {2010}, url = {https://doi.org/10.1016/j.patcog.2010.01.020}, doi = {10.1016/J.PATCOG.2010.01.020}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/ZhangZZZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ZhaoZZL10a, author = {Qijun Zhao and David Zhang and Lei Zhang and Nan Luo}, title = {Adaptive fingerprint pore modeling and extraction}, journal = {Pattern Recognit.}, volume = {43}, number = {8}, pages = {2833--2844}, year = {2010}, url = {https://doi.org/10.1016/j.patcog.2010.02.016}, doi = {10.1016/J.PATCOG.2010.02.016}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/ZhaoZZL10a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/XuZYZ10, author = {Yong Xu and Aini Zhong and Jian Yang and David Zhang}, title = {{LPP} solution schemes for use with face recognition}, journal = {Pattern Recognit.}, volume = {43}, number = {12}, pages = {4165--4176}, year = {2010}, url = {https://doi.org/10.1016/j.patcog.2010.06.016}, doi = {10.1016/J.PATCOG.2010.06.016}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/XuZYZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/GaoZZX10, author = {Quanxue Gao and Lei Zhang and David Zhang and Hui Xu}, title = {Independent components extraction from image matrix}, journal = {Pattern Recognit. Lett.}, volume = {31}, number = {3}, pages = {171--178}, year = {2010}, url = {https://doi.org/10.1016/j.patrec.2009.10.014}, doi = {10.1016/J.PATREC.2009.10.014}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/prl/GaoZZX10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/ZhangZZS10, author = {Baochang Zhang and Lei Zhang and David Zhang and LinLin Shen}, title = {Directional binary code with application to PolyU near-infrared face database}, journal = {Pattern Recognit. Lett.}, volume = {31}, number = {14}, pages = {2337--2344}, year = {2010}, url = {https://doi.org/10.1016/j.patrec.2010.07.006}, doi = {10.1016/J.PATREC.2010.07.006}, timestamp = {Thu, 27 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/prl/ZhangZZS10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigpro/ZuoZZW10, author = {Wangmeng Zuo and Hongzhi Zhang and David Zhang and Kuanquan Wang}, title = {Post-processed {LDA} for face and palmprint recognition: What is the rationale}, journal = {Signal Process.}, volume = {90}, number = {8}, pages = {2344--2352}, year = {2010}, url = {https://doi.org/10.1016/j.sigpro.2009.06.004}, doi = {10.1016/J.SIGPRO.2009.06.004}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/sigpro/ZuoZZW10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tbe/GuoZLZY10, author = {Dongmin Guo and David Zhang and Naimin Li and Lei Zhang and Jianhua Yang}, title = {A Novel Breath Analysis System Based on Electronic Olfaction}, journal = {{IEEE} Trans. Biomed. Eng.}, volume = {57}, number = {11}, pages = {2753--2763}, year = {2010}, url = {https://doi.org/10.1109/TBME.2010.2055864}, doi = {10.1109/TBME.2010.2055864}, timestamp = {Wed, 02 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tbe/GuoZLZY10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tifs/KumarKZ10, author = {Ajay Kumar and Vivek Kanhangad and David Zhang}, title = {A new framework for adaptive multimodal biometrics management}, journal = {{IEEE} Trans. Inf. Forensics Secur.}, volume = {5}, number = {1}, pages = {92--102}, year = {2010}, url = {https://doi.org/10.1109/TIFS.2009.2031892}, doi = {10.1109/TIFS.2009.2031892}, timestamp = {Thu, 06 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tifs/KumarKZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/ZhangGLZZ10, author = {David Zhang and Zhenhua Guo and Guangming Lu and Lei Zhang and Wangmeng Zuo}, title = {An Online System of Multispectral Palmprint Verification}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {59}, number = {2}, pages = {480--490}, year = {2010}, url = {https://doi.org/10.1109/TIM.2009.2028772}, doi = {10.1109/TIM.2009.2028772}, timestamp = {Mon, 08 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tim/ZhangGLZZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/KumarZ10, author = {Ajay Kumar and David Zhang}, title = {Improving Biometric Authentication Performance From the User Quality}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {59}, number = {3}, pages = {730--735}, year = {2010}, url = {https://doi.org/10.1109/TIM.2009.2028773}, doi = {10.1109/TIM.2009.2028773}, timestamp = {Mon, 08 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tim/KumarZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tim/ScottiZ10, author = {Fabio Scotti and David Zhang}, title = {Special Section in {IEEE} Transactions on Instrumentation and Measurement on Biometric Instrumentation and Measurement}, journal = {{IEEE} Trans. Instrum. Meas.}, volume = {59}, number = {4}, pages = {750--751}, year = {2010}, url = {https://doi.org/10.1109/TIM.2010.2043980}, doi = {10.1109/TIM.2010.2043980}, timestamp = {Mon, 08 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tim/ScottiZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/KongZK10, author = {Adams Wai{-}Kin Kong and David Zhang and Mohamed S. Kamel}, title = {An Analysis of IrisCode}, journal = {{IEEE} Trans. Image Process.}, volume = {19}, number = {2}, pages = {522--532}, year = {2010}, url = {https://doi.org/10.1109/TIP.2009.2033427}, doi = {10.1109/TIP.2009.2033427}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/KongZK10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/GuoZZ10, author = {Zhenhua Guo and Lei Zhang and David Zhang}, title = {A Completed Modeling of Local Binary Pattern Operator for Texture Classification}, journal = {{IEEE} Trans. Image Process.}, volume = {19}, number = {6}, pages = {1657--1663}, year = {2010}, url = {https://doi.org/10.1109/TIP.2010.2044957}, doi = {10.1109/TIP.2010.2044957}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/GuoZZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/titb/WangZ10, author = {Xingzheng Wang and David Dapeng Zhang}, title = {An Optimized Tongue Image Color Correction Scheme}, journal = {{IEEE} Trans. Inf. Technol. Biomed.}, volume = {14}, number = {6}, pages = {1355--1364}, year = {2010}, url = {https://doi.org/10.1109/TITB.2010.2076378}, doi = {10.1109/TITB.2010.2076378}, timestamp = {Wed, 13 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/titb/WangZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/DiZZP10, author = {Wei Di and Lei Zhang and David Zhang and Quan Pan}, title = {Studies on Hyperspectral Face Recognition in Visible Spectrum With Feature Band Selection}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {A}}, volume = {40}, number = {6}, pages = {1354--1361}, year = {2010}, url = {https://doi.org/10.1109/TSMCA.2010.2052603}, doi = {10.1109/TSMCA.2010.2052603}, timestamp = {Tue, 11 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/DiZZP10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/ais2/ChenZZZ10, author = {Chao Chen and David Zhang and Lei Zhang and Yongqiang Zhao}, title = {Segmentation of fingerprint image by using polarimetric feature}, booktitle = {Autonomous and Intelligent Systems - First International Conference, {AIS} 2010, Povoa de Varzim, Portugal, June 21-23, 2010. Proceedings}, pages = {1--4}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/AIS.2010.5547039}, doi = {10.1109/AIS.2010.5547039}, timestamp = {Fri, 03 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/ais2/ChenZZZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/bibm/Zhang10, author = {David Zhang}, title = {Medical Biometrics-Computerized {TCM} Diagnosis}, booktitle = {2010 {IEEE} International Conference on Bioinformatics and Biomedicine Workshops, {BIBMW} 2010, Hong Kong, December 18, 2010}, pages = {4}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/BIBMW.2010.5703764}, doi = {10.1109/BIBMW.2010.5703764}, timestamp = {Wed, 16 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/bibm/Zhang10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/KanhangadKZ10, author = {Vivek Kanhangad and Ajay Kumar and David Zhang}, title = {Human hand identification with 3D hand pose variations}, booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR} Workshops 2010, San Francisco, CA, USA, 13-18 June, 2010}, pages = {17--21}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/CVPRW.2010.5543236}, doi = {10.1109/CVPRW.2010.5543236}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/KanhangadKZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/LiZZLY10, author = {Wei Li and Lei Zhang and David Zhang and Guangming Lu and Jingqi Yan}, title = {Efficient joint 2D and 3D palmprint matching with alignment refinement}, booktitle = {The Twenty-Third {IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR} 2010, San Francisco, CA, USA, 13-18 June 2010}, pages = {795--801}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/CVPR.2010.5540134}, doi = {10.1109/CVPR.2010.5540134}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/LiZZLY10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/ZuoLGZ10, author = {Wangmeng Zuo and Zhouchen Lin and Zhenhua Guo and David Zhang}, title = {The multiscale competitive code via sparse representation for palmprint verification}, booktitle = {The Twenty-Third {IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR} 2010, San Francisco, CA, USA, 13-18 June 2010}, pages = {2265--2272}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/CVPR.2010.5539909}, doi = {10.1109/CVPR.2010.5539909}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/ZuoLGZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icassp/YuanZLZ10, author = {Yin Yuan and Haomian Zheng and Zhu Li and David Zhang}, title = {Video action recognition with spatio-temporal graph embedding and spline modeling}, booktitle = {Proceedings of the {IEEE} International Conference on Acoustics, Speech, and Signal Processing, {ICASSP} 2010, 14-19 March 2010, Sheraton Dallas Hotel, Dallas, Texas, {USA}}, pages = {2422--2425}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/ICASSP.2010.5496275}, doi = {10.1109/ICASSP.2010.5496275}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icassp/YuanZLZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/GuoZZZ10, author = {Zhenhua Guo and Lei Zhang and David Zhang and Su Zhang}, title = {Rotation invariant texture classification using adaptive {LBP} with directional statistical features}, booktitle = {Proceedings of the International Conference on Image Processing, {ICIP} 2010, September 26-29, Hong Kong, China}, pages = {285--288}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/ICIP.2010.5652209}, doi = {10.1109/ICIP.2010.5652209}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/icip/GuoZZZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/YangZYZ10, author = {Meng Yang and Lei Zhang and Jian Yang and David Zhang}, title = {Metaface learning for sparse representation based face recognition}, booktitle = {Proceedings of the International Conference on Image Processing, {ICIP} 2010, September 26-29, Hong Kong, China}, pages = {1601--1604}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/ICIP.2010.5652363}, doi = {10.1109/ICIP.2010.5652363}, timestamp = {Wed, 15 Jan 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icip/YangZYZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/ZhangZGZ10, author = {Lin Zhang and Lei Zhang and Zhenhua Guo and David Zhang}, title = {Monogenic-LBP: {A} new approach for rotation invariant texture classification}, booktitle = {Proceedings of the International Conference on Image Processing, {ICIP} 2010, September 26-29, Hong Kong, China}, pages = {2677--2680}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/ICIP.2010.5651885}, doi = {10.1109/ICIP.2010.5651885}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icip/ZhangZGZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/XieZYZ10, author = {Jin Xie and Lei Zhang and Jane You and David Zhang}, title = {Texture classification via patch-based sparse texton learning}, booktitle = {Proceedings of the International Conference on Image Processing, {ICIP} 2010, September 26-29, Hong Kong, China}, pages = {2737--2740}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/ICIP.2010.5651387}, doi = {10.1109/ICIP.2010.5651387}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icip/XieZYZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/YueZZ10, author = {Feng Yue and Wangmeng Zuo and David Zhang}, title = {{ICP} registration using principal line and orientation features for palmprint alignment}, booktitle = {Proceedings of the International Conference on Image Processing, {ICIP} 2010, September 26-29, Hong Kong, China}, pages = {3069--3072}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/ICIP.2010.5649887}, doi = {10.1109/ICIP.2010.5649887}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icip/YueZZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/ZhaoLZZ10, author = {Qijun Zhao and Feng Liu and Lei Zhang and David Zhang}, title = {A comparative study on quality assessment of high resolution fingerprint images}, booktitle = {Proceedings of the International Conference on Image Processing, {ICIP} 2010, September 26-29, Hong Kong, China}, pages = {3089--3092}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/ICIP.2010.5648800}, doi = {10.1109/ICIP.2010.5648800}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icip/ZhaoLZZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/JingLLMLZ10, author = {Xiao{-}Yuan Jing and Qian Liu and Chao Lan and Jiang{-}Yue Man and Sheng Li and David Zhang}, title = {Holistic orthogonal analysis of discriminant transforms for color face recognition}, booktitle = {Proceedings of the International Conference on Image Processing, {ICIP} 2010, September 26-29, Hong Kong, China}, pages = {3841--3844}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/ICIP.2010.5654099}, doi = {10.1109/ICIP.2010.5654099}, timestamp = {Tue, 04 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icip/JingLLMLZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/GuoZZM10, author = {Zhenhua Guo and Lei Zhang and David Zhang and Xuanqin Mou}, title = {Hierarchical multiscale {LBP} for face and palmprint recognition}, booktitle = {Proceedings of the International Conference on Image Processing, {ICIP} 2010, September 26-29, Hong Kong, China}, pages = {4521--4524}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/ICIP.2010.5653119}, doi = {10.1109/ICIP.2010.5653119}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icip/GuoZZM10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/ZhangZZZ10, author = {Dongyu Zhang and Wangmeng Zuo and David Zhang and Hongzhi Zhang}, title = {Time Series Classification Using Support Vector Machine with Gaussian Elastic Metric Kernel}, booktitle = {20th International Conference on Pattern Recognition, {ICPR} 2010, Istanbul, Turkey, 23-26 August 2010}, pages = {29--32}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/ICPR.2010.16}, doi = {10.1109/ICPR.2010.16}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/ZhangZZZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/ZhaoLZZ10, author = {Qijun Zhao and Feng Liu and Lei Zhang and David Zhang}, title = {Parallel versus Hierarchical Fusion of Extended Fingerprint Features}, booktitle = {20th International Conference on Pattern Recognition, {ICPR} 2010, Istanbul, Turkey, 23-26 August 2010}, pages = {1132--1135}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/ICPR.2010.283}, doi = {10.1109/ICPR.2010.283}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/ZhaoLZZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/GuoZZ10, author = {Zhenhua Guo and Lei Zhang and David Zhang}, title = {Feature Band Selection for Multispectral Palmprint Recognition}, booktitle = {20th International Conference on Pattern Recognition, {ICPR} 2010, Istanbul, Turkey, 23-26 August 2010}, pages = {1136--1139}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/ICPR.2010.284}, doi = {10.1109/ICPR.2010.284}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/GuoZZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/ZhangYFZ10, author = {Lei Zhang and Meng Yang and Zhizhao Feng and David Zhang}, title = {On the Dimensionality Reduction for Sparse Representation Based Face Recognition}, booktitle = {20th International Conference on Pattern Recognition, {ICPR} 2010, Istanbul, Turkey, 23-26 August 2010}, pages = {1237--1240}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/ICPR.2010.308}, doi = {10.1109/ICPR.2010.308}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/ZhangYFZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/LiuZZZ10, author = {Feng Liu and Qijun Zhao and Lei Zhang and David Zhang}, title = {Fingerprint Pore Matching Based on Sparse Representation}, booktitle = {20th International Conference on Pattern Recognition, {ICPR} 2010, Istanbul, Turkey, 23-26 August 2010}, pages = {1630--1633}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/ICPR.2010.403}, doi = {10.1109/ICPR.2010.403}, timestamp = {Sun, 12 Nov 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/LiuZZZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/YangZZZ10, author = {Meng Yang and Lei Zhang and Lin Zhang and David Zhang}, title = {Monogenic Binary Pattern {(MBP):} {A} Novel Feature Extraction and Representation Model for Face Recognition}, booktitle = {20th International Conference on Pattern Recognition, {ICPR} 2010, Istanbul, Turkey, 23-26 August 2010}, pages = {2680--2683}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/ICPR.2010.657}, doi = {10.1109/ICPR.2010.657}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/YangZZZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/ZhangZZLL10, author = {Dongyu Zhang and Wangmeng Zuo and David Zhang and Yanlai Li and Naimin Li}, title = {Gaussian {ERP} Kernel Classifier for Pulse Waveforms Classification}, booktitle = {20th International Conference on Pattern Recognition, {ICPR} 2010, Istanbul, Turkey, 23-26 August 2010}, pages = {2736--2739}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/ICPR.2010.670}, doi = {10.1109/ICPR.2010.670}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/ZhangZZLL10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/XiaoZZS10, author = {Rui Xiao and Qijun Zhao and David Zhang and Pengfei Shi}, title = {Data Classification on Multiple Manifolds}, booktitle = {20th International Conference on Pattern Recognition, {ICPR} 2010, Istanbul, Turkey, 23-26 August 2010}, pages = {3898--3901}, publisher = {{IEEE} Computer Society}, year = {2010}, url = {https://doi.org/10.1109/ICPR.2010.949}, doi = {10.1109/ICPR.2010.949}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/XiaoZZS10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/medbiometrics/ChenZ10, author = {Fangmei Chen and David Zhang}, editor = {David Zhang and Milan Sonka}, title = {A Benchmark for Geometric Facial Beauty Study}, booktitle = {Medical Biometrics, Second International Conference, {ICMB} 2010, Hong Kong, China, June 28-30, 2010. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {6165}, pages = {21--32}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-13923-9\_3}, doi = {10.1007/978-3-642-13923-9\_3}, timestamp = {Thu, 17 Oct 2019 12:39:20 +0200}, biburl = {https://dblp.org/rec/conf/medbiometrics/ChenZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/medbiometrics/ChenLGZ10, author = {Haifen Chen and Guangming Lu and Dongmin Guo and David Zhang}, editor = {David Zhang and Milan Sonka}, title = {An Effective Feature Extraction Method Used in Breath Analysis}, booktitle = {Medical Biometrics, Second International Conference, {ICMB} 2010, Hong Kong, China, June 28-30, 2010. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {6165}, pages = {33--41}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-13923-9\_4}, doi = {10.1007/978-3-642-13923-9\_4}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/medbiometrics/ChenLGZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/medbiometrics/GuoZLZY10, author = {Dongmin Guo and David Zhang and Naimin Li and Lei Zhang and Jianhua Yang}, editor = {David Zhang and Milan Sonka}, title = {Diabetes Identification and Classification by Means of a Breath Analysis System}, booktitle = {Medical Biometrics, Second International Conference, {ICMB} 2010, Hong Kong, China, June 28-30, 2010. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {6165}, pages = {52--63}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-13923-9\_6}, doi = {10.1007/978-3-642-13923-9\_6}, timestamp = {Tue, 08 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/medbiometrics/GuoZLZY10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/medbiometrics/WangZ10, author = {Xingzheng Wang and David Zhang}, editor = {David Zhang and Milan Sonka}, title = {A Comparative Study of Color Correction Algorithms for Tongue Image Inspection}, booktitle = {Medical Biometrics, Second International Conference, {ICMB} 2010, Hong Kong, China, June 28-30, 2010. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {6165}, pages = {392--402}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-13923-9\_42}, doi = {10.1007/978-3-642-13923-9\_42}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/medbiometrics/WangZ10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pricai/ZhangLSH10, author = {David Dapeng Zhang and Fen Lin and Zhongzhi Shi and Heqing Huang}, editor = {Byoung{-}Tak Zhang and Mehmet A. Orgun}, title = {Mining Hot Clusters of Similar Anomalies for System Management}, booktitle = {{PRICAI} 2010: Trends in Artificial Intelligence, 11th Pacific Rim International Conference on Artificial Intelligence, Daegu, Korea, August 30-September 2, 2010. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {6230}, pages = {359--371}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-15246-7\_34}, doi = {10.1007/978-3-642-15246-7\_34}, timestamp = {Tue, 14 May 2019 10:00:46 +0200}, biburl = {https://dblp.org/rec/conf/pricai/ZhangLSH10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wcnc/YangWZC10, author = {Xu Yang and Yapeng Wang and David Dapeng Zhang and Laurie G. Cuthbert}, title = {Resource Allocation in {LTE} {OFDMA} Systems Using Genetic Algorithm and Semi-Smart Antennas}, booktitle = {2010 {IEEE} Wireless Communications and Networking Conference, {WCNC} 2010, Proceedings, Sydney, Australia, 18-21 April 2010}, pages = {1--6}, publisher = {{IEEE}}, year = {2010}, url = {https://doi.org/10.1109/WCNC.2010.5506423}, doi = {10.1109/WCNC.2010.5506423}, timestamp = {Sat, 19 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/wcnc/YangWZC10.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/iceb2/2010, editor = {Ajay Kumar and David Zhang}, title = {Ethics and Policy of Biometrics - Third International Conference on Ethics and Policy of Biometrics and International Data Sharing, {ICEB} 2010, Hong Kong, January 4-5, 2010. Revised Papers}, series = {Lecture Notes in Computer Science}, volume = {6005}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-12595-9}, doi = {10.1007/978-3-642-12595-9}, isbn = {978-3-642-12594-2}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iceb2/2010.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/medbiometrics/2010, editor = {David Zhang and Milan Sonka}, title = {Medical Biometrics, Second International Conference, {ICMB} 2010, Hong Kong, China, June 28-30, 2010. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {6165}, publisher = {Springer}, year = {2010}, url = {https://doi.org/10.1007/978-3-642-13923-9}, doi = {10.1007/978-3-642-13923-9}, isbn = {978-3-642-13922-2}, timestamp = {Thu, 17 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/medbiometrics/2010.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/corr/abs-1012-1193, author = {Bo Peng and Lei Zhang and David Zhang}, title = {Automatic Image Segmentation by Dynamic Region Merging}, journal = {CoRR}, volume = {abs/1012.1193}, year = {2010}, url = {http://arxiv.org/abs/1012.1193}, eprinttype = {arXiv}, eprint = {1012.1193}, timestamp = {Mon, 13 Aug 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/corr/abs-1012-1193.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cma/MaWZ09, author = {Lin Ma and Kuanquan Wang and David Zhang}, title = {A universal texture segmentation and representation scheme based on ant colony optimization for iris image processing}, journal = {Comput. Math. Appl.}, volume = {57}, number = {11-12}, pages = {1862--1868}, year = {2009}, url = {https://doi.org/10.1016/j.camwa.2008.10.012}, doi = {10.1016/J.CAMWA.2008.10.012}, timestamp = {Thu, 11 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cma/MaWZ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cviu/ZhaoZZP09, author = {Y. Zhao and Lei Zhang and David Zhang and Quan Pan}, title = {Object separation by polarimetric and spectral imagery fusion}, journal = {Comput. Vis. Image Underst.}, volume = {113}, number = {8}, pages = {855--866}, year = {2009}, url = {https://doi.org/10.1016/j.cviu.2009.03.002}, doi = {10.1016/J.CVIU.2009.03.002}, timestamp = {Tue, 11 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cviu/ZhaoZZP09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ejasp/ZhaoZZL09, author = {Qijun Zhao and David Zhang and Lei Zhang and Hongtao Lu}, title = {Evolutionary Discriminant Feature Extraction with Application to Face Recognition}, journal = {{EURASIP} J. Adv. Signal Process.}, volume = {2009}, year = {2009}, url = {https://doi.org/10.1155/2009/465193}, doi = {10.1155/2009/465193}, timestamp = {Thu, 12 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ejasp/ZhaoZZL09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/eswa/XuYZY09, author = {Yong Xu and Lu Yao and David Zhang and Jing{-}Yu Yang}, title = {Improving the interest operator for face recognition}, journal = {Expert Syst. Appl.}, volume = {36}, number = {6}, pages = {9719--9728}, year = {2009}, url = {https://doi.org/10.1016/j.eswa.2009.02.032}, doi = {10.1016/J.ESWA.2009.02.032}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/eswa/XuYZY09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ieicet/LiYJCGZY09, author = {Sheng Li and Yong{-}Fang Yao and Xiao{-}Yuan Jing and Heng Chang and Shi{-}Qiang Gao and David Zhang and Jing{-}Yu Yang}, title = {Face Recognition Based on Nonlinear {DCT} Discriminant Feature Extraction Using Improved Kernel {DCV}}, journal = {{IEICE} Trans. Inf. Syst.}, volume = {92-D}, number = {12}, pages = {2527--2530}, year = {2009}, url = {https://doi.org/10.1587/transinf.E92.D.2527}, doi = {10.1587/TRANSINF.E92.D.2527}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ieicet/LiYJCGZY09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijig/KumarZ09, author = {Ajay Kumar and David Zhang}, title = {User Authentication Using Fusion of Face and Palmprint}, journal = {Int. J. Image Graph.}, volume = {9}, number = {2}, pages = {251--270}, year = {2009}, url = {https://doi.org/10.1142/S0219467809003423}, doi = {10.1142/S0219467809003423}, timestamp = {Tue, 24 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijig/KumarZ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/GaoZZ09, author = {Quanxue Gao and Lei Zhang and David Zhang}, title = {Sequential row-column independent component analysis for face recognition}, journal = {Neurocomputing}, volume = {72}, number = {4-6}, pages = {1152--1159}, year = {2009}, url = {https://doi.org/10.1016/j.neucom.2008.02.007}, doi = {10.1016/J.NEUCOM.2008.02.007}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/GaoZZ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijprai/NingZZW09, author = {Jifeng Ning and Lei Zhang and David Zhang and Chengke Wu}, title = {Robust Object Tracking Using Joint Color-Texture Histogram}, journal = {Int. J. Pattern Recognit. Artif. Intell.}, volume = {23}, number = {7}, pages = {1245--1263}, year = {2009}, url = {https://doi.org/10.1142/S0218001409007624}, doi = {10.1142/S0218001409007624}, timestamp = {Mon, 11 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijprai/NingZZW09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/KongZK09, author = {Adams Wai{-}Kin Kong and David Dapeng Zhang and Mohamed S. Kamel}, title = {A survey of palmprint recognition}, journal = {Pattern Recognit.}, volume = {42}, number = {7}, pages = {1408--1418}, year = {2009}, url = {https://doi.org/10.1016/j.patcog.2009.01.018}, doi = {10.1016/J.PATCOG.2009.01.018}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/KongZK09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/YueZZW09, author = {Feng Yue and Wangmeng Zuo and David Zhang and Kuanquan Wang}, title = {Orientation selection using modified {FCM} for competitive code-based palmprint recognition}, journal = {Pattern Recognit.}, volume = {42}, number = {11}, pages = {2841--2849}, year = {2009}, url = {https://doi.org/10.1016/j.patcog.2009.03.015}, doi = {10.1016/J.PATCOG.2009.03.015}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/YueZZW09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/GuoZZZ09, author = {Zhenhua Guo and David Zhang and Lei Zhang and Wangmeng Zuo}, title = {Palmprint verification using binary orientation co-occurrence vector}, journal = {Pattern Recognit. Lett.}, volume = {30}, number = {13}, pages = {1219--1227}, year = {2009}, url = {https://doi.org/10.1016/j.patrec.2009.05.010}, doi = {10.1016/J.PATREC.2009.05.010}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/prl/GuoZZZ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/ZhangLWZ09, author = {Lei Zhang and Rastislav Lukac and Xiaolin Wu and David Zhang}, title = {PCA-Based Spatially Adaptive Denoising of {CFA} Images for Single-Sensor Digital Cameras}, journal = {{IEEE} Trans. Image Process.}, volume = {18}, number = {4}, pages = {797--812}, year = {2009}, url = {https://doi.org/10.1109/TIP.2008.2011384}, doi = {10.1109/TIP.2008.2011384}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/ZhangLWZ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/titb/ZhangLYZ09, author = {Lei Zhang and Qin Li and Jane You and David Zhang}, title = {A Modified Matched Filter With Double-Sided Thresholding for Screening Proliferative Diabetic Retinopathy}, journal = {{IEEE} Trans. Inf. Technol. Biomed.}, volume = {13}, number = {4}, pages = {528--534}, year = {2009}, url = {https://doi.org/10.1109/TITB.2008.2007201}, doi = {10.1109/TITB.2008.2007201}, timestamp = {Wed, 13 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/titb/ZhangLYZ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/ZhangLLZL09, author = {David Zhang and Guangming Lu and Wei Li and Lei Zhang and Nan Luo}, title = {Palmprint Recognition Using 3-D Information}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {C}}, volume = {39}, number = {5}, pages = {505--519}, year = {2009}, url = {https://doi.org/10.1109/TSMCC.2009.2020790}, doi = {10.1109/TSMCC.2009.2020790}, timestamp = {Thu, 21 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/ZhangLLZL09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/accv/ZhangZZ09, author = {Lin Zhang and Lei Zhang and David Zhang}, editor = {Hongbin Zha and Rin{-}Ichiro Taniguchi and Stephen J. Maybank}, title = {A Multi-scale Bilateral Structure Tensor Based Corner Detector}, booktitle = {Computer Vision - {ACCV} 2009, 9th Asian Conference on Computer Vision, Xi'an, China, September 23-27, 2009, Revised Selected Papers, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {5995}, pages = {618--627}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-12304-7\_58}, doi = {10.1007/978-3-642-12304-7\_58}, timestamp = {Wed, 17 Feb 2021 15:51:19 +0100}, biburl = {https://dblp.org/rec/conf/accv/ZhangZZ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/caip/GuoZZ09, author = {Zhenhua Guo and David Zhang and Lei Zhang}, editor = {Xiaoyi Jiang and Nicolai Petkov}, title = {Is White Light the Best Illumination for Palmprint Recognition?}, booktitle = {Computer Analysis of Images and Patterns, 13th International Conference, {CAIP} 2009, M{\"{u}}nster, Germany, September 2-4, 2009. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {5702}, pages = {50--57}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-03767-2\_6}, doi = {10.1007/978-3-642-03767-2\_6}, timestamp = {Tue, 14 May 2019 10:00:53 +0200}, biburl = {https://dblp.org/rec/conf/caip/GuoZZ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/caip/LiTLZ09, author = {Rongfeng Li and Darun Tang and Wenxin Li and David Zhang}, editor = {Xiaoyi Jiang and Nicolai Petkov}, title = {Second-Level Partition for Estimating {FAR} Confidence Intervals in Biometric Systems}, booktitle = {Computer Analysis of Images and Patterns, 13th International Conference, {CAIP} 2009, M{\"{u}}nster, Germany, September 2-4, 2009. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {5702}, pages = {58--65}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-03767-2\_7}, doi = {10.1007/978-3-642-03767-2\_7}, timestamp = {Thu, 15 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/caip/LiTLZ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/caip/WuWXZ09, author = {Xiangqian Wu and Kuanquan Wang and Yong Xu and David Zhang}, editor = {Xiaoyi Jiang and Nicolai Petkov}, title = {Differential Feature Analysis for Palmprint Authentication}, booktitle = {Computer Analysis of Images and Patterns, 13th International Conference, {CAIP} 2009, M{\"{u}}nster, Germany, September 2-4, 2009. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {5702}, pages = {125--132}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-03767-2\_15}, doi = {10.1007/978-3-642-03767-2\_15}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/caip/WuWXZ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/caip/ZhangZZ09, author = {Lin Zhang and Lei Zhang and David Zhang}, editor = {Xiaoyi Jiang and Nicolai Petkov}, title = {Finger-Knuckle-Print Verification Based on Band-Limited Phase-Only Correlation}, booktitle = {Computer Analysis of Images and Patterns, 13th International Conference, {CAIP} 2009, M{\"{u}}nster, Germany, September 2-4, 2009. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {5702}, pages = {141--148}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-03767-2\_17}, doi = {10.1007/978-3-642-03767-2\_17}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/caip/ZhangZZ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/caip/GuoZZ09a, author = {Zhenhua Guo and Lei Zhang and David Zhang}, editor = {Xiaoyi Jiang and Nicolai Petkov}, title = {Rotation Invariant Texture Classification Using Binary Filter Response Pattern {(BFRP)}}, booktitle = {Computer Analysis of Images and Patterns, 13th International Conference, {CAIP} 2009, M{\"{u}}nster, Germany, September 2-4, 2009. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {5702}, pages = {1130--1137}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-03767-2\_137}, doi = {10.1007/978-3-642-03767-2\_137}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/caip/GuoZZ09a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/KanhangadKZ09, author = {Vivek Kanhangad and Ajay Kumar and David Zhang}, title = {Combining 2D and 3D hand geometry features for biometric verification}, booktitle = {{IEEE} Conference on Computer Vision and Pattern Recognition, {CVPR} Workshops 2009, Miami, FL, USA, 20-25 June, 2009}, pages = {39--44}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://doi.org/10.1109/CVPRW.2009.5204306}, doi = {10.1109/CVPRW.2009.5204306}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/KanhangadKZ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/ZhaoZZHB09, author = {Qijun Zhao and Lei Zhang and David Zhang and Wenyi Huang and Jian Bai}, title = {Curvature and singularity driven diffusion for oriented pattern enhancement with singular points}, booktitle = {2009 {IEEE} Computer Society Conference on Computer Vision and Pattern Recognition {(CVPR} 2009), 20-25 June 2009, Miami, Florida, {USA}}, pages = {2129--2135}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://doi.org/10.1109/CVPR.2009.5206490}, doi = {10.1109/CVPR.2009.5206490}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/ZhaoZZHB09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icb/ZhaoZZL09, author = {Qijun Zhao and Lei Zhang and David Zhang and Nan Luo}, editor = {Massimo Tistarelli and Mark S. Nixon}, title = {Direct Pore Matching for Fingerprint Recognition}, booktitle = {Advances in Biometrics, Third International Conference, {ICB} 2009, Alghero, Italy, June 2-5, 2009. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {5558}, pages = {597--606}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-01793-3\_61}, doi = {10.1007/978-3-642-01793-3\_61}, timestamp = {Tue, 14 May 2019 10:00:35 +0200}, biburl = {https://dblp.org/rec/conf/icb/ZhaoZZL09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icic/LiuZZ09, author = {Heng Liu and David Zhang and Zhiyuan Zhang}, editor = {De{-}Shuang Huang and Kang{-}Hyun Jo and Hong{-}Hee Lee and Hee{-}Jun Kang and Vitoantonio Bevilacqua}, title = {Multi-view Ear Recognition Based on Moving Least Square Pose Interpolation}, booktitle = {Emerging Intelligent Computing Technology and Applications. With Aspects of Artificial Intelligence, 5th International Conference on Intelligent Computing, {ICIC} 2009, Ulsan, South Korea, September 16-19, 2009, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {5755}, pages = {1085--1095}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-04020-7\_116}, doi = {10.1007/978-3-642-04020-7\_116}, timestamp = {Wed, 13 Sep 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icic/LiuZZ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/LiZZY09, author = {Wei Li and Lei Zhang and David Zhang and Jingqi Yan}, title = {Principal line based {ICP} alignment for palmprint verification}, booktitle = {Proceedings of the International Conference on Image Processing, {ICIP} 2009, 7-10 November 2009, Cairo, Egypt}, pages = {1961--1964}, publisher = {{IEEE}}, year = {2009}, url = {https://doi.org/10.1109/ICIP.2009.5413459}, doi = {10.1109/ICIP.2009.5413459}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/icip/LiZZY09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/ZhangZZ09, author = {Lin Zhang and Lei Zhang and David Zhang}, title = {Finger-knuckle-print: {A} new biometric identifier}, booktitle = {Proceedings of the International Conference on Image Processing, {ICIP} 2009, 7-10 November 2009, Cairo, Egypt}, pages = {1981--1984}, publisher = {{IEEE}}, year = {2009}, url = {https://doi.org/10.1109/ICIP.2009.5413734}, doi = {10.1109/ICIP.2009.5413734}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icip/ZhangZZ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/GuoZZZ09, author = {Zhenhua Guo and Wangmeng Zuo and Lei Zhang and David Zhang}, title = {Palmprint verification using consistent orientation coding}, booktitle = {Proceedings of the International Conference on Image Processing, {ICIP} 2009, 7-10 November 2009, Cairo, Egypt}, pages = {1985--1988}, publisher = {{IEEE}}, year = {2009}, url = {https://doi.org/10.1109/ICIP.2009.5413728}, doi = {10.1109/ICIP.2009.5413728}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icip/GuoZZZ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iscid/SongZ09, author = {Fengxi Song and David Zhang}, editor = {Yongchuan Tang and Jonathan Lawry}, title = {The Negative Effects of Whitening Transformation in Face Recognition}, booktitle = {2009 Second International Symposium on Computational Intelligence and Design, {ISCID} 2009, Changsha, Hunan, China, 12-14 December 2009, 2 Volumes}, pages = {437--440}, publisher = {{IEEE} Computer Society}, year = {2009}, url = {https://doi.org/10.1109/ISCID.2009.255}, doi = {10.1109/ISCID.2009.255}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iscid/SongZ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isnn/ZuoLWZ09, author = {Wangmeng Zuo and Lei Liu and Kuanquan Wang and David Zhang}, editor = {Wen Yu and Haibo He and Nian Zhang}, title = {Spatially Smooth Subspace Face Recognition Using {LOG} and {DOG} Penalties}, booktitle = {Advances in Neural Networks - {ISNN} 2009, 6th International Symposium on Neural Networks, {ISNN} 2009, Wuhan, China, May 26-29, 2009, Proceedings, Part {III}}, series = {Lecture Notes in Computer Science}, volume = {5553}, pages = {439--448}, publisher = {Springer}, year = {2009}, url = {https://doi.org/10.1007/978-3-642-01513-7\_48}, doi = {10.1007/978-3-642-01513-7\_48}, timestamp = {Tue, 14 May 2019 10:00:36 +0200}, biburl = {https://dblp.org/rec/conf/isnn/ZuoLWZ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/smc/WeiZZ09, author = {Li Wei and Lei Zhang and David Zhang}, title = {Three Dimensional Palmprint Recognition}, booktitle = {Proceedings of the {IEEE} International Conference on Systems, Man and Cybernetics, San Antonio, TX, USA, 11-14 October 2009}, pages = {4847--4852}, publisher = {{IEEE}}, year = {2009}, url = {https://doi.org/10.1109/ICSMC.2009.5346053}, doi = {10.1109/ICSMC.2009.5346053}, timestamp = {Wed, 16 Oct 2019 14:14:51 +0200}, biburl = {https://dblp.org/rec/conf/smc/WeiZZ09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:reference/bio/ZhangK09, author = {David Zhang and Vivek Kanhangad}, editor = {Stan Z. Li and Anil K. Jain}, title = {Palmprint, 3D}, booktitle = {Encyclopedia of Biometrics}, pages = {1037--1042}, publisher = {Springer {US}}, year = {2009}, url = {https://doi.org/10.1007/978-0-387-73003-5\_264}, doi = {10.1007/978-0-387-73003-5\_264}, timestamp = {Fri, 27 Oct 2017 15:34:05 +0200}, biburl = {https://dblp.org/rec/reference/bio/ZhangK09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:reference/bio/ZhangL09, author = {David Zhang and Laura Li Liu}, editor = {Stan Z. Li and Anil K. Jain}, title = {Palmprint Features}, booktitle = {Encyclopedia of Biometrics}, pages = {1043--1049}, publisher = {Springer {US}}, year = {2009}, url = {https://doi.org/10.1007/978-0-387-73003-5\_266}, doi = {10.1007/978-0-387-73003-5\_266}, timestamp = {Thu, 21 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/reference/bio/ZhangL09.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/amc/GaoZZ08, author = {Quanxue Gao and Lei Zhang and David Zhang}, title = {Face recognition using {FLDA} with single training image per person}, journal = {Appl. Math. Comput.}, volume = {205}, number = {2}, pages = {726--734}, year = {2008}, url = {https://doi.org/10.1016/j.amc.2008.05.019}, doi = {10.1016/J.AMC.2008.05.019}, timestamp = {Fri, 21 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/amc/GaoZZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/appml/ShaoYZ08, author = {Zhendong Shao and Roger K. Yeh and David Zhang}, title = {The L(2, 1)-labeling on graphs and the frequency assignment problem}, journal = {Appl. Math. Lett.}, volume = {21}, number = {1}, pages = {37--41}, year = {2008}, url = {https://doi.org/10.1016/j.aml.2006.08.029}, doi = {10.1016/J.AML.2006.08.029}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/appml/ShaoYZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/appml/ShaoZ08, author = {Zhendong Shao and David Zhang}, title = {The L(2, 1)-labeling on Cartesian sum of graphs}, journal = {Appl. Math. Lett.}, volume = {21}, number = {8}, pages = {843--848}, year = {2008}, url = {https://doi.org/10.1016/j.aml.2007.08.010}, doi = {10.1016/J.AML.2007.08.010}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/appml/ShaoZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/fcsc/YangYZ08, author = {Jian Yang and Jing{-}Yu Yang and David Zhang}, title = {Median Fisher Discriminator: a robust feature extraction method with applications to biometrics}, journal = {Frontiers Comput. Sci. China}, volume = {2}, number = {3}, pages = {295--305}, year = {2008}, url = {https://doi.org/10.1007/s11704-008-0029-4}, doi = {10.1007/S11704-008-0029-4}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/fcsc/YangYZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijig/FengZYH08, author = {Guiyu Feng and David Zhang and Jian Yang and Dewen Hu}, title = {A Theoretical Framework for Matrix-Based Feature Extraction Algorithms with its Application to Image Recognition}, journal = {Int. J. Image Graph.}, volume = {8}, number = {1}, pages = {1--23}, year = {2008}, url = {https://doi.org/10.1142/S0219467808002940}, doi = {10.1142/S0219467808002940}, timestamp = {Tue, 24 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijig/FengZYH08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/XuZYY08, author = {Yong Xu and David Zhang and Jian Yang and Jing{-}Yu Yang}, title = {An approach for directly extracting features from matrix data and its application in face recognition}, journal = {Neurocomputing}, volume = {71}, number = {10-12}, pages = {1857--1865}, year = {2008}, url = {https://doi.org/10.1016/j.neucom.2007.09.021}, doi = {10.1016/J.NEUCOM.2007.09.021}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijon/XuZYY08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/SongLZY08, author = {Fengxi Song and Hang Liu and David Zhang and Jing{-}Yu Yang}, title = {A highly scalable incremental facial feature extraction method}, journal = {Neurocomputing}, volume = {71}, number = {10-12}, pages = {1883--1888}, year = {2008}, url = {https://doi.org/10.1016/j.neucom.2007.09.022}, doi = {10.1016/J.NEUCOM.2007.09.022}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijon/SongLZY08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/JingYYZ08, author = {Xiao{-}Yuan Jing and Yong{-}Fang Yao and Jing{-}Yu Yang and David Zhang}, title = {A novel face recognition approach based on kernel discriminative common vectors {(KDCV)} feature extraction and {RBF} neural network}, journal = {Neurocomputing}, volume = {71}, number = {13-15}, pages = {3044--3048}, year = {2008}, url = {https://doi.org/10.1016/j.neucom.2007.08.027}, doi = {10.1016/J.NEUCOM.2007.08.027}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijon/JingYYZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/paa/ZuoZW08, author = {Wangmeng Zuo and David Zhang and Kuanquan Wang}, title = {On kernel difference-weighted \emph{k}-nearest neighbor classification}, journal = {Pattern Anal. Appl.}, volume = {11}, number = {3-4}, pages = {247--257}, year = {2008}, url = {https://doi.org/10.1007/s10044-007-0100-z}, doi = {10.1007/S10044-007-0100-Z}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/paa/ZuoZW08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/HuangJZ08, author = {De{-}Shuang Huang and Wei Jia and David Zhang}, title = {Palmprint verification based on principal lines}, journal = {Pattern Recognit.}, volume = {41}, number = {4}, pages = {1316--1328}, year = {2008}, url = {https://doi.org/10.1016/j.patcog.2007.08.016}, doi = {10.1016/J.PATCOG.2007.08.016}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/HuangJZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/KongZK08, author = {Adams Wai{-}Kin Kong and David Zhang and Mohamed Kamel}, title = {Three measures for secure palmprint identification}, journal = {Pattern Recognit.}, volume = {41}, number = {4}, pages = {1329--1337}, year = {2008}, url = {https://doi.org/10.1016/j.patcog.2007.09.002}, doi = {10.1016/J.PATCOG.2007.09.002}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/KongZK08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/JiaHZ08, author = {Wei Jia and De{-}Shuang Huang and David Zhang}, title = {Palmprint verification based on robust line orientation code}, journal = {Pattern Recognit.}, volume = {41}, number = {5}, pages = {1504--1513}, year = {2008}, url = {https://doi.org/10.1016/j.patcog.2007.10.011}, doi = {10.1016/J.PATCOG.2007.10.011}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/JiaHZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/ZhaoLZZ08, author = {Tuo Zhao and Zhizheng Liang and David Zhang and Quan Zou}, title = {Interest filter vs. interest operator: Face recognition using Fisher linear discriminant based on interest filter representation}, journal = {Pattern Recognit. Lett.}, volume = {29}, number = {13}, pages = {1849--1857}, year = {2008}, url = {https://doi.org/10.1016/j.patrec.2008.05.023}, doi = {10.1016/J.PATREC.2008.05.023}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/prl/ZhaoLZZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/sigarch/ZhangLRA08, author = {David Zhang and Qiuyuan J. Li and Rodric M. Rabbah and Saman P. Amarasinghe}, title = {A lightweight streaming layer for multicore execution}, journal = {{SIGARCH} Comput. Archit. News}, volume = {36}, number = {2}, pages = {18--27}, year = {2008}, url = {https://doi.org/10.1145/1399972.1399978}, doi = {10.1145/1399972.1399978}, timestamp = {Sun, 02 Oct 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/sigarch/ZhangLRA08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcas/ShaoKSZ08, author = {Zhendong Shao and Sandi Klavzar and Wai Chee Shiu and David Zhang}, title = {Improved Bounds on the L(2, 1)-Number of Direct and Strong Products of Graphs}, journal = {{IEEE} Trans. Circuits Syst. {II} Express Briefs}, volume = {55-II}, number = {7}, pages = {685--689}, year = {2008}, url = {https://doi.org/10.1109/TCSII.2008.921411}, doi = {10.1109/TCSII.2008.921411}, timestamp = {Wed, 27 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcas/ShaoKSZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcas/ShiuSPZ08, author = {Wai Chee Shiu and Zhendong Shao and Kin Keung Poon and David Zhang}, title = {A New Approach to the L(2, 1) -Labeling of Some Products of Graphs}, journal = {{IEEE} Trans. Circuits Syst. {II} Express Briefs}, volume = {55-II}, number = {8}, pages = {802--805}, year = {2008}, url = {https://doi.org/10.1109/TCSII.2008.922450}, doi = {10.1109/TCSII.2008.922450}, timestamp = {Wed, 27 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcas/ShiuSPZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcs/ShaoZ08, author = {Zhendong Shao and David Zhang}, title = {Improved upper bounds on the L(2, 1) -labeling of the skew and converse skew product graphs}, journal = {Theor. Comput. Sci.}, volume = {400}, number = {1-3}, pages = {230--233}, year = {2008}, url = {https://doi.org/10.1016/j.tcs.2008.02.048}, doi = {10.1016/J.TCS.2008.02.048}, timestamp = {Wed, 17 Feb 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tcs/ShaoZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/KanhangadKZ08, author = {Vivek Kanhangad and Ajay Kumar and David Zhang}, title = {Comments on "An Adaptive Multimodal Biometric Management Algorithm"}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {C}}, volume = {38}, number = {6}, pages = {841--843}, year = {2008}, url = {https://doi.org/10.1109/TSMCC.2008.2001570}, doi = {10.1109/TSMCC.2008.2001570}, timestamp = {Thu, 21 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/KanhangadKZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/bmei/ZhangZZZ08, author = {Dongyu Zhang and Lei Zhang and David Zhang and Yongping Zheng}, title = {Wavelet Based Analysis of Doppler Ultrasonic Wrist-pulse Signals}, booktitle = {Proceedings of the 2008 International Conference on BioMedical Engineering and Informatics, {BMEI} 2008, May 28-30, 2008, Sanya, Hainan, China - Volume 2}, pages = {539--543}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/BMEI.2008.326}, doi = {10.1109/BMEI.2008.326}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/bmei/ZhangZZZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/ZhangGZ08, author = {Lei Zhang and Quanxue Gao and David Zhang}, title = {Directional independent component analysis with tensor representation}, booktitle = {2008 {IEEE} Computer Society Conference on Computer Vision and Pattern Recognition {(CVPR} 2008), 24-26 June 2008, Anchorage, Alaska, {USA}}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/CVPR.2008.4587667}, doi = {10.1109/CVPR.2008.4587667}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/ZhangGZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icarcv/KumarZ08, author = {Ajay Kumar and David Zhang}, title = {Incorporating user quality for performance improvement in hand identification}, booktitle = {10th International Conference on Control, Automation, Robotics and Vision, {ICARCV} 2008, Hanoi, Vietnam, 17-20 December 2008, Proceedings}, pages = {1133--1136}, publisher = {{IEEE}}, year = {2008}, url = {https://doi.org/10.1109/ICARCV.2008.4795680}, doi = {10.1109/ICARCV.2008.4795680}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/icarcv/KumarZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/LiZYZB08, author = {Qin Li and Lei Zhang and Jane You and David Zhang and Prabir Bhattacharya}, title = {Dark line detection with line width extraction}, booktitle = {Proceedings of the International Conference on Image Processing, {ICIP} 2008, October 12-15, 2008, San Diego, California, {USA}}, pages = {621--624}, publisher = {{IEEE}}, year = {2008}, url = {https://doi.org/10.1109/ICIP.2008.4711831}, doi = {10.1109/ICIP.2008.4711831}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/icip/LiZYZB08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icnc/WuQW008, author = {Xiangqian Wu and Ning Qi and Kuanquan Wang and David Zhang}, editor = {Maozu Guo and Liang Zhao and Lipo Wang}, title = {A Novel Cryptosystem Based on Iris Key Generation}, booktitle = {Fourth International Conference on Natural Computation, {ICNC} 2008, Jinan, Shandong, China, 18-20 October 2008, Volume 4}, pages = {53--56}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/ICNC.2008.808}, doi = {10.1109/ICNC.2008.808}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icnc/WuQW008.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/KumarKZ08, author = {Ajay Kumar and Vivek Kanhangad and David Zhang}, title = {Multimodal biometrics management using adaptive score-level combination}, booktitle = {19th International Conference on Pattern Recognition {(ICPR} 2008), December 8-11, 2008, Tampa, Florida, {USA}}, pages = {1--4}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/ICPR.2008.4761879}, doi = {10.1109/ICPR.2008.4761879}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/KumarKZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/LiuZKW08, author = {Laura Li Liu and David Zhang and Ajay Kumar and Xiangqian Wu}, title = {Tongue line extraction}, booktitle = {19th International Conference on Pattern Recognition {(ICPR} 2008), December 8-11, 2008, Tampa, Florida, {USA}}, pages = {1--4}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/ICPR.2008.4761651}, doi = {10.1109/ICPR.2008.4761651}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/LiuZKW08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/WuWZ08, author = {Xiangqian Wu and Kuanquan Wang and David Zhang}, title = {A cryptosystem based on palmprint feature}, booktitle = {19th International Conference on Pattern Recognition {(ICPR} 2008), December 8-11, 2008, Tampa, Florida, {USA}}, pages = {1--4}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/ICPR.2008.4761117}, doi = {10.1109/ICPR.2008.4761117}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/WuWZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/YueZWZ08, author = {Feng Yue and Wangmeng Zuo and Kuanquan Wang and David Zhang}, title = {A performance evaluation of filter design and coding schemes for palmprint recognition}, booktitle = {19th International Conference on Pattern Recognition {(ICPR} 2008), December 8-11, 2008, Tampa, Florida, {USA}}, pages = {1--4}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/ICPR.2008.4761845}, doi = {10.1109/ICPR.2008.4761845}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/YueZWZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/YueZWZ08a, author = {Feng Yue and Wangmeng Zuo and Kuanquan Wang and David Zhang}, title = {FCM-based orientation selection for competitive coding-based palmprint recognition}, booktitle = {19th International Conference on Pattern Recognition {(ICPR} 2008), December 8-11, 2008, Tampa, Florida, {USA}}, pages = {1--4}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/ICPR.2008.4761846}, doi = {10.1109/ICPR.2008.4761846}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/YueZWZ08a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/ZhaoZZLB08, author = {Qijun Zhao and Lei Zhang and David Zhang and Nan Luo and Jing Bao}, title = {Adaptive pore model for fingerprint pore extraction}, booktitle = {19th International Conference on Pattern Recognition {(ICPR} 2008), December 8-11, 2008, Tampa, Florida, {USA}}, pages = {1--4}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/ICPR.2008.4761458}, doi = {10.1109/ICPR.2008.4761458}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/ZhaoZZLB08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/ZuoYWZ08, author = {Wangmeng Zuo and Feng Yue and Kuanquan Wang and David Zhang}, title = {Multiscale competitive code for efficient palmprint recognition}, booktitle = {19th International Conference on Pattern Recognition {(ICPR} 2008), December 8-11, 2008, Tampa, Florida, {USA}}, pages = {1--4}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/ICPR.2008.4761868}, doi = {10.1109/ICPR.2008.4761868}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/ZuoYWZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iih-msp/WuQWZ08, author = {Xiangqian Wu and Ning Qi and Kuanquan Wang and David Zhang}, editor = {Jeng{-}Shyang Pan and Xiamu Niu and Hsiang{-}Cheh Huang and Lakhmi C. Jain}, title = {An Iris Cryptosystem for Information Security}, booktitle = {4th International Conference on Intelligent Information Hiding and Multimedia Signal Processing {(IIH-MSP} 2008), Harbin, China, 15-17 August 2008, Proceedings}, pages = {1533--1536}, publisher = {{IEEE} Computer Society}, year = {2008}, url = {https://doi.org/10.1109/IIH-MSP.2008.83}, doi = {10.1109/IIH-MSP.2008.83}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iih-msp/WuQWZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/medbiometrics/LiuZ08, author = {Laura Li Liu and David Zhang}, editor = {David Zhang}, title = {Extracting Tongue Cracks Using the Wide Line Detector}, booktitle = {Medical Biometrics, First International Conference, {ICMB} 2008, Hong Kong, China, January 4-5, 2008, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4901}, pages = {49--56}, publisher = {Springer}, year = {2008}, url = {https://doi.org/10.1007/978-3-540-77413-6\_7}, doi = {10.1007/978-3-540-77413-6\_7}, timestamp = {Tue, 14 May 2019 10:00:39 +0200}, biburl = {https://dblp.org/rec/conf/medbiometrics/LiuZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/smc/JiaHTZ08, author = {Wei Jia and De{-}Shuang Huang and Dacheng Tao and David Zhang}, title = {Palmprint identification based on directional representation}, booktitle = {Proceedings of the {IEEE} International Conference on Systems, Man and Cybernetics, Singapore, 12-15 October 2008}, pages = {1562--1567}, publisher = {{IEEE}}, year = {2008}, url = {https://doi.org/10.1109/ICSMC.2008.4811509}, doi = {10.1109/ICSMC.2008.4811509}, timestamp = {Wed, 16 Oct 2019 14:14:51 +0200}, biburl = {https://dblp.org/rec/conf/smc/JiaHTZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sspr/XuZ08, author = {Yong Xu and David Zhang}, editor = {Niels da Vitoria Lobo and Takis Kasparis and Fabio Roli and James Tin{-}Yau Kwok and Michael Georgiopoulos and Georgios C. Anagnostopoulos and Marco Loog}, title = {A New Solution Scheme of Unsupervised Locality Preserving Projection Method for the {SSS} Problem}, booktitle = {Structural, Syntactic, and Statistical Pattern Recognition, Joint {IAPR} International Workshop, {SSPR} {\&} {SPR} 2008, Orlando, USA, December 4-6, 2008. Proceedings}, series = {Lecture Notes in Computer Science}, volume = {5342}, pages = {775--781}, publisher = {Springer}, year = {2008}, url = {https://doi.org/10.1007/978-3-540-89689-0\_81}, doi = {10.1007/978-3-540-89689-0\_81}, timestamp = {Tue, 14 May 2019 10:00:36 +0200}, biburl = {https://dblp.org/rec/conf/sspr/XuZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/wsc/JohnstonSYZ08, author = {Lenrick Johnston and Lee Schruben and Arden Yang and David Zhang}, editor = {Scott J. Mason and Raymond R. Hill and Lars M{\"{o}}nch and Oliver Rose and Thomas Jefferson and John W. Fowler}, title = {Establishing the credibility of a biotech simulation model}, booktitle = {Proceedings of the 2008 Winter Simulation Conference, Global Gateway to Discovery, {WSC} 2008, InterContinental Hotel, Miami, Florida, USA, December 7-10, 2008}, pages = {822--826}, publisher = {{WSC}}, year = {2008}, url = {https://doi.org/10.1109/WSC.2008.4736145}, doi = {10.1109/WSC.2008.4736145}, timestamp = {Thu, 10 Jun 2021 22:19:17 +0200}, biburl = {https://dblp.org/rec/conf/wsc/JohnstonSYZ08.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/medbiometrics/2008, editor = {David Zhang}, title = {Medical Biometrics, First International Conference, {ICMB} 2008, Hong Kong, China, January 4-5, 2008, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4901}, publisher = {Springer}, year = {2008}, url = {https://doi.org/10.1007/978-3-540-77413-6}, doi = {10.1007/978-3-540-77413-6}, isbn = {978-3-540-77410-5}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/medbiometrics/2008.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/appml/ShaoYZ07, author = {Zhendong Shao and Roger K. Yeh and David Zhang}, title = {The \emph{L}(2, 1)-labeling on the skew and converse skew products of graphs}, journal = {Appl. Math. Lett.}, volume = {20}, number = {1}, pages = {59--64}, year = {2007}, url = {https://doi.org/10.1016/j.aml.2006.02.032}, doi = {10.1016/J.AML.2006.02.032}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/appml/ShaoYZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cbm/XuZWLW07, author = {Lisheng Xu and David Zhang and Kuanquan Wang and Naimin Li and Xiaoyun Wang}, title = {Baseline wander correction in pulse waveforms using wavelet-based cascaded adaptive filter}, journal = {Comput. Biol. Medicine}, volume = {37}, number = {5}, pages = {716--731}, year = {2007}, url = {https://doi.org/10.1016/j.compbiomed.2006.06.014}, doi = {10.1016/J.COMPBIOMED.2006.06.014}, timestamp = {Sat, 05 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cbm/XuZWLW07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cim/ZhangZ07, author = {David Zhang and Wangmeng Zuo}, title = {Computational Intelligence-Based Biometric Technologies}, journal = {{IEEE} Comput. Intell. Mag.}, volume = {2}, number = {2}, pages = {26--36}, year = {2007}, url = {https://doi.org/10.1109/MCI.2007.353418}, doi = {10.1109/MCI.2007.353418}, timestamp = {Tue, 01 Jun 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cim/ZhangZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cmig/ZhiZYLT07, author = {Liu Zhi and David Zhang and Jingqi Yan and Qingli Li and Qun{-}lin Tang}, title = {Classification of hyperspectral medical tongue images for tongue diagnosis}, journal = {Comput. Medical Imaging Graph.}, volume = {31}, number = {8}, pages = {672--678}, year = {2007}, url = {https://doi.org/10.1016/j.compmedimag.2007.07.008}, doi = {10.1016/J.COMPMEDIMAG.2007.07.008}, timestamp = {Thu, 20 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cmig/ZhiZYLT07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cviu/ZhangZ07, author = {Lei Zhang and David Zhang}, title = {A joint demosaicking-zooming scheme for single chip digital color cameras}, journal = {Comput. Vis. Image Underst.}, volume = {107}, number = {1-2}, pages = {14--25}, year = {2007}, url = {https://doi.org/10.1016/j.cviu.2006.11.006}, doi = {10.1016/J.CVIU.2006.11.006}, timestamp = {Fri, 21 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cviu/ZhangZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/ZuoWZZ07, author = {Wangmeng Zuo and Kuanquan Wang and David Zhang and Hongzhi Zhang}, title = {Combination of two novel LDA-based methods for face recognition}, journal = {Neurocomputing}, volume = {70}, number = {4-6}, pages = {735--742}, year = {2007}, url = {https://doi.org/10.1016/j.neucom.2006.10.008}, doi = {10.1016/J.NEUCOM.2006.10.008}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/ZuoWZZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/YuWZ07, author = {Li Yu and Kuanquan Wang and David Zhang}, title = {Extracting the autonomic nerve wreath of iris based on an improved snake approach}, journal = {Neurocomputing}, volume = {70}, number = {4-6}, pages = {743--748}, year = {2007}, url = {https://doi.org/10.1016/j.neucom.2006.10.009}, doi = {10.1016/J.NEUCOM.2006.10.009}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/YuWZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/XuZSYJL07, author = {Yong Xu and David Zhang and Fengxi Song and Jing{-}Yu Yang and Zhong Jing and Miao Li}, title = {A method for speeding up feature extraction based on {KPCA}}, journal = {Neurocomputing}, volume = {70}, number = {4-6}, pages = {1056--1061}, year = {2007}, url = {https://doi.org/10.1016/j.neucom.2006.09.005}, doi = {10.1016/J.NEUCOM.2006.09.005}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijon/XuZSYJL07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/SongZWLT07, author = {Fengxi Song and David Zhang and Jizhong Wang and Hang Liu and Qing Tao}, title = {A parameterized direct {LDA} and its application to face recognition}, journal = {Neurocomputing}, volume = {71}, number = {1-3}, pages = {191--196}, year = {2007}, url = {https://doi.org/10.1016/j.neucom.2007.01.003}, doi = {10.1016/J.NEUCOM.2007.01.003}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/SongZWLT07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijprai/SongZXW07, author = {Fengxi Song and David Zhang and Yong Xu and Jizhong Wang}, title = {Five New Feature Selection Metrics in Text Categorization}, journal = {Int. J. Pattern Recognit. Artif. Intell.}, volume = {21}, number = {6}, pages = {1085--1101}, year = {2007}, url = {https://doi.org/10.1142/S0218001407005831}, doi = {10.1142/S0218001407005831}, timestamp = {Mon, 11 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijprai/SongZXW07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jcst/SongZCY07, author = {Fengxi Song and David Zhang and Cai{-}Kou Chen and Jing{-}Yu Yang}, title = {Facial Feature Extraction Method Based on Coefficients of Variances}, journal = {J. Comput. Sci. Technol.}, volume = {22}, number = {4}, pages = {626--632}, year = {2007}, url = {https://doi.org/10.1007/s11390-007-9070-2}, doi = {10.1007/S11390-007-9070-2}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jcst/SongZCY07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/paa/SongZCW07, author = {Fengxi Song and David Zhang and Qinglong Chen and Jizhong Wang}, title = {Face recognition based on a novel linear discriminant criterion}, journal = {Pattern Anal. Appl.}, volume = {10}, number = {3}, pages = {165--174}, year = {2007}, url = {https://doi.org/10.1007/s10044-006-0057-3}, doi = {10.1007/S10044-006-0057-3}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/paa/SongZCW07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pami/YangZYN07, author = {Jian Yang and David Zhang and Jing{-}Yu Yang and Ben Niu}, title = {Globally Maximizing, Locally Minimizing: Unsupervised Discriminant Projection with Applications to Face and Palm Biometrics}, journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.}, volume = {29}, number = {4}, pages = {650--664}, year = {2007}, url = {https://doi.org/10.1109/TPAMI.2007.1008}, doi = {10.1109/TPAMI.2007.1008}, timestamp = {Thu, 15 Feb 2024 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pami/YangZYN07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/YuZW07, author = {Li Yu and David Zhang and Kuanquan Wang}, title = {The relative distance of key point based iris recognition}, journal = {Pattern Recognit.}, volume = {40}, number = {2}, pages = {423--430}, year = {2007}, url = {https://doi.org/10.1016/j.patcog.2006.03.008}, doi = {10.1016/J.PATCOG.2006.03.008}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/YuZW07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/LiangZS07, author = {Zhizheng Liang and David Zhang and Pengfei Shi}, title = {The theoretical analysis of {GLRAM} and its applications}, journal = {Pattern Recognit.}, volume = {40}, number = {3}, pages = {1032--1041}, year = {2007}, url = {https://doi.org/10.1016/j.patcog.2006.04.038}, doi = {10.1016/J.PATCOG.2006.04.038}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/LiangZS07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/LamLZ07, author = {Toby H. W. Lam and Raymond S. T. Lee and David Zhang}, title = {Human gait recognition by the fusion of motion and static spatio-temporal templates}, journal = {Pattern Recognit.}, volume = {40}, number = {9}, pages = {2563--2573}, year = {2007}, url = {https://doi.org/10.1016/j.patcog.2006.11.014}, doi = {10.1016/J.PATCOG.2006.11.014}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/LamLZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/JingYZYL07, author = {Xiao{-}Yuan Jing and Yong{-}Fang Yao and David Zhang and Jing{-}Yu Yang and Miao Li}, title = {Face and palmprint pixel level fusion and Kernel {DCV-RBF} classifier for small sample biometric recognition}, journal = {Pattern Recognit.}, volume = {40}, number = {11}, pages = {3209--3224}, year = {2007}, url = {https://doi.org/10.1016/j.patcog.2007.01.034}, doi = {10.1016/J.PATCOG.2007.01.034}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/JingYZYL07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tifs/KumarZ07, author = {Ajay Kumar and David Zhang}, title = {Hand-Geometry Recognition Using Entropy-Based Discretization}, journal = {{IEEE} Trans. Inf. Forensics Secur.}, volume = {2}, number = {2}, pages = {181--187}, year = {2007}, url = {https://doi.org/10.1109/TIFS.2007.896915}, doi = {10.1109/TIFS.2007.896915}, timestamp = {Thu, 06 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tifs/KumarZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/LiuZY07, author = {L. Liu and David Zhang and Jane You}, title = {Detecting Wide Lines Using Isotropic Nonlinear Filtering}, journal = {{IEEE} Trans. Image Process.}, volume = {16}, number = {6}, pages = {1584--1595}, year = {2007}, url = {https://doi.org/10.1109/TIP.2007.894288}, doi = {10.1109/TIP.2007.894288}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/LiuZY07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/ZhangWZ07, author = {Lei Zhang and Xiaolin Wu and David Zhang}, title = {Color Reproduction From Noisy {CFA} Data of Single Sensor Digital Cameras}, journal = {{IEEE} Trans. Image Process.}, volume = {16}, number = {9}, pages = {2184--2197}, year = {2007}, url = {https://doi.org/10.1109/TIP.2007.901807}, doi = {10.1109/TIP.2007.901807}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/ZhangWZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/YangZY07, author = {Jian Yang and David Zhang and Jing{-}Yu Yang}, title = {Constructing {PCA} Baseline Algorithms to Reevaluate ICA-Based Face-Recognition Performance}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {B}}, volume = {37}, number = {4}, pages = {1015--1021}, year = {2007}, url = {https://doi.org/10.1109/TSMCB.2007.891541}, doi = {10.1109/TSMCB.2007.891541}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/YangZY07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/GaoZZY07, author = {Quanxue Gao and Lei Zhang and David Zhang and Jian Yang}, title = {Comments on "On Image Matrix Based Feature Extraction Algorithms"}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {B}}, volume = {37}, number = {5}, pages = {1373--1374}, year = {2007}, url = {https://doi.org/10.1109/TSMCB.2007.899415}, doi = {10.1109/TSMCB.2007.899415}, timestamp = {Mon, 18 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/GaoZZY07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/SongZMG07, author = {Fengxi Song and David Zhang and Dayong Mei and Zhongwei Guo}, title = {A Multiple Maximum Scatter Difference Discriminant Criterion for Facial Feature Extraction}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {B}}, volume = {37}, number = {6}, pages = {1599--1606}, year = {2007}, url = {https://doi.org/10.1109/TSMCB.2007.906579}, doi = {10.1109/TSMCB.2007.906579}, timestamp = {Mon, 18 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/SongZMG07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tvt/ZhouGZ07, author = {Jie Zhou and Dashan Gao and David Zhang}, title = {Moving Vehicle Detection for Automatic Traffic Monitoring}, journal = {{IEEE} Trans. Veh. Technol.}, volume = {56}, number = {1}, pages = {51--59}, year = {2007}, url = {https://doi.org/10.1109/TVT.2006.883735}, doi = {10.1109/TVT.2006.883735}, timestamp = {Wed, 16 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tvt/ZhouGZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/IEEEicci/LinZSXZ07, author = {Fen Lin and David Dapeng Zhang and Zhongzhi Shi and Minjie Xu and Yuanbing Zhou}, editor = {Du Zhang and Yingxu Wang and Witold Kinsner}, title = {A Novel Simulation Approach For Estimating Residential Power Demand Based on Multi-Agent Society}, booktitle = {Proceedings of the Six {IEEE} International Conference on Cognitive Informatics, {ICCI} 2007, August 6-8, Lake Tahoe, CA, {USA}}, pages = {450--455}, publisher = {{IEEE} Computer Society}, year = {2007}, url = {https://doi.org/10.1109/COGINF.2007.4341923}, doi = {10.1109/COGINF.2007.4341923}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/IEEEicci/LinZSXZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/adma/WuZWQ07, author = {Xiangqian Wu and David Zhang and Kuanquan Wang and Ning Qi}, editor = {Reda Alhajj and Hong Gao and Xue Li and Jianzhong Li and Osmar R. Za{\"{\i}}ane}, title = {Fusion of Palmprint and Iris for Personal Authentication}, booktitle = {Advanced Data Mining and Applications, Third International Conference, {ADMA} 2007, Harbin, China, August 6-8, 2007, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4632}, pages = {466--475}, publisher = {Springer}, year = {2007}, url = {https://doi.org/10.1007/978-3-540-73871-8\_43}, doi = {10.1007/978-3-540-73871-8\_43}, timestamp = {Mon, 31 Aug 2020 16:04:32 +0200}, biburl = {https://dblp.org/rec/conf/adma/WuZWQ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/emmcvpr/WuWZQ07, author = {Xiangqian Wu and Kuanquan Wang and David Zhang and Ning Qi}, editor = {Alan L. Yuille and Song Chun Zhu and Daniel Cremers and Yongtian Wang}, title = {Combining Left and Right Irises for Personal Authentication}, booktitle = {Energy Minimization Methods in Computer Vision and Pattern Recognition, 6th International Conference, {EMMCVPR} 2007, Ezhou, China, August 27-29, 2007, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4679}, pages = {145--152}, publisher = {Springer}, year = {2007}, url = {https://doi.org/10.1007/978-3-540-74198-5\_12}, doi = {10.1007/978-3-540-74198-5\_12}, timestamp = {Tue, 14 May 2019 10:00:54 +0200}, biburl = {https://dblp.org/rec/conf/emmcvpr/WuWZQ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icassp/KumarZ07, author = {Ajay Kumar and David Zhang}, title = {Biometric Recognition using Entropy-Based Discretization}, booktitle = {Proceedings of the {IEEE} International Conference on Acoustics, Speech, and Signal Processing, {ICASSP} 2007, Honolulu, Hawaii, USA, April 15-20, 2007}, pages = {125--128}, publisher = {{IEEE}}, year = {2007}, url = {https://doi.org/10.1109/ICASSP.2007.366188}, doi = {10.1109/ICASSP.2007.366188}, timestamp = {Mon, 22 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icassp/KumarZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icassp/WanZZ07, author = {Dingrui Wan and Jie Zhou and David Zhang}, title = {A Spherical Rectification for Dual-PTZ-Camera System}, booktitle = {Proceedings of the {IEEE} International Conference on Acoustics, Speech, and Signal Processing, {ICASSP} 2007, Honolulu, Hawaii, USA, April 15-20, 2007}, pages = {777--780}, publisher = {{IEEE}}, year = {2007}, url = {https://doi.org/10.1109/ICASSP.2007.366023}, doi = {10.1109/ICASSP.2007.366023}, timestamp = {Mon, 22 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icassp/WanZZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icb/ZhouGZ07, author = {Jie Zhou and Jinwei Gu and David Zhang}, editor = {Seong{-}Whan Lee and Stan Z. Li}, title = {Singular Points Analysis in Fingerprints Based on Topological Structure and Orientation Field}, booktitle = {Advances in Biometrics, International Conference, {ICB} 2007, Seoul, Korea, August 27-29, 2007, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4642}, pages = {261--270}, publisher = {Springer}, year = {2007}, url = {https://doi.org/10.1007/978-3-540-74549-5\_28}, doi = {10.1007/978-3-540-74549-5\_28}, timestamp = {Wed, 16 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icb/ZhouGZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icb/ZhaoLZL07, author = {Tuo Zhao and Zhizheng Liang and David Zhang and Yahui Liu}, editor = {Seong{-}Whan Lee and Stan Z. Li}, title = {A Novel Null Space-Based Kernel Discriminant Analysis for Face Recognition}, booktitle = {Advances in Biometrics, International Conference, {ICB} 2007, Seoul, Korea, August 27-29, 2007, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4642}, pages = {547--556}, publisher = {Springer}, year = {2007}, url = {https://doi.org/10.1007/978-3-540-74549-5\_58}, doi = {10.1007/978-3-540-74549-5\_58}, timestamp = {Thu, 17 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icb/ZhaoLZL07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icb/LiWZ07, author = {Bin Li and Kuanquan Wang and David Zhang}, editor = {Seong{-}Whan Lee and Stan Z. Li}, title = {Minimizing Spatial Deformation Method for Online Signature Matching}, booktitle = {Advances in Biometrics, International Conference, {ICB} 2007, Seoul, Korea, August 27-29, 2007, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4642}, pages = {646--652}, publisher = {Springer}, year = {2007}, url = {https://doi.org/10.1007/978-3-540-74549-5\_68}, doi = {10.1007/978-3-540-74549-5\_68}, timestamp = {Tue, 25 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icb/LiWZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icb/WuZW07, author = {Xiangqian Wu and David Zhang and Kuanquan Wang}, editor = {Seong{-}Whan Lee and Stan Z. Li}, title = {A Palmprint Cryptosystem}, booktitle = {Advances in Biometrics, International Conference, {ICB} 2007, Seoul, Korea, August 27-29, 2007, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4642}, pages = {1035--1042}, publisher = {Springer}, year = {2007}, url = {https://doi.org/10.1007/978-3-540-74549-5\_108}, doi = {10.1007/978-3-540-74549-5\_108}, timestamp = {Thu, 27 Sep 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icb/WuZW07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icb/ZhangLYS07, author = {David Zhang and Zhi Liu and Jingqi Yan and Pengfei Shi}, editor = {Seong{-}Whan Lee and Stan Z. Li}, title = {Tongue-Print: {A} Novel Biometrics Pattern}, booktitle = {Advances in Biometrics, International Conference, {ICB} 2007, Seoul, Korea, August 27-29, 2007, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4642}, pages = {1174--1183}, publisher = {Springer}, year = {2007}, url = {https://doi.org/10.1007/978-3-540-74549-5\_122}, doi = {10.1007/978-3-540-74549-5\_122}, timestamp = {Thu, 17 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icb/ZhangLYS07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iciap/ZhangGZ07, author = {Lei Zhang and Quanxue Gao and David Zhang}, editor = {Rita Cucchiara}, title = {Block Independent Component Analysis for Face Recognition}, booktitle = {14th International Conference on Image Analysis and Processing {(ICIAP} 2007), 10-14 September 2007, Modena, Italy}, pages = {217--222}, publisher = {{IEEE} Computer Society}, year = {2007}, url = {https://doi.org/10.1109/ICIAP.2007.4362782}, doi = {10.1109/ICIAP.2007.4362782}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iciap/ZhangGZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icic/ZuoWZZ07, author = {Wangmeng Zuo and Kuanquan Wang and Hongzhi Zhang and David Zhang}, editor = {De{-}Shuang Huang and Laurent Heutte and Marco Loog}, title = {Kernel Difference-Weighted k-Nearest Neighbors Classification}, booktitle = {Advanced Intelligent Computing Theories and Applications. With Aspects of Artificial Intelligence, Third International Conference on Intelligent Computing, {ICIC} 2007, Qingdao, China, August 21-24, 2007, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4682}, pages = {861--870}, publisher = {Springer}, year = {2007}, url = {https://doi.org/10.1007/978-3-540-74205-0\_89}, doi = {10.1007/978-3-540-74205-0\_89}, timestamp = {Tue, 14 May 2019 10:00:53 +0200}, biburl = {https://dblp.org/rec/conf/icic/ZuoWZZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/ZhangGWZ07, author = {Lei Zhang and Zhenhua Guo and Zhou Wang and David Zhang}, title = {Palmprint Verification using Complex Wavelet Transform}, booktitle = {Proceedings of the International Conference on Image Processing, {ICIP} 2007, September 16-19, 2007, San Antonio, Texas, {USA}}, pages = {417--420}, publisher = {{IEEE}}, year = {2007}, url = {https://doi.org/10.1109/ICIP.2007.4379181}, doi = {10.1109/ICIP.2007.4379181}, timestamp = {Fri, 30 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icip/ZhangGWZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icnc/ZhaoZLZ07, author = {Tianwen Zhao and Qijun Zhao and Hongtao Lu and David Zhang}, editor = {Jingsheng Lei and JingTao Yao and Qingfu Zhang}, title = {Bagging Evolutionary Feature Extraction Algorithm for Classification}, booktitle = {Third International Conference on Natural Computation, {ICNC} 2007, Haikou, Hainan, China, 24-27 August 2007, Volume 3}, pages = {540--545}, publisher = {{IEEE} Computer Society}, year = {2007}, url = {https://doi.org/10.1109/ICNC.2007.280}, doi = {10.1109/ICNC.2007.280}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icnc/ZhaoZLZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iih-msp/ShenXLZ07, author = {Bo Shen and Yong Xu and Guangming Lu and David Zhang}, editor = {Bin{-}Yih Liao and Jeng{-}Shyang Pan and Lakhmi C. Jain and Mark Liao and Hideki Noda and Anthony T. S. Ho}, title = {Detecting Iris Lacunae Based on Gaussian Filter}, booktitle = {3rd International Conference on Intelligent Information Hiding and Multimedia Signal Processing {(IIH-MSP} 2007), Kaohsiung, Taiwan, 26-28 November 2007, Proceedings}, pages = {233--236}, publisher = {{IEEE} Computer Society}, year = {2007}, url = {https://doi.org/10.1109/IIHMSP.2007.4457533}, doi = {10.1109/IIHMSP.2007.4457533}, timestamp = {Fri, 24 Mar 2023 08:33:27 +0100}, biburl = {https://dblp.org/rec/conf/iih-msp/ShenXLZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isnn/ZuoWZY07, author = {Wangmeng Zuo and Kuanquan Wang and David Zhang and Feng Yue}, editor = {Derong Liu and Shumin Fei and Zeng{-}Guang Hou and Huaguang Zhang and Changyin Sun}, title = {Iteratively Reweighted Fitting for Reduced Multivariate Polynomial Model}, booktitle = {Advances in Neural Networks - {ISNN} 2007, 4th International Symposium on Neural Networks, {ISNN} 2007, Nanjing, China, June 3-7, 2007, Proceedings, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {4492}, pages = {583--592}, publisher = {Springer}, year = {2007}, url = {https://doi.org/10.1007/978-3-540-72393-6\_70}, doi = {10.1007/978-3-540-72393-6\_70}, timestamp = {Tue, 14 May 2019 10:00:36 +0200}, biburl = {https://dblp.org/rec/conf/isnn/ZuoWZY07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iwec/WuWZ07, author = {Xiangqian Wu and Kuanquan Wang and David Zhang}, editor = {Lizhuang Ma and Matthias Rauterberg and Ryohei Nakatsu}, title = {Automated Personal Authentication Using Both Palmprints}, booktitle = {Entertainment Computing - {ICEC} 2007, 6th International Conference, Shanghai, China, September 15-17, 2007, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4740}, pages = {450--453}, publisher = {Springer}, year = {2007}, url = {https://doi.org/10.1007/978-3-540-74873-1\_58}, doi = {10.1007/978-3-540-74873-1\_58}, timestamp = {Fri, 27 Mar 2020 09:01:01 +0100}, biburl = {https://dblp.org/rec/conf/iwec/WuWZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:series/sci/LiZ07, author = {Yanlai Li and David Zhang}, editor = {Ke Chen and Lipo Wang}, title = {Modular Neural Networks and Their Applications in Biometrics}, booktitle = {Trends in Neural Computation}, series = {Studies in Computational Intelligence}, volume = {35}, pages = {337--365}, publisher = {Springer}, year = {2007}, url = {https://doi.org/10.1007/978-3-540-36122-0\_14}, doi = {10.1007/978-3-540-36122-0\_14}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/series/sci/LiZ07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@incollection{DBLP:series/smpai/LuZKL07, author = {Guangming Lu and David Zhang and Adams Wai{-}Kin Kong and Qingmin Liao}, editor = {Svetlana N. Yanushkevich and Marina L. Gavrilova and Patrick S. P. Wang and Sargur N. Srihari}, title = {Palmprint Identification by Fused Wavelet Characteristics}, booktitle = {Image Pattern Recognition - Synthesis and Analysis in Biometrics}, series = {Series in Machine Perception and Artificial Intelligence}, volume = {67}, pages = {225--242}, publisher = {WorldScientific}, year = {2007}, url = {https://doi.org/10.1142/9789812770677\_0009}, doi = {10.1142/9789812770677\_0009}, timestamp = {Sun, 25 Jul 2021 11:34:35 +0200}, biburl = {https://dblp.org/rec/series/smpai/LuZKL07.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ejasp/XuZWW06, author = {Lisheng Xu and David Zhang and Kuanquan Wang and Lu Wang}, title = {Arrhythmic Pulses Detection Using Lempel-Ziv Complexity Analysis}, journal = {{EURASIP} J. Adv. Signal Process.}, volume = {2006}, year = {2006}, url = {https://doi.org/10.1155/ASP/2006/18268}, doi = {10.1155/ASP/2006/18268}, timestamp = {Sat, 05 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ejasp/XuZWW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijig/LiPZ06, author = {Li Li and Zhigeng Pan and David Zhang}, title = {A Public Mesh Watermarking Algorithm Based on Addition Property of Fourier Transform}, journal = {Int. J. Image Graph.}, volume = {6}, number = {1}, pages = {35--44}, year = {2006}, url = {https://doi.org/10.1142/S0219467806002070}, doi = {10.1142/S0219467806002070}, timestamp = {Tue, 24 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijig/LiPZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijig/KumarZ06, author = {Ajay Kumar and David Zhang}, title = {Integrating Shape and Texture for Hand Verification}, journal = {Int. J. Image Graph.}, volume = {6}, number = {1}, pages = {101--114}, year = {2006}, url = {https://doi.org/10.1142/S0219467806002148}, doi = {10.1142/S0219467806002148}, timestamp = {Tue, 24 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijig/KumarZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijig/LiZW06, author = {Bin Li and David Zhang and Kuanquan Wang}, title = {Online Signature Verification by Combining Shape Contexts and Local Features}, journal = {Int. J. Image Graph.}, volume = {6}, number = {3}, pages = {407--420}, year = {2006}, url = {https://doi.org/10.1142/S0219467806002318}, doi = {10.1142/S0219467806002318}, timestamp = {Tue, 25 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijig/LiZW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/LiangZS06, author = {Zhizheng Liang and David Zhang and Pengfei Shi}, title = {Robust kernel discriminant analysis and its application to feature extraction and recognition}, journal = {Neurocomputing}, volume = {69}, number = {7-9}, pages = {928--933}, year = {2006}, url = {https://doi.org/10.1016/j.neucom.2005.09.001}, doi = {10.1016/J.NEUCOM.2005.09.001}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/LiangZS06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/SongZY06, author = {Fengxi Song and David Zhang and Jing{-}Yu Yang}, title = {A novel dimensionality-reduction approach for face recognition}, journal = {Neurocomputing}, volume = {69}, number = {13-15}, pages = {1683--1687}, year = {2006}, url = {https://doi.org/10.1016/j.neucom.2006.01.016}, doi = {10.1016/J.NEUCOM.2006.01.016}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijon/SongZY06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/YangZY06, author = {Jian Yang and David Zhang and Jing{-}Yu Yang}, title = {Locally principal component learning for face representation and recognition}, journal = {Neurocomputing}, volume = {69}, number = {13-15}, pages = {1697--1701}, year = {2006}, url = {https://doi.org/10.1016/j.neucom.2006.01.009}, doi = {10.1016/J.NEUCOM.2006.01.009}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijon/YangZY06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/FengHZZ06, author = {Guiyu Feng and Dewen Hu and David Zhang and Zongtan Zhou}, title = {An alternative formulation of kernel {LPP} with application to image recognition}, journal = {Neurocomputing}, volume = {69}, number = {13-15}, pages = {1733--1738}, year = {2006}, url = {https://doi.org/10.1016/j.neucom.2006.01.006}, doi = {10.1016/J.NEUCOM.2006.01.006}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/FengHZZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/LiuYZ06, author = {Heng Liu and Jingqi Yan and David Zhang}, title = {Three-dimensional surface registration: {A} neural network strategy}, journal = {Neurocomputing}, volume = {70}, number = {1-3}, pages = {597--602}, year = {2006}, url = {https://doi.org/10.1016/j.neucom.2006.04.004}, doi = {10.1016/J.NEUCOM.2006.04.004}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/LiuYZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/imst/ZhangZWZ06, author = {Hongzhi Zhang and Wangmeng Zuo and Kuanquan Wang and David Zhang}, title = {A snake-based approach to automated segmentation of tongue image using polar edge detector}, journal = {Int. J. Imaging Syst. Technol.}, volume = {16}, number = {4}, pages = {103--112}, year = {2006}, url = {https://doi.org/10.1002/ima.20075}, doi = {10.1002/IMA.20075}, timestamp = {Thu, 18 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/imst/ZhangZWZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/npl/LiZW06, author = {Yanlai Li and David Zhang and Kuanquan Wang}, title = {Parameter by Parameter Algorithm for Multilayer Perceptrons}, journal = {Neural Process. Lett.}, volume = {23}, number = {2}, pages = {229--242}, year = {2006}, url = {https://doi.org/10.1007/s11063-006-0003-9}, doi = {10.1007/S11063-006-0003-9}, timestamp = {Thu, 09 Jul 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/npl/LiZW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/paa/LiZW06, author = {Bin Li and David Zhang and Kuanquan Wang}, title = {Online signature verification based on null component analysis and principal component analysis}, journal = {Pattern Anal. Appl.}, volume = {8}, number = {4}, pages = {345--356}, year = {2006}, url = {https://doi.org/10.1007/s10044-005-0016-4}, doi = {10.1007/S10044-005-0016-4}, timestamp = {Tue, 25 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/paa/LiZW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/paa/WuZW06, author = {Xiangqian Wu and David Zhang and Kuanquan Wang}, title = {Fusion of phase and orientation information for palmprint authentication}, journal = {Pattern Anal. Appl.}, volume = {9}, number = {2-3}, pages = {103--111}, year = {2006}, url = {https://doi.org/10.1007/s10044-005-0006-6}, doi = {10.1007/S10044-005-0006-6}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/paa/WuZW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ZhaoLZ06, author = {Qijun Zhao and Hongtao Lu and David Zhang}, title = {A fast evolutionary pursuit algorithm based on linearly combining vectors}, journal = {Pattern Recognit.}, volume = {39}, number = {2}, pages = {310--312}, year = {2006}, url = {https://doi.org/10.1016/j.patcog.2005.09.001}, doi = {10.1016/J.PATCOG.2005.09.001}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/ZhaoLZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/KongZK06, author = {Adams Wai{-}Kin Kong and David Zhang and Mohamed Kamel}, title = {Palmprint identification using feature-level fusion}, journal = {Pattern Recognit.}, volume = {39}, number = {3}, pages = {478--487}, year = {2006}, url = {https://doi.org/10.1016/j.patcog.2005.08.014}, doi = {10.1016/J.PATCOG.2005.08.014}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/KongZK06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/JingWZ06, author = {Xiao{-}Yuan Jing and Hau{-}San Wong and David Zhang}, title = {Face recognition based on 2D Fisherface approach}, journal = {Pattern Recognit.}, volume = {39}, number = {4}, pages = {707--710}, year = {2006}, url = {https://doi.org/10.1016/j.patcog.2005.10.020}, doi = {10.1016/J.PATCOG.2005.10.020}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/JingWZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/XuZJLY06, author = {Yong Xu and David Zhang and Zhong Jin and Miao Li and Jing{-}Yu Yang}, title = {A fast kernel-based nonlinear discriminant analysis for multi-class problems}, journal = {Pattern Recognit.}, volume = {39}, number = {6}, pages = {1026--1033}, year = {2006}, url = {https://doi.org/10.1016/j.patcog.2005.10.029}, doi = {10.1016/J.PATCOG.2005.10.029}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/XuZJLY06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/KongCZKY06, author = {Adams Wai{-}Kin Kong and King Hong Cheung and David Zhang and Mohamed S. Kamel and Jane You}, title = {An analysis of BioHashing and its variants}, journal = {Pattern Recognit.}, volume = {39}, number = {7}, pages = {1359--1368}, year = {2006}, url = {https://doi.org/10.1016/j.patcog.2005.10.025}, doi = {10.1016/J.PATCOG.2005.10.025}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/KongCZKY06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/KongZL06, author = {Adams Wai{-}Kin Kong and David Zhang and Guangming Lu}, title = {A study of identical twins' palmprints for personal verification}, journal = {Pattern Recognit.}, volume = {39}, number = {11}, pages = {2149--2156}, year = {2006}, url = {https://doi.org/10.1016/j.patcog.2006.04.035}, doi = {10.1016/J.PATCOG.2006.04.035}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/KongZL06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/LiuYZ06, author = {Heng Liu and Jingqi Yan and David Zhang}, title = {What is wrong with mesh {PCA} in coordinate direction normalization}, journal = {Pattern Recognit.}, volume = {39}, number = {11}, pages = {2244--2247}, year = {2006}, url = {https://doi.org/10.1016/j.patcog.2006.05.019}, doi = {10.1016/J.PATCOG.2006.05.019}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/LiuYZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/ZuoZW06, author = {Wangmeng Zuo and David Zhang and Kuanquan Wang}, title = {An assembled matrix distance metric for 2DPCA-based image recognition}, journal = {Pattern Recognit. Lett.}, volume = {27}, number = {3}, pages = {210--216}, year = {2006}, url = {https://doi.org/10.1016/j.patrec.2005.08.017}, doi = {10.1016/J.PATREC.2005.08.017}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/prl/ZuoZW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/JingWZ06, author = {Xiao{-}Yuan Jing and Hau{-}San Wong and David Zhang}, title = {Face recognition based on discriminant fractional Fourier feature extraction}, journal = {Pattern Recognit. Lett.}, volume = {27}, number = {13}, pages = {1465--1471}, year = {2006}, url = {https://doi.org/10.1016/j.patrec.2006.02.020}, doi = {10.1016/J.PATREC.2006.02.020}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/prl/JingWZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/KumarZ06, author = {Ajay Kumar and David Zhang}, title = {Personal recognition using hand shape and texture}, journal = {{IEEE} Trans. Image Process.}, volume = {15}, number = {8}, pages = {2454--2461}, year = {2006}, url = {https://doi.org/10.1109/TIP.2006.875214}, doi = {10.1109/TIP.2006.875214}, timestamp = {Sun, 10 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/KumarZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/ZuoZW06, author = {Wangmeng Zuo and David Zhang and Kuanquan Wang}, title = {Bidirectional {PCA} with assembled matrix distance metric for image recognition}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {B}}, volume = {36}, number = {4}, pages = {863--872}, year = {2006}, url = {https://doi.org/10.1109/TSMCB.2006.872274}, doi = {10.1109/TSMCB.2006.872274}, timestamp = {Sat, 30 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/ZuoZW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/ZuoZYW06, author = {Wangmeng Zuo and David Zhang and Jian Yang and Kuanquan Wang}, title = {{BDPCA} plus {LDA:} a novel fast feature extraction technique for face recognition}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {B}}, volume = {36}, number = {4}, pages = {946--953}, year = {2006}, url = {https://doi.org/10.1109/TSMCB.2005.863377}, doi = {10.1109/TSMCB.2005.863377}, timestamp = {Sat, 30 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/ZuoZYW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/WuZW06, author = {Xiangqian Wu and David Zhang and Kuanquan Wang}, title = {Palm line extraction and matching for personal authentication}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {A}}, volume = {36}, number = {5}, pages = {978--987}, year = {2006}, url = {https://doi.org/10.1109/TSMCA.2006.871797}, doi = {10.1109/TSMCA.2006.871797}, timestamp = {Mon, 25 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/WuZW06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/KongZK06, author = {Adams Wai{-}Kin Kong and David Zhang and Mohamed Kamel}, title = {Analysis of Brute-Force Break-Ins of a Palmprint Authentication System}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {B}}, volume = {36}, number = {5}, pages = {1201--1205}, year = {2006}, url = {https://doi.org/10.1109/TSMCB.2006.876168}, doi = {10.1109/TSMCB.2006.876168}, timestamp = {Sat, 30 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/KongZK06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tvcg/YanYSZ06, author = {Jingqi Yan and Xin Yang and Pengfei Shi and David Zhang}, title = {Mesh Parameterization by Minimizing the Synthesized Distortion Metric with the Coefficient-Optimizing Algorithm}, journal = {{IEEE} Trans. Vis. Comput. Graph.}, volume = {12}, number = {1}, pages = {83--92}, year = {2006}, url = {https://doi.org/10.1109/TVCG.2006.10}, doi = {10.1109/TVCG.2006.10}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tvcg/YanYSZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/aaai/ZhaoZL06, author = {Qijun Zhao and David Zhang and Hongtao Lu}, title = {A Direct Evolutionary Feature Extraction Algorithm for Classifying High Dimensional Data}, booktitle = {Proceedings, The Twenty-First National Conference on Artificial Intelligence and the Eighteenth Innovative Applications of Artificial Intelligence Conference, July 16-20, 2006, Boston, Massachusetts, {USA}}, pages = {561--566}, publisher = {{AAAI} Press}, year = {2006}, url = {http://www.aaai.org/Library/AAAI/2006/aaai06-090.php}, timestamp = {Tue, 05 Sep 2023 09:10:47 +0200}, biburl = {https://dblp.org/rec/conf/aaai/ZhaoZL06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/accv/LiangSZ06, author = {Zhizheng Liang and Pengfei Shi and David Zhang}, editor = {P. J. Narayanan and Shree K. Nayar and Heung{-}Yeung Shum}, title = {Two-Dimensional Fisher Discriminant Analysis and Its Application to Face Recognition}, booktitle = {Computer Vision - {ACCV} 2006, 7th Asian Conference on Computer Vision, Hyderabad, India, January 13-16, 2006, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {3851}, pages = {130--139}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11612032\_14}, doi = {10.1007/11612032\_14}, timestamp = {Thu, 17 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/accv/LiangSZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icarcv/YangZY06, author = {Jian Yang and David Zhang and Jing{-}Yu Yang}, title = {"Non-locality" Preserving Projection and Its Application to Palmprint Recognition}, booktitle = {Ninth International Conference on Control, Automation, Robotics and Vision, {ICARCV} 2006, Singapore, 5-8 December 2006, Proceedings}, pages = {1--4}, publisher = {{IEEE}}, year = {2006}, url = {https://doi.org/10.1109/ICARCV.2006.345339}, doi = {10.1109/ICARCV.2006.345339}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icarcv/YangZY06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icb/YangZXY06, author = {Jian Yang and David Zhang and Yong Xu and Jing{-}Yu Yang}, editor = {David Zhang and Anil K. Jain}, title = {Recognize Color Face Images Using Complex Eigenfaces}, booktitle = {Advances in Biometrics, International Conference, {ICB} 2006, Hong Kong, China, January 5-7, 2006, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3832}, pages = {64--68}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11608288\_9}, doi = {10.1007/11608288\_9}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icb/YangZXY06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icb/ZuoWZ06, author = {Wangmeng Zuo and Kuanquan Wang and David Zhang}, editor = {David Zhang and Anil K. Jain}, title = {Improvement on Null Space {LDA} for Face Recognition: {A} Symmetry Consideration}, booktitle = {Advances in Biometrics, International Conference, {ICB} 2006, Hong Kong, China, January 5-7, 2006, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3832}, pages = {78--84}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11608288\_11}, doi = {10.1007/11608288\_11}, timestamp = {Tue, 26 Jun 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icb/ZuoWZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icb/CheungKZKY06, author = {King Hong Cheung and Adams Wai{-}Kin Kong and David Zhang and Mohamed Kamel and Jane You}, editor = {David Zhang and Anil K. Jain}, title = {Revealing the Secret of FaceHashing}, booktitle = {Advances in Biometrics, International Conference, {ICB} 2006, Hong Kong, China, January 5-7, 2006, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3832}, pages = {106--112}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11608288\_15}, doi = {10.1007/11608288\_15}, timestamp = {Tue, 26 Jun 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icb/CheungKZKY06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icb/YuWZ06, author = {Li Yu and Kuanquan Wang and David Zhang}, editor = {David Zhang and Anil K. Jain}, title = {A Novel Method for Coarse Iris Classification}, booktitle = {Advances in Biometrics, International Conference, {ICB} 2006, Hong Kong, China, January 5-7, 2006, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3832}, pages = {404--410}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11608288\_54}, doi = {10.1007/11608288\_54}, timestamp = {Tue, 26 Jun 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icb/YuWZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icb/KongZL06, author = {Adams Wai{-}Kin Kong and David Zhang and Guangming Lu}, editor = {David Zhang and Anil K. Jain}, title = {A Study of Identical Twins' Palmprints for Personal Authentication}, booktitle = {Advances in Biometrics, International Conference, {ICB} 2006, Hong Kong, China, January 5-7, 2006, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3832}, pages = {668--674}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11608288\_89}, doi = {10.1007/11608288\_89}, timestamp = {Tue, 26 Jun 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icb/KongZL06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icb/JingLZ06, author = {Xiao{-}Yuan Jing and Chen Lu and David Zhang}, editor = {David Zhang and Anil K. Jain}, title = {An Uncorrelated Fisherface Approach for Face and Palmprint Recognition}, booktitle = {Advances in Biometrics, International Conference, {ICB} 2006, Hong Kong, China, January 5-7, 2006, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3832}, pages = {682--687}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11608288\_91}, doi = {10.1007/11608288\_91}, timestamp = {Tue, 26 Jun 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icb/JingLZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccsa/LiuYZ06, author = {Heng Liu and Jingqi Yan and David Zhang}, editor = {Marina L. Gavrilova and Osvaldo Gervasi and Vipin Kumar and Chih Jeng Kenneth Tan and David Taniar and Antonio Lagan{\`{a}} and Youngsong Mun and Hyunseung Choo}, title = {A Neural Network Strategy for 3D Surface Registration}, booktitle = {Computational Science and Its Applications - {ICCSA} 2006, International Conference, Glasgow, UK, May 8-11, 2006, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {3980}, pages = {528--536}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11751540\_56}, doi = {10.1007/11751540\_56}, timestamp = {Thu, 28 Apr 2022 16:17:38 +0200}, biburl = {https://dblp.org/rec/conf/iccsa/LiuYZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/LiZZB06, author = {Qin Li and Lei Zhang and David Zhang and Prabir Bhattacharya}, title = {A New Approach to Automated Retinal Vessel Segmentation Using Multiscale Analysis}, booktitle = {18th International Conference on Pattern Recognition {(ICPR} 2006), 20-24 August 2006, Hong Kong, China}, pages = {77--80}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/ICPR.2006.112}, doi = {10.1109/ICPR.2006.112}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/LiZZB06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/KongZK06, author = {Adams Wai{-}Kin Kong and David Zhang and Mohamed Kamel}, title = {An Anatomy of IrisCode for Precise Phase Representation}, booktitle = {18th International Conference on Pattern Recognition {(ICPR} 2006), 20-24 August 2006, Hong Kong, China}, pages = {429--432}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/ICPR.2006.234}, doi = {10.1109/ICPR.2006.234}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/KongZK06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/CheungKZKY06, author = {King Hong Cheung and Adams Wai{-}Kin Kong and David Zhang and Mohamed Kamel and Jane You}, title = {Does EigenPalm work? {A} System and Evaluation Perspective}, booktitle = {18th International Conference on Pattern Recognition {(ICPR} 2006), 20-24 August 2006, Hong Kong, China}, pages = {445--448}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/ICPR.2006.460}, doi = {10.1109/ICPR.2006.460}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/CheungKZKY06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/KumarZ06, author = {Ajay Kumar and David Zhang}, title = {Combining Fingerprint, Palmprint and Hand-Shape for User Authentication}, booktitle = {18th International Conference on Pattern Recognition {(ICPR} 2006), 20-24 August 2006, Hong Kong, China}, pages = {549--552}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/ICPR.2006.383}, doi = {10.1109/ICPR.2006.383}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/KumarZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/YangZJY06, author = {Jian Yang and David Zhang and Zhong Jin and Jing{-}Yu Yang}, title = {Unsupervised Discriminant Projection Analysis for Feature Extraction}, booktitle = {18th International Conference on Pattern Recognition {(ICPR} 2006), 20-24 August 2006, Hong Kong, China}, pages = {904--907}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/ICPR.2006.1143}, doi = {10.1109/ICPR.2006.1143}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/YangZJY06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isda/WuWJZ06, author = {Xiangqian Wu and Kuanquan Wang and Liao Jing and David Zhang}, title = {Graph based Cross-shape Recognition for Palm Diagnosis}, booktitle = {Proceedings of the Sixth International Conference on Intelligent Systems Design and Applications {(ISDA} 2006), October 16-18, 2006, Jinan, China}, pages = {325--328}, publisher = {{IEEE} Computer Society}, year = {2006}, url = {https://doi.org/10.1109/ISDA.2006.253855}, doi = {10.1109/ISDA.2006.253855}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/isda/WuWJZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isnn/ZhaoLZ06, author = {Qijun Zhao and Hongtao Lu and David Zhang}, editor = {Jun Wang and Zhang Yi and Jacek M. Zurada and Bao{-}Liang Lu and Hujun Yin}, title = {Parsimonious Feature Extraction Based on Genetic Algorithms and Support Vector Machines}, booktitle = {Advances in Neural Networks - {ISNN} 2006, Third International Symposium on Neural Networks, Chengdu, China, May 28 - June 1, 2006, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {3971}, pages = {1387--1393}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11759966\_206}, doi = {10.1007/11759966\_206}, timestamp = {Tue, 14 May 2019 10:00:36 +0200}, biburl = {https://dblp.org/rec/conf/isnn/ZhaoLZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pcm/WuWZ06, author = {Xiangqian Wu and Kuanquan Wang and David Zhang}, editor = {Yueting Zhuang and Shiqiang Yang and Yong Rui and Qinming He}, title = {Differential Operation Based Palmprint Authentication for Multimedia Security}, booktitle = {Advances in Multimedia Information Processing - {PCM} 2006, 7th Pacific Rim Conference on Multimedia, Hangzhou, China, November 2-4, 2006, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4261}, pages = {237--244}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11922162\_28}, doi = {10.1007/11922162\_28}, timestamp = {Tue, 14 May 2019 10:00:54 +0200}, biburl = {https://dblp.org/rec/conf/pcm/WuWZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/pcm/ZuoWZ06, author = {Wangmeng Zuo and Kuanquan Wang and David Zhang}, editor = {Yueting Zhuang and Shiqiang Yang and Yong Rui and Qinming He}, title = {Robust Recognition of Noisy and Partially Occluded Faces Using Iteratively Reweighted Fitting of Eigenfaces}, booktitle = {Advances in Multimedia Information Processing - {PCM} 2006, 7th Pacific Rim Conference on Multimedia, Hangzhou, China, November 2-4, 2006, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4261}, pages = {844--851}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11922162\_96}, doi = {10.1007/11922162\_96}, timestamp = {Sat, 16 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/pcm/ZuoWZ06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/psivt/SongZCY06, author = {Fengxi Song and David Zhang and Qinglong Chen and Jing{-}Yu Yang}, editor = {Long{-}Wen Chang and Wen{-}Nung Lie}, title = {A Novel Supervised Dimensionality Reduction Algorithm for Online Image Recognition}, booktitle = {Advances in Image and Video Technology, First Pacific Rim Symposium, {PSIVT} 2006, Hsinchu, Taiwan, December 10-13, 2006, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {4319}, pages = {198--207}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11949534\_20}, doi = {10.1007/11949534\_20}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/psivt/SongZCY06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/smc/YangZY06, author = {Jian Yang and David Zhang and Jing{-}Yu Yang}, title = {Median {LDA:} {A} Robust Feature Extraction Method for Face Recognition}, booktitle = {Proceedings of the {IEEE} International Conference on Systems, Man and Cybernetics, Taipei, Taiwan, October 8-11, 2006}, pages = {4208--4213}, publisher = {{IEEE}}, year = {2006}, url = {https://doi.org/10.1109/ICSMC.2006.384795}, doi = {10.1109/ICSMC.2006.384795}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/smc/YangZY06.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icb/2006, editor = {David Zhang and Anil K. Jain}, title = {Advances in Biometrics, International Conference, {ICB} 2006, Hong Kong, China, January 5-7, 2006, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3832}, publisher = {Springer}, year = {2006}, url = {https://doi.org/10.1007/11608288}, doi = {10.1007/11608288}, isbn = {3-540-31111-4}, timestamp = {Thu, 17 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icb/2006.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/automatica/ZhangXSZ05, author = {Huanshui Zhang and Lihua Xie and Yeng Chai Soh and David Zhang}, title = {H\({}_{\mbox{infinity}}\) Fixed-lag smoothing for discrete linear time-varying systems}, journal = {Autom.}, volume = {41}, number = {5}, pages = {839--846}, year = {2005}, url = {https://doi.org/10.1016/j.automatica.2004.11.028}, doi = {10.1016/J.AUTOMATICA.2004.11.028}, timestamp = {Thu, 20 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/automatica/ZhangXSZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/JingWZT05, author = {Xiao{-}Yuan Jing and Hau{-}San Wong and David Zhang and Yuan Yan Tang}, title = {An uncorrelated fisherface approach}, journal = {Neurocomputing}, volume = {67}, pages = {328--334}, year = {2005}, url = {https://doi.org/10.1016/j.neucom.2005.01.001}, doi = {10.1016/J.NEUCOM.2005.01.001}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/JingWZT05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/isci/PangZW05, author = {Bo Pang and David Zhang and Kuanquan Wang}, title = {Tongue image analysis for appendicitis diagnosis}, journal = {Inf. Sci.}, volume = {175}, number = {3}, pages = {160--176}, year = {2005}, url = {https://doi.org/10.1016/j.ins.2005.01.010}, doi = {10.1016/J.INS.2005.01.010}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/isci/PangZW05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jcst/ZhangLKW05, author = {David Zhang and Guangming Lu and Adams Wai{-}Kin Kong and Michael Wong}, title = {Online Palmprint Identification System for Civil Applications}, journal = {J. Comput. Sci. Technol.}, volume = {20}, number = {1}, pages = {70--76}, year = {2005}, url = {https://doi.org/10.1007/s11390-005-0008-2}, doi = {10.1007/S11390-005-0008-2}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jcst/ZhangLKW05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jcst/WuWZ05, author = {Xiangqian Wu and Kuanquan Wang and David Zhang}, title = {Wavelet Energy Feature Extraction and Matching for Palmprint Recognition}, journal = {J. Comput. Sci. Technol.}, volume = {20}, number = {3}, pages = {411--418}, year = {2005}, url = {https://doi.org/10.1007/s11390-005-0411-8}, doi = {10.1007/S11390-005-0411-8}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jcst/WuWZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pami/YangFYZJ05, author = {Jian Yang and Alejandro F. Frangi and Jing{-}Yu Yang and David Zhang and Zhong Jin}, title = {{KPCA} Plus {LDA:} {A} Complete Kernel Fisher Discriminant Framework for Feature Extraction and Recognition}, journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.}, volume = {27}, number = {2}, pages = {230--244}, year = {2005}, url = {https://doi.org/10.1109/TPAMI.2005.33}, doi = {10.1109/TPAMI.2005.33}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pami/YangFYZJ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/JingTZ05, author = {Xiao{-}Yuan Jing and Yuan Yan Tang and David Zhang}, title = {A Fourier-LDA approach for image recognition}, journal = {Pattern Recognit.}, volume = {38}, number = {3}, pages = {453--457}, year = {2005}, url = {https://doi.org/10.1016/j.patcog.2003.09.020}, doi = {10.1016/J.PATCOG.2003.09.020}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/JingTZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/YangZYY05, author = {Jian Yang and David Zhang and Yong Xu and Jing{-}Yu Yang}, title = {Two-dimensional discriminant transform for face recognition}, journal = {Pattern Recognit.}, volume = {38}, number = {7}, pages = {1125--1129}, year = {2005}, url = {https://doi.org/10.1016/j.patcog.2004.11.019}, doi = {10.1016/J.PATCOG.2004.11.019}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/YangZYY05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/KumarZ05, author = {Ajay Kumar and David Zhang}, title = {Personal authentication using multiple palmprint representation}, journal = {Pattern Recognit.}, volume = {38}, number = {10}, pages = {1695--1704}, year = {2005}, url = {https://doi.org/10.1016/j.patcog.2005.03.012}, doi = {10.1016/J.PATCOG.2005.03.012}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/KumarZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/YangGZY05, author = {Jian Yang and Xiumei Gao and David Zhang and Jing{-}Yu Yang}, title = {Kernel {ICA:} An alternative formulation and its application to face recognition}, journal = {Pattern Recognit.}, volume = {38}, number = {10}, pages = {1784--1787}, year = {2005}, url = {https://doi.org/10.1016/j.patcog.2005.01.023}, doi = {10.1016/J.PATCOG.2005.01.023}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/YangGZY05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/YuZWY05, author = {Li Yu and David Zhang and Kuanquan Wang and Wen Yang}, title = {Coarse iris classification using box-counting to estimate fractal dimensions}, journal = {Pattern Recognit.}, volume = {38}, number = {11}, pages = {1791--1798}, year = {2005}, url = {https://doi.org/10.1016/j.patcog.2005.03.015}, doi = {10.1016/J.PATCOG.2005.03.015}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/YuZWY05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tbe/XuZW05, author = {Lisheng Xu and David Zhang and Kuanquan Wang}, title = {Wavelet-based cascaded adaptive filter for removing baseline drift in pulse waveforms}, journal = {{IEEE} Trans. Biomed. Eng.}, volume = {52}, number = {11}, pages = {1973--1975}, year = {2005}, url = {https://doi.org/10.1109/TBME.2005.856296}, doi = {10.1109/TBME.2005.856296}, timestamp = {Sat, 05 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tbe/XuZW05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tmi/PangZW05, author = {Bo Pang and David Zhang and Kuanquan Wang}, title = {The Bi-Elliptical Deformable Contour and Its Application to Automated Tongue Segmentation in Chinese Medicine}, journal = {{IEEE} Trans. Medical Imaging}, volume = {24}, number = {8}, pages = {946--956}, year = {2005}, url = {https://doi.org/10.1109/TMI.2005.850552}, doi = {10.1109/TMI.2005.850552}, timestamp = {Thu, 18 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tmi/PangZW05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tmm/LiYZ05, author = {Wenxin Li and Jane You and David Zhang}, title = {Texture-based palmprint retrieval using a layered search scheme for personal identification}, journal = {{IEEE} Trans. Multim.}, volume = {7}, number = {5}, pages = {891--898}, year = {2005}, url = {https://doi.org/10.1109/TMM.2005.854380}, doi = {10.1109/TMM.2005.854380}, timestamp = {Wed, 28 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tmm/LiYZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/LiZLQ05, author = {Wen Li and David Dapeng Zhang and Zhiyong Liu and Xiangzhen Qiao}, title = {Fast block-based image restoration employing the improved best neighborhood matching approach}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {A}}, volume = {35}, number = {4}, pages = {546--555}, year = {2005}, url = {https://doi.org/10.1109/TSMCA.2005.850605}, doi = {10.1109/TSMCA.2005.850605}, timestamp = {Mon, 25 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/LiZLQ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amfg/ZuoWZY05, author = {Wangmeng Zuo and Kuanquan Wang and David Zhang and Jian Yang}, editor = {Wenyi Zhao and Shaogang Gong and Xiaoou Tang}, title = {Regularization of {LDA} for Face Recognition: {A} Post-processing Approach}, booktitle = {Analysis and Modelling of Faces and Gestures, Second International Workshop, {AMFG} 2005, Beijing, China, October 16, 2005, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3723}, pages = {377--391}, publisher = {Springer}, year = {2005}, url = {https://doi.org/10.1007/11564386\_29}, doi = {10.1007/11564386\_29}, timestamp = {Tue, 14 May 2019 10:00:53 +0200}, biburl = {https://dblp.org/rec/conf/amfg/ZuoWZY05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/avbpa/WangZZ05, author = {Kuanquan Wang and Wangmeng Zuo and David Zhang}, editor = {Takeo Kanade and Anil K. Jain and Nalini K. Ratha}, title = {Post-processing on LDA's Discriminant Vectors for Facial Feature Extraction}, booktitle = {Audio- and Video-Based Biometric Person Authentication, 5th International Conference, {AVBPA} 2005, Hilton Rye Town, NY, USA, July 20-22, 2005, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3546}, pages = {346--354}, publisher = {Springer}, year = {2005}, url = {https://doi.org/10.1007/11527923\_36}, doi = {10.1007/11527923\_36}, timestamp = {Tue, 14 May 2019 10:00:44 +0200}, biburl = {https://dblp.org/rec/conf/avbpa/WangZZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/avbpa/KongZK05, author = {Adams Wai{-}Kin Kong and David Zhang and Mohamed Kamel}, editor = {Takeo Kanade and Anil K. Jain and Nalini K. Ratha}, title = {A Study of Brute-Force Break-ins of a Palmprint Verification System}, booktitle = {Audio- and Video-Based Biometric Person Authentication, 5th International Conference, {AVBPA} 2005, Hilton Rye Town, NY, USA, July 20-22, 2005, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3546}, pages = {447--454}, publisher = {Springer}, year = {2005}, url = {https://doi.org/10.1007/11527923\_46}, doi = {10.1007/11527923\_46}, timestamp = {Sat, 16 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/avbpa/KongZK05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/avbpa/WuWZ05, author = {Xiangqian Wu and Kuanquan Wang and David Zhang}, editor = {Takeo Kanade and Anil K. Jain and Nalini K. Ratha}, title = {Palmprint Authentication Based on Orientation Code Matching}, booktitle = {Audio- and Video-Based Biometric Person Authentication, 5th International Conference, {AVBPA} 2005, Hilton Rye Town, NY, USA, July 20-22, 2005, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3546}, pages = {555--562}, publisher = {Springer}, year = {2005}, url = {https://doi.org/10.1007/11527923\_57}, doi = {10.1007/11527923\_57}, timestamp = {Thu, 27 Sep 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/avbpa/WuWZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/avbpa/LiuZ05, author = {Li Liu and David Zhang}, editor = {Takeo Kanade and Anil K. Jain and Nalini K. Ratha}, title = {A Novel Palm-Line Detector}, booktitle = {Audio- and Video-Based Biometric Person Authentication, 5th International Conference, {AVBPA} 2005, Hilton Rye Town, NY, USA, July 20-22, 2005, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3546}, pages = {563--571}, publisher = {Springer}, year = {2005}, url = {https://doi.org/10.1007/11527923\_58}, doi = {10.1007/11527923\_58}, timestamp = {Thu, 17 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/avbpa/LiuZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/avbpa/KumarZ05, author = {Ajay Kumar and David Zhang}, editor = {Takeo Kanade and Anil K. Jain and Nalini K. Ratha}, title = {Biometric Recognition Using Feature Selection and Combination}, booktitle = {Audio- and Video-Based Biometric Person Authentication, 5th International Conference, {AVBPA} 2005, Hilton Rye Town, NY, USA, July 20-22, 2005, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3546}, pages = {813--822}, publisher = {Springer}, year = {2005}, url = {https://doi.org/10.1007/11527923\_85}, doi = {10.1007/11527923\_85}, timestamp = {Mon, 18 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/avbpa/KumarZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cisst/CheungKYZ05, author = {King Hong Cheung and Adams Wai{-}Kin Kong and Jane You and David Zhang}, editor = {Hamid R. Arabnia}, title = {An Analysis on Invertibility of Cancelable Biometrics based on BioHashing}, booktitle = {Proceedings of The 2005 International Conference on Imaging Science, Systems, and Technology: Computer Graphics, {CISST} 2005, Las Vegas, Nevada, USA, June 27-30, 2005}, pages = {40--45}, publisher = {{CSREA} Press}, year = {2005}, timestamp = {Sat, 16 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cisst/CheungKYZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/iccv/YangZY05, author = {Jian Yang and David Zhang and Jing{-}Yu Yang}, title = {Is {ICA} Significantly Better than {PCA} for Face Recognition?}, booktitle = {10th {IEEE} International Conference on Computer Vision {(ICCV} 2005), 17-20 October 2005, Beijing, China}, pages = {198--203}, publisher = {{IEEE} Computer Society}, year = {2005}, url = {https://doi.org/10.1109/ICCV.2005.127}, doi = {10.1109/ICCV.2005.127}, timestamp = {Thu, 23 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/iccv/YangZY05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icic/LiuZYL05, author = {Heng Liu and David Zhang and Jingqi Yan and Zushu Li}, editor = {De{-}Shuang Huang and Xiao{-}Ping (Steven) Zhang and Guang{-}Bin Huang}, title = {Fast and Robust Portrait Segmentation Using {QEA} and Histogram Peak Distribution Methods}, booktitle = {Advances in Intelligent Computing, International Conference on Intelligent Computing, {ICIC} 2005, Hefei, China, August 23-26, 2005, Proceedings, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {3645}, pages = {920--928}, publisher = {Springer}, year = {2005}, url = {https://doi.org/10.1007/11538356\_95}, doi = {10.1007/11538356\_95}, timestamp = {Thu, 12 Dec 2019 16:43:34 +0100}, biburl = {https://dblp.org/rec/conf/icic/LiuZYL05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icic/WuZWZ05, author = {Xiangqian Wu and Fengmiao Zhang and Kuanquan Wang and David Zhang}, editor = {De{-}Shuang Huang and Xiao{-}Ping (Steven) Zhang and Guang{-}Bin Huang}, title = {Fusion of the Textural Feature and Palm-Lines for Palmprint Authentication}, booktitle = {Advances in Intelligent Computing, International Conference on Intelligent Computing, {ICIC} 2005, Hefei, China, August 23-26, 2005, Proceedings, Part {I}}, series = {Lecture Notes in Computer Science}, volume = {3644}, pages = {1075--1084}, publisher = {Springer}, year = {2005}, url = {https://doi.org/10.1007/11538059\_111}, doi = {10.1007/11538059\_111}, timestamp = {Thu, 12 Dec 2019 16:43:34 +0100}, biburl = {https://dblp.org/rec/conf/icic/WuZWZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/WuWZZ05, author = {Xiangqian Wu and Kuanquan Wang and Fengmiao Zhang and David Zhang}, title = {Fusion of phase and orientation information for palmprint authentication}, booktitle = {Proceedings of the 2005 International Conference on Image Processing, {ICIP} 2005, Genoa, Italy, September 11-14, 2005}, pages = {29--32}, publisher = {{IEEE}}, year = {2005}, url = {https://doi.org/10.1109/ICIP.2005.1529983}, doi = {10.1109/ICIP.2005.1529983}, timestamp = {Wed, 16 Oct 2019 14:14:52 +0200}, biburl = {https://dblp.org/rec/conf/icip/WuWZZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/LiuZ05, author = {Laura Li Liu and David Zhang and Kuanquan Wang}, title = {Palm-line detection}, booktitle = {Proceedings of the 2005 International Conference on Image Processing, {ICIP} 2005, Genoa, Italy, September 11-14, 2005}, pages = {269--272}, publisher = {{IEEE}}, year = {2005}, url = {https://doi.org/10.1109/ICIP.2005.1530380}, doi = {10.1109/ICIP.2005.1530380}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icip/LiuZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/YuWZ05, author = {Li Yu and Kuanquan Wang and David Zhang}, title = {Coarse iris classification based on box-counting method}, booktitle = {Proceedings of the 2005 International Conference on Image Processing, {ICIP} 2005, Genoa, Italy, September 11-14, 2005}, pages = {301--304}, publisher = {{IEEE}}, year = {2005}, url = {https://doi.org/10.1109/ICIP.2005.1530388}, doi = {10.1109/ICIP.2005.1530388}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icip/YuWZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icip/ZuoWZ05, author = {Wangmeng Zuo and Kuanquan Wang and David Zhang}, title = {Bi-directional {PCA} with assembled matrix distance metric}, booktitle = {Proceedings of the 2005 International Conference on Image Processing, {ICIP} 2005, Genoa, Italy, September 11-14, 2005}, pages = {958--961}, publisher = {{IEEE}}, year = {2005}, url = {https://doi.org/10.1109/ICIP.2005.1530216}, doi = {10.1109/ICIP.2005.1530216}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icip/ZuoWZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/isnn/LiWZ05, author = {Yanlai Li and Kuanquan Wang and David Zhang}, editor = {Jun Wang and Xiaofeng Liao and Zhang Yi}, title = {Palmprint Recognition Based on Translation Invariant Zernike Moments and Modular Neural Network}, booktitle = {Advances in Neural Networks - {ISNN} 2005, Second International Symposium on Neural Networks, Chongqing, China, May 30 - June 1, 2005, Proceedings, Part {II}}, series = {Lecture Notes in Computer Science}, volume = {3497}, pages = {177--182}, publisher = {Springer}, year = {2005}, url = {https://doi.org/10.1007/11427445\_28}, doi = {10.1007/11427445\_28}, timestamp = {Tue, 14 May 2019 10:00:36 +0200}, biburl = {https://dblp.org/rec/conf/isnn/LiWZ05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/kes/CheungKZKYL05, author = {King Hong Cheung and Adams Wai{-}Kin Kong and David Zhang and Mohamed Kamel and Jane You and Ho{-}Wang Lam}, editor = {Rajiv Khosla and Robert J. Howlett and Lakhmi C. Jain}, title = {An Analysis on Accuracy of Cancelable Biometrics Based on BioHashing}, booktitle = {Knowledge-Based Intelligent Information and Engineering Systems, 9th International Conference, {KES} 2005, Melbourne, Australia, September 14-16, 2005, Proceedings, Part {III}}, series = {Lecture Notes in Computer Science}, volume = {3683}, pages = {1168--1172}, publisher = {Springer}, year = {2005}, url = {https://doi.org/10.1007/11553939\_162}, doi = {10.1007/11553939\_162}, timestamp = {Tue, 14 May 2019 10:00:51 +0200}, biburl = {https://dblp.org/rec/conf/kes/CheungKZKYL05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/premi/ZhangLKW05, author = {David Zhang and Guangming Lu and Adams Wai{-}Kin Kong and Michael Wong}, editor = {Sankar K. Pal and Sanghamitra Bandyopadhyay and Sambhunath Biswas}, title = {A Novel Personal Authentication System Using Palmprint Technology}, booktitle = {Pattern Recognition and Machine Intelligence, First International Conference, PReMI 2005, Kolkata, India, December 20-22, 2005, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3776}, pages = {147--156}, publisher = {Springer}, year = {2005}, url = {https://doi.org/10.1007/11590316\_18}, doi = {10.1007/11590316\_18}, timestamp = {Tue, 14 May 2019 10:00:41 +0200}, biburl = {https://dblp.org/rec/conf/premi/ZhangLKW05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/smc/CheungKYLZB05, author = {King Hong Cheung and Adams Wai{-}Kin Kong and Jane You and Qin Li and David Zhang and Prabir Bhattacharya}, title = {A new approach to appearance-based face recognition}, booktitle = {Proceedings of the {IEEE} International Conference on Systems, Man and Cybernetics, Waikoloa, Hawaii, USA, October 10-12, 2005}, pages = {1686--1691}, publisher = {{IEEE}}, year = {2005}, url = {https://doi.org/10.1109/ICSMC.2005.1571391}, doi = {10.1109/ICSMC.2005.1571391}, timestamp = {Wed, 03 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/smc/CheungKYLZB05.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/iwbrs/2005, editor = {Stan Z. Li and Zhenan Sun and Tieniu Tan and Sharath Pankanti and G{\'{e}}rard Chollet and David Zhang}, title = {Advances in Biometric Person Authentication, International Workshop on Biometric Recognition Systems, IWBRS2005, Beijing, China, October 22-23, 2005, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3781}, publisher = {Springer}, year = {2005}, url = {https://doi.org/10.1007/11569947}, doi = {10.1007/11569947}, isbn = {3-540-29431-7}, timestamp = {Thu, 17 Oct 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/iwbrs/2005.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/automatica/XieLZZ04, author = {Lihua Xie and Lilei Lu and David Zhang and Huanshui Zhang}, title = {Improved robust H\({}_{\mbox{2}}\) and H\({}_{\mbox{infinity}}\) filtering for uncertain discrete-time systems}, journal = {Autom.}, volume = {40}, number = {5}, pages = {873--880}, year = {2004}, url = {https://doi.org/10.1016/j.automatica.2004.01.003}, doi = {10.1016/J.AUTOMATICA.2004.01.003}, timestamp = {Thu, 20 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/automatica/XieLZZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/automatica/ZhangZX04, author = {Huanshui Zhang and David Zhang and Lihua Xie}, title = {An innovation approach to H\({}_{\mbox{infinity}}\) prediction for continuous-time systems with application to systems with delayed measurements}, journal = {Autom.}, volume = {40}, number = {7}, pages = {1253--1261}, year = {2004}, url = {https://doi.org/10.1016/j.automatica.2004.02.016}, doi = {10.1016/J.AUTOMATICA.2004.02.016}, timestamp = {Thu, 20 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/automatica/ZhangZX04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/automatica/ZhangZXL04, author = {Huanshui Zhang and David Zhang and Lihua Xie and Jun Lin}, title = {Robust filtering under stochastic parametric uncertainties}, journal = {Autom.}, volume = {40}, number = {9}, pages = {1583--1589}, year = {2004}, url = {https://doi.org/10.1016/j.automatica.2004.04.002}, doi = {10.1016/J.AUTOMATICA.2004.04.002}, timestamp = {Thu, 20 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/automatica/ZhangZXL04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cg/LiZPSZY04, author = {Li Li and David Zhang and Zhigeng Pan and Jiaoying Shi and Kun Zhou and Kai Ye}, title = {Watermarking 3D mesh by spherical parameterization}, journal = {Comput. Graph.}, volume = {28}, number = {6}, pages = {981--989}, year = {2004}, url = {https://doi.org/10.1016/j.cag.2004.08.002}, doi = {10.1016/J.CAG.2004.08.002}, timestamp = {Mon, 19 Oct 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/cg/LiZPSZY04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/paa/YangYZ04, author = {Jian Yang and Hui Ye and David Zhang}, title = {A new {LDA-KL} combined method for feature extraction and its generalisation}, journal = {Pattern Anal. Appl.}, volume = {7}, number = {1}, pages = {40--50}, year = {2004}, url = {https://doi.org/10.1007/s10044-004-0205-6}, doi = {10.1007/S10044-004-0205-6}, timestamp = {Fri, 12 Mar 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/paa/YangYZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/paa/YangYYZ04, author = {Jian Yang and Hui Ye and Jing{-}Yu Yang and David Zhang}, title = {A new {LDA-KL} combined method for feature extraction and its generalisation}, journal = {Pattern Anal. Appl.}, volume = {7}, number = {2}, pages = {225}, year = {2004}, url = {https://doi.org/10.1007/s10044-004-0221-6}, doi = {10.1007/S10044-004-0221-6}, timestamp = {Thu, 27 Jul 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/paa/YangYYZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pami/YangZFY04, author = {Jian Yang and David Zhang and Alejandro F. Frangi and Jing{-}Yu Yang}, title = {Two-Dimensional {PCA:} {A} New Approach to Appearance-Based Face Representation and Recognition}, journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.}, volume = {26}, number = {1}, pages = {131--137}, year = {2004}, url = {http://doi.ieeecomputersociety.org/10.1109/TPAMI.2004.10004}, doi = {10.1109/TPAMI.2004.10004}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pami/YangZFY04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ZhangZZ04, author = {Yungang Zhang and Changshui Zhang and David Zhang}, title = {Distance metric learning by knowledge embedding}, journal = {Pattern Recognit.}, volume = {37}, number = {1}, pages = {161--163}, year = {2004}, url = {https://doi.org/10.1016/S0031-3203(03)00218-8}, doi = {10.1016/S0031-3203(03)00218-8}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/ZhangZZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ZhangWZZ04, author = {Changshui Zhang and Jun Wang and Nanyuan Zhao and David Zhang}, title = {Reconstruction and analysis of multi-pose face images based on nonlinear dimensionality reduction}, journal = {Pattern Recognit.}, volume = {37}, number = {2}, pages = {325--336}, year = {2004}, url = {https://doi.org/10.1016/j.patcog.2003.07.005}, doi = {10.1016/J.PATCOG.2003.07.005}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/ZhangWZZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/GuZZ04, author = {Jinwei Gu and Jie Zhou and David Zhang}, title = {A combination model for orientation field of fingerprints}, journal = {Pattern Recognit.}, volume = {37}, number = {3}, pages = {543--553}, year = {2004}, url = {https://doi.org/10.1016/S0031-3203(03)00178-X}, doi = {10.1016/S0031-3203(03)00178-X}, timestamp = {Wed, 16 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/GuZZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ZhangZZ04a, author = {Yungang Zhang and Changshui Zhang and David Zhang}, title = {Erratum to "Distance metric learning by knowledge embedding" [Pattern Recognition 37(1)161-163(2004)]}, journal = {Pattern Recognit.}, volume = {37}, number = {4}, pages = {855}, year = {2004}, url = {https://doi.org/10.1016/j.patcog.2003.12.001}, doi = {10.1016/J.PATCOG.2003.12.001}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/ZhangZZ04a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/WuZWH04, author = {Xiangqian Wu and David Zhang and Kuanquan Wang and Bo Huang}, title = {Palmprint classification using principal lines}, journal = {Pattern Recognit.}, volume = {37}, number = {10}, pages = {1987--1998}, year = {2004}, url = {https://doi.org/10.1016/j.patcog.2004.02.015}, doi = {10.1016/J.PATCOG.2004.02.015}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/WuZWH04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/YangJYZF04, author = {Jian Yang and Zhong Jin and Jing{-}Yu Yang and David Zhang and Alejandro F. Frangi}, title = {Essence of kernel Fisher discriminant: {KPCA} plus {LDA}}, journal = {Pattern Recognit.}, volume = {37}, number = {10}, pages = {2097--2100}, year = {2004}, url = {https://doi.org/10.1016/j.patcog.2003.10.015}, doi = {10.1016/J.PATCOG.2003.10.015}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/YangJYZF04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/spic/WangZ04, author = {Huiyuan Wang and David Zhang}, title = {A linear edge model and its application in lossless image coding}, journal = {Signal Process. Image Commun.}, volume = {19}, number = {10}, pages = {955--958}, year = {2004}, url = {https://doi.org/10.1016/j.image.2004.04.006}, doi = {10.1016/J.IMAGE.2004.04.006}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/spic/WangZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tac/ZhangXZS04, author = {Huanshui Zhang and Lihua Xie and David Zhang and Yeng Chai Soh}, title = {A reorganized innovation approach to linear estimation}, journal = {{IEEE} Trans. Autom. Control.}, volume = {49}, number = {10}, pages = {1810--1814}, year = {2004}, url = {https://doi.org/10.1109/TAC.2004.835599}, doi = {10.1109/TAC.2004.835599}, timestamp = {Wed, 20 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tac/ZhangXZS04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tbe/PangZLW04, author = {Bo Pang and David Zhang and Naimin Li and Kuanquan Wang}, title = {Computerized tongue diagnosis based on Bayesian networks}, journal = {{IEEE} Trans. Biomed. Eng.}, volume = {51}, number = {10}, pages = {1803--1810}, year = {2004}, url = {https://doi.org/10.1109/TBME.2004.831534}, doi = {10.1109/TBME.2004.831534}, timestamp = {Wed, 02 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tbe/PangZLW04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/YouKZC04, author = {Jane You and Adams Wai{-}Kin Kong and David Zhang and King Hong Cheung}, title = {On hierarchical palmprint coding with multiple features for personal identification in large databases}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {14}, number = {2}, pages = {234--243}, year = {2004}, url = {https://doi.org/10.1109/TCSVT.2003.821978}, doi = {10.1109/TCSVT.2003.821978}, timestamp = {Tue, 25 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcsv/YouKZC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/ZhangZ04, author = {Lei Zhang and David Zhang}, title = {Characterization of palmprints by wavelet signatures via directional context modeling}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {B}}, volume = {34}, number = {3}, pages = {1335--1347}, year = {2004}, url = {https://doi.org/10.1109/TSMCB.2004.824521}, doi = {10.1109/TSMCB.2004.824521}, timestamp = {Mon, 18 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/ZhangZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/JingZT04, author = {Xiao{-}Yuan Jing and David Zhang and Yuan Yan Tang}, title = {An improved {LDA} approach}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {B}}, volume = {34}, number = {5}, pages = {1942--1951}, year = {2004}, url = {https://doi.org/10.1109/TSMCB.2004.831770}, doi = {10.1109/TSMCB.2004.831770}, timestamp = {Mon, 18 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/JingZT04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/JingZ04, author = {Xiao{-}Yuan Jing and David Zhang}, title = {A face and palmprint recognition approach based on discriminant {DCT} feature extraction}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {B}}, volume = {34}, number = {6}, pages = {2405--2415}, year = {2004}, url = {https://doi.org/10.1109/TSMCB.2004.837586}, doi = {10.1109/TSMCB.2004.837586}, timestamp = {Mon, 18 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/JingZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tvcg/YanSZ04, author = {Jingqi Yan and Pengfei Shi and David Zhang}, title = {Mesh Simplification with Hierarchical Shape Analysis and Iterative Edge Contraction}, journal = {{IEEE} Trans. Vis. Comput. Graph.}, volume = {10}, number = {2}, pages = {142--151}, year = {2004}, url = {https://doi.org/10.1109/TVCG.2004.1260766}, doi = {10.1109/TVCG.2004.1260766}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tvcg/YanSZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/asplos/SuhLZD04, author = {G. Edward Suh and Jae W. Lee and David Zhang and Srinivas Devadas}, editor = {Shubu Mukherjee and Kathryn S. McKinley}, title = {Secure program execution via dynamic information flow tracking}, booktitle = {Proceedings of the 11th International Conference on Architectural Support for Programming Languages and Operating Systems, {ASPLOS} 2004, Boston, MA, USA, October 7-13, 2004}, pages = {85--96}, publisher = {{ACM}}, year = {2004}, url = {https://doi.org/10.1145/1024393.1024404}, doi = {10.1145/1024393.1024404}, timestamp = {Fri, 15 Oct 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/asplos/SuhLZD04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/eccv/ZhangLKW04, author = {David Zhang and Guangming Lu and Adams Wai{-}Kin Kong and Michael Wong}, editor = {Davide Maltoni and Anil K. Jain}, title = {Palmprint Authentication System for Civil Applications}, booktitle = {Biometric Authentication, {ECCV} 2004 International Workshop, BioAW 2004, Prague, Czech Republic, May 15, 2004, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3087}, pages = {217--228}, publisher = {Springer}, year = {2004}, url = {https://doi.org/10.1007/978-3-540-25976-3\_20}, doi = {10.1007/978-3-540-25976-3\_20}, timestamp = {Tue, 14 May 2019 10:00:45 +0200}, biburl = {https://dblp.org/rec/conf/eccv/ZhangLKW04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icba/ZhouWBZ04, author = {Jie Zhou and Chenyu Wu and Zhaoqi Bian and David Zhang}, editor = {David Zhang and Anil K. Jain}, title = {Improving Fingerprint Recognition Based on Crease Detection}, booktitle = {Biometric Authentication, First International Conference, {ICBA} 2004, Hong Kong, China, July 15-17, 2004, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3072}, pages = {287--293}, publisher = {Springer}, year = {2004}, url = {https://doi.org/10.1007/978-3-540-25948-0\_40}, doi = {10.1007/978-3-540-25948-0\_40}, timestamp = {Wed, 16 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icba/ZhouWBZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icba/LiWZ04, author = {Bin Li and Kuanquan Wang and David Zhang}, editor = {David Zhang and Anil K. Jain}, title = {On-Line Signature Verification Based on {PCA} (Principal Component Analysis) and {MCA} (Minor Component Analysis)}, booktitle = {Biometric Authentication, First International Conference, {ICBA} 2004, Hong Kong, China, July 15-17, 2004, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3072}, pages = {540--546}, publisher = {Springer}, year = {2004}, url = {https://doi.org/10.1007/978-3-540-25948-0\_74}, doi = {10.1007/978-3-540-25948-0\_74}, timestamp = {Tue, 25 Jan 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icba/LiWZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icba/FengDHZ04, author = {Guiyu Feng and Kaifeng Dong and Dewen Hu and David Zhang}, editor = {David Zhang and Anil K. Jain}, title = {When Faces Are Combined with Palmprints: {A} Novel Biometric Fusion Strategy}, booktitle = {Biometric Authentication, First International Conference, {ICBA} 2004, Hong Kong, China, July 15-17, 2004, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3072}, pages = {701--707}, publisher = {Springer}, year = {2004}, url = {https://doi.org/10.1007/978-3-540-25948-0\_95}, doi = {10.1007/978-3-540-25948-0\_95}, timestamp = {Thu, 21 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icba/FengDHZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icba/YouKZC04, author = {Jane You and Adams Wai{-}Kin Kong and David Zhang and King Hong Cheung}, editor = {David Zhang and Anil K. Jain}, title = {A New Approach to Personal Identification in Large Databases by Hierarchical Palmprint Coding with Multi-features}, booktitle = {Biometric Authentication, First International Conference, {ICBA} 2004, Hong Kong, China, July 15-17, 2004, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3072}, pages = {739--745}, publisher = {Springer}, year = {2004}, url = {https://doi.org/10.1007/978-3-540-25948-0\_100}, doi = {10.1007/978-3-540-25948-0\_100}, timestamp = {Sat, 16 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icba/YouKZC04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icba/KongZ04, author = {Adams Wai{-}Kin Kong and David Zhang}, editor = {David Zhang and Anil K. Jain}, title = {Feature-Level Fusion for Effective Palmprint Authentication}, booktitle = {Biometric Authentication, First International Conference, {ICBA} 2004, Hong Kong, China, July 15-17, 2004, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3072}, pages = {761--767}, publisher = {Springer}, year = {2004}, url = {https://doi.org/10.1007/978-3-540-25948-0\_103}, doi = {10.1007/978-3-540-25948-0\_103}, timestamp = {Sat, 16 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icba/KongZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icba/WuWZ04, author = {Xiangqian Wu and Kuanquan Wang and David Zhang}, editor = {David Zhang and Anil K. Jain}, title = {HMMs Based Palmprint Identification}, booktitle = {Biometric Authentication, First International Conference, {ICBA} 2004, Hong Kong, China, July 15-17, 2004, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3072}, pages = {775--781}, publisher = {Springer}, year = {2004}, url = {https://doi.org/10.1007/978-3-540-25948-0\_105}, doi = {10.1007/978-3-540-25948-0\_105}, timestamp = {Thu, 27 Sep 2018 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icba/WuWZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icig/KumarZ04, author = {Ajay Kumar and David Zhang}, title = {Integrating shape and texture for hand verification}, booktitle = {Third International Conference on Image and Graphics, {ICIG} 2004, Hong Kong, China, December 18-20, 2004}, pages = {222--225}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.org/10.1109/ICIG.2004.87}, doi = {10.1109/ICIG.2004.87}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icig/KumarZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icig/WuWZ04, author = {Xiangqian Wu and Kuanquan Wang and David Zhang}, title = {A novel approach of palm-line extraction}, booktitle = {Third International Conference on Image and Graphics, {ICIG} 2004, Hong Kong, China, December 18-20, 2004}, pages = {230--233}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.org/10.1109/ICIG.2004.16}, doi = {10.1109/ICIG.2004.16}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icig/WuWZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icig/ZuoWZZ04, author = {Wangmeng Zuo and Kuanquan Wang and David Zhang and Hongzhi Zhang}, title = {Combination of polar edge detection and active contour model for automated tongue segmentation}, booktitle = {Third International Conference on Image and Graphics, {ICIG} 2004, Hong Kong, China, December 18-20, 2004}, pages = {270--273}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.org/10.1109/ICIG.2004.48}, doi = {10.1109/ICIG.2004.48}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icig/ZuoWZZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icig/CheungYKZ04, author = {King Hong Cheung and Jane You and Adams Wai{-}Kin Kong and David Zhang}, title = {A study of aggregated 2D Gabor features on appearance-based face recognition}, booktitle = {Third International Conference on Image and Graphics, {ICIG} 2004, Hong Kong, China, December 18-20, 2004}, pages = {310--313}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.org/10.1109/ICIG.2004.26}, doi = {10.1109/ICIG.2004.26}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icig/CheungYKZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icig/LiPZ04, author = {Li Li and Zhigeng Pan and David Zhang}, title = {A public mesh watermarking algorithm based on addition property of Fourier transform}, booktitle = {Third International Conference on Image and Graphics, {ICIG} 2004, Hong Kong, China, December 18-20, 2004}, pages = {324--328}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.org/10.1109/ICIG.2004.22}, doi = {10.1109/ICIG.2004.22}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icig/LiPZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icig/PanLZZ04, author = {Zhigeng Pan and Li Li and Mingmin Zhang and David Zhang}, title = {Watermark extraction by magnifying noise and applying global minimum decoder}, booktitle = {Third International Conference on Image and Graphics, {ICIG} 2004, Hong Kong, China, December 18-20, 2004}, pages = {349--352}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.org/10.1109/ICIG.2004.146}, doi = {10.1109/ICIG.2004.146}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icig/PanLZZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/WuWZ04, author = {Xiangqian Wu and Kuanquan Wang and David Zhang}, title = {Palmprint Recognition Using Directional Line Energy Feature}, booktitle = {17th International Conference on Pattern Recognition, {ICPR} 2004, Cambridge, UK, August 23-26, 2004}, pages = {475--478}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.org/10.1109/ICPR.2004.1333805}, doi = {10.1109/ICPR.2004.1333805}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/WuWZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/KongZ04, author = {Adams Wai{-}Kin Kong and David Zhang}, title = {Competitive Coding Scheme for Palmprint Verification}, booktitle = {17th International Conference on Pattern Recognition, {ICPR} 2004, Cambridge, UK, August 23-26, 2004}, pages = {520--523}, publisher = {{IEEE} Computer Society}, year = {2004}, url = {https://doi.org/10.1109/ICPR.2004.1334184}, doi = {10.1109/ICPR.2004.1334184}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/KongZ04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/sinobiometrics/ZhangLKW04, author = {David Zhang and Guangming Lu and Adams Wai{-}Kin Kong and Michael Wong}, editor = {Stan Z. Li and Jian{-}Huang Lai and Tieniu Tan and Guo{-}Can Feng and Yangsheng Wang}, title = {Palmprint Authentication Technologies, Systems and Applications}, booktitle = {Advances in Biometric Person Authentication, 5th Chinese Conference on Biometric Recognition, {SINOBIOMETRICS} 2004, Guangzhou, China, December 13-14, 2004, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3338}, pages = {78--89}, publisher = {Springer}, year = {2004}, url = {https://doi.org/10.1007/978-3-540-30548-4\_10}, doi = {10.1007/978-3-540-30548-4\_10}, timestamp = {Tue, 14 May 2019 10:00:53 +0200}, biburl = {https://dblp.org/rec/conf/sinobiometrics/ZhangLKW04.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@proceedings{DBLP:conf/icba/2004, editor = {David Zhang and Anil K. Jain}, title = {Biometric Authentication, First International Conference, {ICBA} 2004, Hong Kong, China, July 15-17, 2004, Proceedings}, series = {Lecture Notes in Computer Science}, volume = {3072}, publisher = {Springer}, year = {2004}, url = {https://doi.org/10.1007/b98225}, doi = {10.1007/B98225}, isbn = {3-540-22146-8}, timestamp = {Tue, 14 May 2019 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icba/2004.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijon/JingZ03, author = {Xiao{-}Yuan Jing and David Zhang}, title = {Face recognition based on linear classifiers combination}, journal = {Neurocomputing}, volume = {50}, pages = {485--488}, year = {2003}, url = {https://doi.org/10.1016/S0925-2312(02)00674-4}, doi = {10.1016/S0925-2312(02)00674-4}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijon/JingZ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijprai/KongZ03, author = {Adams Wai{-}Kin Kong and David Zhang}, title = {Detecting Eyelash and Reflection for Accurate Iris Segmentation}, journal = {Int. J. Pattern Recognit. Artif. Intell.}, volume = {17}, number = {6}, pages = {1025--1034}, year = {2003}, url = {https://doi.org/10.1142/S0218001403002733}, doi = {10.1142/S0218001403002733}, timestamp = {Mon, 11 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijprai/KongZ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijprai/YangYFZ03, author = {Jian Yang and Jing{-}Yu Yang and Alejandro F. Frangi and David Zhang}, title = {Uncorrelated Projection Discriminant Analysis And Its Application To Face Image Feature Extraction}, journal = {Int. J. Pattern Recognit. Artif. Intell.}, volume = {17}, number = {8}, pages = {1325--1347}, year = {2003}, url = {https://doi.org/10.1142/S0218001403002903}, doi = {10.1142/S0218001403002903}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijprai/YangYFZ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/imst/LiZLQ03, author = {Wen Li and David Zhang and Zhiyong Liu and Xiangzhen Qiao}, title = {A fast {BNM} (Best Neighborhood Matching): Algorithm and parallel processing for image restoration}, journal = {Int. J. Imaging Syst. Technol.}, volume = {13}, number = {4}, pages = {189--200}, year = {2003}, url = {https://doi.org/10.1002/ima.10057}, doi = {10.1002/IMA.10057}, timestamp = {Thu, 18 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/imst/LiZLQ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ivc/YangZ03, author = {Yang Yang and David Zhang}, title = {A novel line scan clustering algorithm for identifying connected components in digital images}, journal = {Image Vis. Comput.}, volume = {21}, number = {5}, pages = {459--472}, year = {2003}, url = {https://doi.org/10.1016/S0262-8856(03)00015-5}, doi = {10.1016/S0262-8856(03)00015-5}, timestamp = {Thu, 20 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ivc/YangZ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/paa/YangZY03, author = {Jian Yang and David Zhang and Jing{-}Yu Yang}, title = {A generalised {K-L} expansion method which can deal with small sample size and high-dimensional problems}, journal = {Pattern Anal. Appl.}, volume = {6}, number = {1}, pages = {47--54}, year = {2003}, url = {https://doi.org/10.1007/s10044-002-0177-3}, doi = {10.1007/S10044-002-0177-3}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/paa/YangZY03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pami/ZhangKYW03, author = {David Zhang and Adams Wai{-}Kin Kong and Jane You and Michael Wong}, title = {Online Palmprint Identification}, journal = {{IEEE} Trans. Pattern Anal. Mach. Intell.}, volume = {25}, number = {9}, pages = {1041--1050}, year = {2003}, url = {https://doi.org/10.1109/TPAMI.2003.1227981}, doi = {10.1109/TPAMI.2003.1227981}, timestamp = {Wed, 14 Nov 2018 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pami/ZhangKYW03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ZhouXZ02, author = {Jie Zhou and Le{-}ping Xin and David Zhang}, title = {Scale-orientation histogram for texture image retrieval}, journal = {Pattern Recognit.}, volume = {36}, number = {4}, pages = {1061--1063}, year = {2003}, url = {https://doi.org/10.1016/S0031-3203(02)00264-9}, doi = {10.1016/S0031-3203(02)00264-9}, timestamp = {Wed, 16 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/ZhouXZ02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/YangYZL03, author = {Jian Yang and Jing{-}Yu Yang and David Zhang and Jianfeng Lu}, title = {Feature fusion: parallel strategy vs. serial strategy}, journal = {Pattern Recognit.}, volume = {36}, number = {6}, pages = {1369--1381}, year = {2003}, url = {https://doi.org/10.1016/S0031-3203(02)00262-5}, doi = {10.1016/S0031-3203(02)00262-5}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/YangYZL03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/JingZY03, author = {Xiao{-}Yuan Jing and David Zhang and Jing{-}Yu Yang}, title = {Face recognition based on a group decision-making combination approach}, journal = {Pattern Recognit.}, volume = {36}, number = {7}, pages = {1675--1678}, year = {2003}, url = {https://doi.org/10.1016/S0031-3203(02)00287-X}, doi = {10.1016/S0031-3203(02)00287-X}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/JingZY03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/JingZJ03, author = {Xiao{-}Yuan Jing and David Zhang and Zhong Jin}, title = {Improvements on the uncorrelated optimal discriminant vectors}, journal = {Pattern Recognit.}, volume = {36}, number = {8}, pages = {1921--1923}, year = {2003}, url = {https://doi.org/10.1016/S0031-3203(02)00319-9}, doi = {10.1016/S0031-3203(02)00319-9}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/JingZJ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/KongZL03, author = {Adams Wai{-}Kin Kong and David Zhang and Wenxin Li}, title = {Palmprint feature extraction using 2-D Gabor filters}, journal = {Pattern Recognit.}, volume = {36}, number = {10}, pages = {2339--2347}, year = {2003}, url = {https://doi.org/10.1016/S0031-3203(03)00121-3}, doi = {10.1016/S0031-3203(03)00121-3}, timestamp = {Wed, 28 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/KongZL03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/JingZJ03a, author = {Xiao{-}Yuan Jing and David Zhang and Zhong Jin}, title = {{UODV:} improved algorithm and generalized theory}, journal = {Pattern Recognit.}, volume = {36}, number = {11}, pages = {2593--2602}, year = {2003}, url = {https://doi.org/10.1016/S0031-3203(03)00177-8}, doi = {10.1016/S0031-3203(03)00177-8}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/JingZJ03a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/GuoZS03, author = {Jie Guo and David Zhang and Pengfei Shi}, title = {Self-synchronizing watermarking scheme for an arbitrarily shaped object}, journal = {Pattern Recognit.}, volume = {36}, number = {11}, pages = {2737--2741}, year = {2003}, url = {https://doi.org/10.1016/S0031-3203(03)00048-7}, doi = {10.1016/S0031-3203(03)00048-7}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/GuoZS03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/LuZW03, author = {Guangming Lu and David Zhang and Kuanquan Wang}, title = {Palmprint recognition using eigenpalms features}, journal = {Pattern Recognit. Lett.}, volume = {24}, number = {9-10}, pages = {1463--1467}, year = {2003}, url = {https://doi.org/10.1016/S0167-8655(02)00386-0}, doi = {10.1016/S0167-8655(02)00386-0}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/prl/LuZW03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/JingZY03, author = {Xiao{-}Yuan Jing and David Zhang and Yong{-}Fang Yao}, title = {Improvements on the linear discrimination technique with application to face recognition}, journal = {Pattern Recognit. Lett.}, volume = {24}, number = {15}, pages = {2695--2701}, year = {2003}, url = {https://doi.org/10.1016/S0167-8655(03)00112-0}, doi = {10.1016/S0167-8655(03)00112-0}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/prl/JingZY03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/prl/WuZW03, author = {Xiangqian Wu and David Zhang and Kuanquan Wang}, title = {Fisherpalms based palmprint recognition}, journal = {Pattern Recognit. Lett.}, volume = {24}, number = {15}, pages = {2829--2838}, year = {2003}, url = {https://doi.org/10.1016/S0167-8655(03)00141-7}, doi = {10.1016/S0167-8655(03)00141-7}, timestamp = {Sat, 22 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/prl/WuZW03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/spic/LiZX03, author = {Wenxin Li and David Zhang and Zhuoqun Xu}, title = {Image alignment based on invariant features for palmprint identification}, journal = {Signal Process. Image Commun.}, volume = {18}, number = {5}, pages = {373--379}, year = {2003}, url = {https://doi.org/10.1016/S0923-5965(03)00011-0}, doi = {10.1016/S0923-5965(03)00011-0}, timestamp = {Wed, 28 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/spic/LiZX03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/amcc/ZhangZX03, author = {Huanshui Zhang and David Zhang and Lihua Xie}, title = {H\({}_{\mbox{{\(\infty\)}}}\) fixed-lag smoothing and prediction for linear continous-time systems}, booktitle = {American Control Conference, {ACC} 2003, Denver, CO, USA, June 4-6 2003}, pages = {4201--4206}, publisher = {{IEEE}}, year = {2003}, url = {https://doi.org/10.1109/ACC.2003.1240495}, doi = {10.1109/ACC.2003.1240495}, timestamp = {Mon, 06 Dec 2021 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/amcc/ZhangZX03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/caine/CheungKYZ03, author = {King Hong Cheung and Adams Wai{-}Kin Kong and Jane You and David Zhang}, editor = {Kendall E. Nygard}, title = {An Integration of Principal Component Analysis and Self-Organizing Map for Effective Palmprint Retrieval}, booktitle = {Proceedings of the 16th International Conference on Computer Applications in Industry and Engineering, November 11-13, 2003, Imperial Palace Hotel, Las Vegas, Nevada, {USA}}, pages = {101--104}, publisher = {{ISCA}}, year = {2003}, timestamp = {Sat, 16 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/caine/CheungKYZ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/caine/YouKZC03, author = {Jane You and Adams Wai{-}Kin Kong and David Zhang and King Hong Cheung}, editor = {Kendall E. Nygard}, title = {On Hierarchical Palmprint Coding with Multi-Features for Personal Identification in Large Databases}, booktitle = {Proceedings of the 16th International Conference on Computer Applications in Industry and Engineering, November 11-13, 2003, Imperial Palace Hotel, Las Vegas, Nevada, {USA}}, pages = {105--108}, publisher = {{ISCA}}, year = {2003}, timestamp = {Sat, 16 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/caine/YouKZC03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/WangXLZLW03, author = {Kuanquan Wang and Lisheng Xu and Zhenguo Li and David Zhang and Naimin Li and Shuying Wang}, title = {Approximate Entropy Based Pulse Variability Analysis}, booktitle = {16th {IEEE} Symposium on Computer-Based Medical Systems {(CBMS} 2003), 26-27 June 2003, New York, NY, {USA}}, pages = {236--241}, publisher = {{IEEE} Computer Society}, year = {2003}, url = {https://doi.org/10.1109/CBMS.2003.1212795}, doi = {10.1109/CBMS.2003.1212795}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cbms/WangXLZLW03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cdc/XieL0Z03, author = {Lihua Xie and Lilei Lu and David Zhang and Huanshui Zhang}, title = {Robust filtering for uncertain discrete-time systems: an improved {LMI} approach}, booktitle = {42nd {IEEE} Conference on Decision and Control, {CDC} 2003, Maui, Hawaii, USA, December 9-12, 2003}, pages = {906--911}, publisher = {{IEEE}}, year = {2003}, url = {https://doi.org/10.1109/CDC.2003.1272682}, doi = {10.1109/CDC.2003.1272682}, timestamp = {Mon, 07 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cdc/XieL0Z03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cdc/Zhang00X03, author = {Huanshui Zhang and David Zhang and Wei Wang and Lihua Xie}, title = {Robust filtering by fictitious noises}, booktitle = {42nd {IEEE} Conference on Decision and Control, {CDC} 2003, Maui, Hawaii, USA, December 9-12, 2003}, pages = {1280--1284}, publisher = {{IEEE}}, year = {2003}, url = {https://doi.org/10.1109/CDC.2003.1272785}, doi = {10.1109/CDC.2003.1272785}, timestamp = {Mon, 07 Mar 2022 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cdc/Zhang00X03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cdc/Zhang0X03, author = {Huanshui Zhang and David Zhang and Lihua Xie}, title = {Necessary and sufficient condition for finite horizon H\({}_{\mbox{{\(\infty\)}}}\) estimation of time delay systems}, booktitle = {42nd {IEEE} Conference on Decision and Control, {CDC} 2003, Maui, Hawaii, USA, December 9-12, 2003}, pages = {5735--5740}, publisher = {{IEEE}}, year = {2003}, url = {https://doi.org/10.1109/CDC.2003.1271919}, doi = {10.1109/CDC.2003.1271919}, timestamp = {Sat, 09 Apr 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cdc/Zhang0X03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cisst/CheungKYZ03, author = {King Hong Cheung and Adams Wai{-}Kin Kong and Jane You and David Zhang}, editor = {Hamid R. Arabnia and Youngsong Mun}, title = {On Effective Palmprint Retrieval for Personal Identification}, booktitle = {Proceedings of the International Conference on Imaging Science, Systems and Technology, {CISST} '03, June 23 - 26, 2003, Las Vegas, Nevada, USA, Volume 1}, pages = {111--117}, publisher = {{CSREA} Press}, year = {2003}, timestamp = {Sat, 16 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cisst/CheungKYZ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cisst/YouZCK03, author = {Jane You and David Zhang and King Hong Cheung and Adams Wai{-}Kin Kong}, editor = {Hamid R. Arabnia and Youngsong Mun}, title = {A New Approach to Personal Identification Via Hierarchical Palmprint Coding}, booktitle = {Proceedings of the International Conference on Imaging Science, Systems and Technology, {CISST} '03, June 23 - 26, 2003, Las Vegas, Nevada, USA, Volume 2}, pages = {531--537}, publisher = {{CSREA} Press}, year = {2003}, timestamp = {Sat, 16 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/cisst/YouZCK03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icassp/0006BZ03, author = {Lei Zhang and Paul Bao and David Zhang}, title = {Interscale image denoising with wavelet context modeling}, booktitle = {2003 {IEEE} International Conference on Acoustics, Speech, and Signal Processing, {ICASSP} '03, Hong Kong, April 6-10, 2003}, pages = {97--100}, publisher = {{IEEE}}, year = {2003}, url = {https://doi.org/10.1109/ICASSP.2003.1201627}, doi = {10.1109/ICASSP.2003.1201627}, timestamp = {Mon, 22 Jun 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/icassp/0006BZ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpp/YouZCG03, author = {Jane You and David Zhang and Jiannong Cao and Minyi Guo}, title = {Parallel Biometrics Computing Using Mobile Agents}, booktitle = {32nd International Conference on Parallel Processing {(ICPP} 2003), 6-9 October 2003, Kaohsiung, Taiwan}, pages = {305--312}, publisher = {{IEEE} Computer Society}, year = {2003}, url = {https://doi.org/10.1109/ICPP.2003.1240593}, doi = {10.1109/ICPP.2003.1240593}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpp/YouZCG03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/waa/YuWWZ03, author = {Li Yu and Kuanquan Wang and Chengfa Wang and David Zhang}, editor = {Jian Ping Li and Jing Zhao and M. Victor Wickerhauser and Yuan Yan Tang and John Daugman and Lizhong Peng}, title = {Multiscale Wavelet Texture Based Iris Verification}, booktitle = {Wavelet Analysis and Its Applications, Third International Conference on WAA, Chongqing, P. R. China 29-31 May 2003, Proceedings}, pages = {200--205}, publisher = {World Scientific}, year = {2003}, timestamp = {Sat, 16 Sep 2017 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/waa/YuWWZ03.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijig/YouZ02, author = {Jane You and David Zhang}, title = {Smart Sensor: An On-Board Image Processing System for Real-Time Remote Sensing}, journal = {Int. J. Image Graph.}, volume = {2}, number = {3}, pages = {481}, year = {2002}, url = {https://doi.org/10.1142/S0219467802000718}, doi = {10.1142/S0219467802000718}, timestamp = {Tue, 24 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijig/YouZ02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijprai/BianZS02, author = {Zhaoqi Bian and David Zhang and Wei Shu}, title = {Knowledge-Based Fingerprint Post-Processing}, journal = {Int. J. Pattern Recognit. Artif. Intell.}, volume = {16}, number = {1}, pages = {53--67}, year = {2002}, url = {https://doi.org/10.1142/S021800140200154X}, doi = {10.1142/S021800140200154X}, timestamp = {Mon, 11 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijprai/BianZS02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijprai/LiZX02, author = {Wenxin Li and David Zhang and Zhuoqun Xu}, title = {Palmprint Identification by Fourier Transform}, journal = {Int. J. Pattern Recognit. Artif. Intell.}, volume = {16}, number = {4}, pages = {417--432}, year = {2002}, url = {https://doi.org/10.1142/S0218001402001757}, doi = {10.1142/S0218001402001757}, timestamp = {Wed, 28 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijprai/LiZX02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ivc/ZhouLZW02, author = {Jie Zhou and Xiao guang Lu and David Zhang and Chenyu Wu}, title = {Orientation analysis for rotated human face detection}, journal = {Image Vis. Comput.}, volume = {20}, number = {4}, pages = {257--264}, year = {2002}, url = {https://doi.org/10.1016/S0262-8856(02)00018-5}, doi = {10.1016/S0262-8856(02)00018-5}, timestamp = {Wed, 16 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ivc/ZhouLZW02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/YouLZ02, author = {Jane You and Wenxin Li and David Zhang}, title = {Hierarchical palmprint identification via multiple feature extraction}, journal = {Pattern Recognit.}, volume = {35}, number = {4}, pages = {847--859}, year = {2002}, url = {https://doi.org/10.1016/S0031-3203(01)00100-5}, doi = {10.1016/S0031-3203(01)00100-5}, timestamp = {Wed, 28 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/YouLZ02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/YangYZ02, author = {Jian Yang and Jing{-}Yu Yang and David Zhang}, title = {What's wrong with Fisher criterion?}, journal = {Pattern Recognit.}, volume = {35}, number = {11}, pages = {2665--2668}, year = {2002}, url = {https://doi.org/10.1016/S0031-3203(02)00071-7}, doi = {10.1016/S0031-3203(02)00071-7}, timestamp = {Tue, 01 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/pr/YangYZ02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcsv/ZhangW02, author = {David Dapeng Zhang and Zhou Wang}, title = {Image information restoration based on long-range correlation}, journal = {{IEEE} Trans. Circuits Syst. Video Technol.}, volume = {12}, number = {5}, pages = {331--341}, year = {2002}, url = {https://doi.org/10.1109/TCSVT.2002.1003472}, doi = {10.1109/TCSVT.2002.1003472}, timestamp = {Fri, 30 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcsv/ZhangW02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/ZhangPZP02, author = {David Zhang and Hui Peng and Jie Zhou and Sankar K. Pal}, title = {A novel face recognition system using hybrid neural and dual eigenspaces methods}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {A}}, volume = {32}, number = {6}, pages = {787--793}, year = {2002}, url = {https://doi.org/10.1109/TSMCA.2003.808252}, doi = {10.1109/TSMCA.2003.808252}, timestamp = {Wed, 16 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/ZhangPZP02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cbms/LishengZZC02, author = {Lisheng Xu and Kuanquan Zhang and David Zhang and Shi Cheng}, title = {Adaptive Baseline Wander Removal in the Pulse Waveform}, booktitle = {15th {IEEE} Symposium on Computer-Based Medical Systems {(CBMS} 2002), 4-7 June 2002, Maribor, Slovenia}, pages = {143--148}, publisher = {{IEEE} Computer Society}, year = {2002}, url = {https://doi.org/10.1109/CBMS.2002.1011368}, doi = {10.1109/CBMS.2002.1011368}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cbms/LishengZZC02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/LiWZ02, author = {Yanlai Li and Kuanquan Wang and David Zhang}, title = {Step Acceleration Based Training Algorithm for Feedforward Neural Networks}, booktitle = {16th International Conference on Pattern Recognition, {ICPR} 2002, Quebec, Canada, August 11-15, 2002}, pages = {84--87}, publisher = {{IEEE} Computer Society}, year = {2002}, url = {https://doi.org/10.1109/ICPR.2002.1048243}, doi = {10.1109/ICPR.2002.1048243}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/LiWZ02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/WuWZ02, author = {Xiangqian Wu and Kuanquan Wang and David Zhang}, title = {Fuzzy Directional Element Energy Feature {(FDEEF)} Based Palmprint Identification}, booktitle = {16th International Conference on Pattern Recognition, {ICPR} 2002, Quebec, Canada, August 11-15, 2002}, pages = {95--98}, publisher = {{IEEE} Computer Society}, year = {2002}, url = {https://doi.org/10.1109/ICPR.2002.1044621}, doi = {10.1109/ICPR.2002.1044621}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/WuWZ02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/ZhouZ02, author = {Jie Zhou and David Zhang}, title = {Face Recognition by Combining Several Algorithms}, booktitle = {16th International Conference on Pattern Recognition, {ICPR} 2002, Quebec, Canada, August 11-15, 2002}, pages = {497}, publisher = {{IEEE} Computer Society}, year = {2002}, url = {https://doi.org/10.1109/ICPR.2002.1047985}, doi = {10.1109/ICPR.2002.1047985}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/ZhouZ02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/PangWZZ02, author = {Bo Pang and Kuanquan Wang and David Zhang and Fengmiao Zhang}, title = {On Automated Tongue Image Segmentation in Chinese Medicine}, booktitle = {16th International Conference on Pattern Recognition, {ICPR} 2002, Quebec, Canada, August 11-15, 2002}, pages = {616--619}, publisher = {{IEEE} Computer Society}, year = {2002}, url = {https://doi.org/10.1109/ICPR.2002.1044817}, doi = {10.1109/ICPR.2002.1044817}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/PangWZZ02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/KongZ02, author = {Adams Wai{-}Kin Kong and David Zhang}, title = {Palmprint Texture Analysis Based on Low-Resolution Images for Personal Authentication}, booktitle = {16th International Conference on Pattern Recognition, {ICPR} 2002, Quebec, Canada, August 11-15, 2002}, pages = {807--810}, publisher = {{IEEE} Computer Society}, year = {2002}, url = {https://doi.org/10.1109/ICPR.2002.1048142}, doi = {10.1109/ICPR.2002.1048142}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/KongZ02.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cg/YinPSZ01, author = {KangKang Yin and Zhigeng Pan and Jiaoying Shi and David Zhang}, title = {Robust mesh watermarking based on multiresolution processing}, journal = {Comput. Graph.}, volume = {25}, number = {3}, pages = {409--420}, year = {2001}, url = {https://doi.org/10.1016/S0097-8493(01)00065-6}, doi = {10.1016/S0097-8493(01)00065-6}, timestamp = {Wed, 19 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cg/YinPSZ01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijig/ShuRBZ01, author = {Wei Shu and Gang Rong and Zhaoqi Bian and David Zhang}, title = {Automatic Palmprint Verification}, journal = {Int. J. Image Graph.}, volume = {1}, number = {1}, pages = {135--151}, year = {2001}, url = {https://doi.org/10.1142/S0219467801000104}, doi = {10.1142/S0219467801000104}, timestamp = {Tue, 24 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/ijig/ShuRBZ01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jss/CaiCWYZ01, author = {Kai{-}Yuan Cai and Lin Cai and Weidong Wang and Zhou{-}Yi Yu and David Zhang}, title = {On the neural network approach in software reliability modeling}, journal = {J. Syst. Softw.}, volume = {58}, number = {1}, pages = {47--62}, year = {2001}, url = {https://doi.org/10.1016/S0164-1212(01)00027-9}, doi = {10.1016/S0164-1212(01)00027-9}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/jss/CaiCWYZ01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/npsc/ZhuHSZ01, author = {Xiaoyan Zhu and Yu Hao and Yifan Shi and David Zhang}, title = {An effective result-feedback neural algorithm for handwritten character recognition}, journal = {Neural Parallel Sci. Comput.}, volume = {9}, number = {2}, pages = {139--150}, year = {2001}, url = {http://dl.acm.org/citation.cfm?id=639014}, timestamp = {Wed, 02 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/npsc/ZhuHSZ01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/cvpr/ZhouXGZZ01, author = {Jie Zhou and Le{-}ping Xin and Dashan Gao and Changshui Zhang and David Zhang}, title = {Automated Cartridge Identification for Firearm Authentication}, booktitle = {2001 {IEEE} Computer Society Conference on Computer Vision and Pattern Recognition {(CVPR} 2001), with CD-ROM, 8-14 December 2001, Kauai, HI, {USA}}, pages = {749--754}, publisher = {{IEEE} Computer Society}, year = {2001}, url = {https://doi.org/10.1109/CVPR.2001.990551}, doi = {10.1109/CVPR.2001.990551}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/cvpr/ZhouXGZZ01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/spieSR/LiZXY01, author = {Wenxin Li and David Zhang and Zhuoqun Xu and Jane You}, editor = {Minerva M. Yeung and Chung{-}Sheng Li and Rainer Lienhart}, title = {Texture-based approach to palmprint retrieval for personal identification}, booktitle = {Storage and Retrieval for Media Databases 2001, San Jose, CA, USA, January 24, 2001}, series = {{SPIE} Proceedings}, volume = {4315}, pages = {415--424}, publisher = {{SPIE}}, year = {2001}, url = {https://doi.org/10.1117/12.410952}, doi = {10.1117/12.410952}, timestamp = {Wed, 28 Oct 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/spieSR/LiZXY01.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/spic/WangZY00, author = {Zhou Wang and David Zhang and Yinglin Yu}, title = {Hybrid image coding based on partial fractal mapping}, journal = {Signal Process. Image Commun.}, volume = {15}, number = {9}, pages = {767--779}, year = {2000}, url = {https://doi.org/10.1016/S0923-5965(99)00018-1}, doi = {10.1016/S0923-5965(99)00018-1}, timestamp = {Fri, 30 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/spic/WangZY00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tnn/ZhangP00, author = {David Zhang and Sankar K. Pal}, title = {A fuzzy clustering neural networks (FCNs) system design methodology}, journal = {{IEEE} Trans. Neural Networks Learn. Syst.}, volume = {11}, number = {5}, pages = {1174--1177}, year = {2000}, url = {https://doi.org/10.1109/72.870048}, doi = {10.1109/72.870048}, timestamp = {Mon, 09 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tnn/ZhangP00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/ZhangP00, author = {David Zhang and Sankar K. Pal}, title = {Parallel system design for time-delay neural networks}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {C}}, volume = {30}, number = {2}, pages = {265--275}, year = {2000}, url = {https://doi.org/10.1109/5326.868447}, doi = {10.1109/5326.868447}, timestamp = {Thu, 21 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/ZhangP00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/YiyingZZ00, author = {Yiying Zhang and David Zhang and Xiaoyan Zhu}, title = {A novel text-independent speaker verification method based on the global speaker model}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {A}}, volume = {30}, number = {5}, pages = {598--602}, year = {2000}, url = {https://doi.org/10.1109/3468.867867}, doi = {10.1109/3468.867867}, timestamp = {Mon, 25 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/YiyingZZ00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tsmc/ZhangZZ00, author = {Y. Zhang and X. Zhu and David Zhang}, title = {Correction to a novel text-independent speaker verification method based on the global speaker model}, journal = {{IEEE} Trans. Syst. Man Cybern. Part {A}}, volume = {30}, number = {6}, pages = {883}, year = {2000}, url = {https://doi.org/10.1109/TSMCA.2000.895929}, doi = {10.1109/TSMCA.2000.895929}, timestamp = {Mon, 25 May 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tsmc/ZhangZZ00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icppw/LiZLQ00, author = {Wen Li and David Dapeng Zhang and Zhiyong Liu and Xiangzhen Qiao}, title = {A Jump and Look All Round Long Range Image Restoration and Its Parallelism}, booktitle = {Proceedings of the 2000 International Workshop on Parallel Processing, {ICPPW} 2000, Toronto, Canada, August 21-24, 2000}, pages = {285--290}, publisher = {{IEEE} Computer Society}, year = {2000}, url = {https://doi.org/10.1109/ICPPW.2000.869114}, doi = {10.1109/ICPPW.2000.869114}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icppw/LiZLQ00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/smc/ZhouXRZ00, author = {Jie Zhou and Le{-}ping Xin and Gang Rong and David Zhang}, title = {Decision fusion based cartridge identification using Support Vector Machine}, booktitle = {Proceedings of the {IEEE} International Conference on Systems, Man {\&} Cybernetics: "Cybernetics Evolving to Systems, Humans, Organizations, and their Complex Interactions", Sheraton Music City Hotel, Nashville, Tennessee, USA, 8-11 October 2000}, pages = {2873--2877}, publisher = {{IEEE}}, year = {2000}, url = {https://doi.org/10.1109/ICSMC.2000.884434}, doi = {10.1109/ICSMC.2000.884434}, timestamp = {Wed, 16 Sep 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/smc/ZhouXRZ00.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/pr/ZhangS99, author = {David Dapeng Zhang and Wei Shu}, title = {Two novel characteristics in palmprint verification: datum point invariance and line feature matching}, journal = {Pattern Recognit.}, volume = {32}, number = {4}, pages = {691--702}, year = {1999}, url = {https://doi.org/10.1016/S0031-3203(98)00117-4}, doi = {10.1016/S0031-3203(98)00117-4}, timestamp = {Mon, 24 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/pr/ZhangS99.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/cn/TongZ98, author = {Franky H. F. Tong and David Zhang}, title = {A new progressive colour image transmission scheme for the World Wide Web}, journal = {Comput. Networks}, volume = {30}, number = {20-21}, pages = {2059--2064}, year = {1998}, url = {https://doi.org/10.1016/S0169-7552(98)00210-4}, doi = {10.1016/S0169-7552(98)00210-4}, timestamp = {Wed, 19 Feb 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/cn/TongZ98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/spl/WangZ98, author = {Zhou Wang and David Zhang}, title = {Restoration of impulse noise corrupted images using long-range correlation}, journal = {{IEEE} Signal Process. Lett.}, volume = {5}, number = {1}, pages = {4--7}, year = {1998}, url = {https://doi.org/10.1109/97.654865}, doi = {10.1109/97.654865}, timestamp = {Fri, 30 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/spl/WangZ98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tcom/WangZ98, author = {Zhou Wang and David Dapeng Zhang}, title = {A novel approach for reduction of blocking effects in low-bit-rate image compression}, journal = {{IEEE} Trans. Commun.}, volume = {46}, number = {6}, pages = {732--734}, year = {1998}, url = {https://doi.org/10.1109/26.681401}, doi = {10.1109/26.681401}, timestamp = {Fri, 30 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tcom/WangZ98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tip/WangYZ98, author = {Zhou Wang and Yinglin Yu and David Zhang}, title = {Best neighborhood matching: an information loss restoration technique for block-based image coding systems}, journal = {{IEEE} Trans. Image Process.}, volume = {7}, number = {7}, pages = {1056--1061}, year = {1998}, url = {https://doi.org/10.1109/83.701166}, doi = {10.1109/83.701166}, timestamp = {Fri, 30 Jul 2021 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/tip/WangYZ98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/icpr/ShuZ98, author = {Wei Shu and David Zhang}, editor = {Anil K. Jain and Svetha Venkatesh and Brian C. Lovell}, title = {Palmprint verification: an implementation of biometric technology}, booktitle = {Fourteenth International Conference on Pattern Recognition, {ICPR} 1998, Brisbane, Australia, 16-20 August, 1998}, pages = {219--221}, publisher = {{IEEE} Computer Society}, year = {1998}, url = {https://doi.org/10.1109/ICPR.1998.711120}, doi = {10.1109/ICPR.1998.711120}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/icpr/ShuZ98.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/tvlsi/ZhangE97, author = {David Zhang and Mohamed I. Elmasry}, title = {{VLSI} compressor design with applications to digital neural networks}, journal = {{IEEE} Trans. Very Large Scale Integr. Syst.}, volume = {5}, number = {2}, pages = {230--233}, year = {1997}, url = {https://doi.org/10.1109/92.585226}, doi = {10.1109/92.585226}, timestamp = {Wed, 11 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/journals/tvlsi/ZhangE97.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/apdc/Zhang97, author = {David Dapeng Zhang}, title = {Parallel {VLSI} Neural System Design for Time-Delay Speech Recognition Computing}, booktitle = {Proceedings of the 1997 Advances in Parallel and Distributed Computing Conference {(APDC} '97), March 19-21, 1997, Shanghai, China}, pages = {12--17}, publisher = {{IEEE} Computer Society}, year = {1997}, url = {https://doi.org/10.1109/APDC.1997.574008}, doi = {10.1109/APDC.1997.574008}, timestamp = {Fri, 24 Mar 2023 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/apdc/Zhang97.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/ijns/ZhangJ96, author = {David Zhang and Graham A. Jullien}, title = {{VLSI} Neural System Architecture for Finite Ring Recursive Reduction}, journal = {Int. J. Neural Syst.}, volume = {7}, number = {6}, pages = {697--708}, year = {1996}, url = {http://ejournals.wspc.com.sg/ijns/07/0706/jull.html}, timestamp = {Thu, 24 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/ijns/ZhangJ96.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jcsc/ZhangE96, author = {David Zhang and Mohamed I. Elmasry}, title = {A Digital Perceptron Learning Implementation with Look-up Table Feedback Layer}, journal = {J. Circuits Syst. Comput.}, volume = {6}, number = {1}, pages = {79--84}, year = {1996}, url = {https://doi.org/10.1142/S021812669600008X}, doi = {10.1142/S021812669600008X}, timestamp = {Tue, 25 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jcsc/ZhangE96.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/npsc/ZhangE96, author = {David Zhang and Mohamed I. Elmasry}, title = {Mapping neural networks onto systolic arrays}, journal = {Neural Parallel Sci. Comput.}, volume = {4}, number = {3}, pages = {341--352}, year = {1996}, url = {http://dl.acm.org/citation.cfm?id=241624}, timestamp = {Thu, 27 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/npsc/ZhangE96.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/npsc/ZhangE96a, author = {David Zhang and Mohamed I. Elmasry}, title = {A parallel digital layered perceptrons implementation}, journal = {Neural Parallel Sci. Comput.}, volume = {4}, number = {4}, pages = {493--504}, year = {1996}, url = {http://dl.acm.org/citation.cfm?id=254756}, timestamp = {Thu, 27 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/npsc/ZhangE96a.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/npsc/ZhangGE95, author = {David Zhang and Richard X. Gu and Mohamed I. Elmasry}, title = {A programmable neural network architecture using BiCMOS technology}, journal = {Neural Parallel Sci. Comput.}, volume = {3}, number = {1}, pages = {103--113}, year = {1995}, url = {http://dl.acm.org/citation.cfm?id=204450}, timestamp = {Mon, 18 Jul 2022 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/npsc/ZhangGE95.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jifs/ZhangKE94, author = {David Zhang and Mohamed Kamel and Mohamed I. Elmasry}, title = {Fuzzy Clustering Neural Network {(FCNN):} Competitive Learning and Parallel Architecture}, journal = {J. Intell. Fuzzy Syst.}, volume = {2}, number = {4}, pages = {289--298}, year = {1994}, url = {https://doi.org/10.3233/IFS-1994-2402}, doi = {10.3233/IFS-1994-2402}, timestamp = {Mon, 28 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jifs/ZhangKE94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/jssc/JullienMGPBZ94, author = {Graham A. Jullien and William C. Miller and Roger Grondin and Lino Del Pup and Sami S. Bizzan and David Zhang}, title = {Dynamic computational blocks for bit-level systolic arrays}, journal = {{IEEE} J. Solid State Circuits}, volume = {29}, number = {1}, pages = {14--22}, year = {1994}, url = {https://doi.org/10.1109/4.272090}, doi = {10.1109/4.272090}, timestamp = {Mon, 28 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/jssc/JullienMGPBZ94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@article{DBLP:journals/npsc/ZhangDE94, author = {David Zhang and Li Deng and Mohamed I. Elmasry}, title = {Pipelined architecture for neural-network-based speech recognition}, journal = {Neural Parallel Sci. Comput.}, volume = {2}, number = {1}, pages = {81--92}, year = {1994}, url = {http://dl.acm.org/citation.cfm?id=184206}, timestamp = {Thu, 27 Aug 2020 01:00:00 +0200}, biburl = {https://dblp.org/rec/journals/npsc/ZhangDE94.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/arith/ZhangJMS91, author = {David Zhang and Graham A. Jullien and William C. Miller and Earl E. Swartzlander Jr.}, title = {Arithmetic for digital neural networks}, booktitle = {10th {IEEE} Symposium on Computer Arithmetic, {ARITH} 1991, Grenoble, France, June 26-28, 1991}, pages = {58--63}, publisher = {{IEEE}}, year = {1991}, url = {https://doi.org/10.1109/ARITH.1991.145534}, doi = {10.1109/ARITH.1991.145534}, timestamp = {Thu, 24 Aug 2023 01:00:00 +0200}, biburl = {https://dblp.org/rec/conf/arith/ZhangJMS91.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
@inproceedings{DBLP:conf/mva/ZhangB88, author = {David Dapeng Zhang and Zhaoqi Bian}, title = {Some Researches of Pyramid Structure in Robot Vision System}, booktitle = {Proceedings of {IAPR} Workshop on Computer Vision - Special Hardware and Industrial Applications, {MVA} 1988, Tokyo, Japan, October 12-14, 1988}, pages = {124--127}, year = {1988}, url = {http://www.mva-org.jp/Proceedings/CommemorativeDVD/1988/papers/1988124.pdf}, timestamp = {Thu, 12 Mar 2020 00:00:00 +0100}, biburl = {https://dblp.org/rec/conf/mva/ZhangB88.bib}, bibsource = {dblp computer science bibliography, https://dblp.org} }
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.