Stop the war!Остановите войну!
for scientists:
default search action
Google
Google Scholar
Semantic Scholar
Internet Archive Scholar
CiteSeerX
ORCIDBibTeX records: Nenad Stojanovic
@article{DBLP:journals/vc/BondzulicPSPB24,
author = {Boban P. Bondzulic and
Boban Pavlovic and
Nenad Stojanovic and
Vladimir S. Petrovic and
Dimitrije Bujakovic},
title = {A simple and reliable approach to providing a visually lossless image
compression},
journal = {Vis. Comput.},
volume = {40},
number = {5},
pages = {3747--3763},
year = {2024},
url = {https://doi.org/10.1007/s00371-023-03062-y},
doi = {10.1007/S00371-023-03062-Y},
timestamp = {Sat, 04 May 2024 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/vc/BondzulicPSPB24.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/information/EirinakisLPAKKL22,
author = {Pavlos Eirinakis and
Stavros Lounis and
Stathis Plitsos and
George Arampatzis and
Kostas Kalaboukas and
Klemen Kenda and
Jinzhi Lu and
Joze M. Rozanec and
Nenad Stojanovic},
title = {Cognitive Digital Twins for Resilience in Production: {A} Conceptual
Framework},
journal = {Inf.},
volume = {13},
number = {1},
pages = {33},
year = {2022},
url = {https://doi.org/10.3390/info13010033},
doi = {10.3390/INFO13010033},
timestamp = {Wed, 23 Feb 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/information/EirinakisLPAKKL22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/isie/LeitaoCPCUSBW22,
author = {Paulo Leit{\~{a}}o and
Cristina Cristalli and
Nicola Paone and
Paolo Chiariotti and
Wilfrid Utz and
Nenad Stojanovic and
Jos{\'{e}} Barata and
Robert Woitsch},
title = {Integrating Standardization in Research and Innovation Projects: the
{GO0DMAN} Experience},
booktitle = {31st {IEEE} International Symposium on Industrial Electronics, {ISIE}
2022, Anchorage, AK, USA, June 1-3, 2022},
pages = {1147--1152},
publisher = {{IEEE}},
year = {2022},
url = {https://doi.org/10.1109/ISIE51582.2022.9831486},
doi = {10.1109/ISIE51582.2022.9831486},
timestamp = {Mon, 05 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/isie/LeitaoCPCUSBW22.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/information/JacobyJSS21,
author = {Michael Jacoby and
Branislav Jovicic and
Ljiljana Stojanovic and
Nenad Stojanovic},
title = {An Approach for Realizing Hybrid Digital Twins Using Asset Administration
Shells and Apache StreamPipes},
journal = {Inf.},
volume = {12},
number = {6},
pages = {217},
year = {2021},
url = {https://doi.org/10.3390/info12060217},
doi = {10.3390/INFO12060217},
timestamp = {Thu, 29 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/information/JacobyJSS21.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fuin/DjordjevicIS20,
author = {Radosav Djordjevic and
Nebojsa Ikodinovic and
Nenad Stojanovic},
title = {A Propositional Metric Logic with Fixed Finite Ranges},
journal = {Fundam. Informaticae},
volume = {174},
number = {2},
pages = {185--199},
year = {2020},
url = {https://doi.org/10.3233/FI-2020-1938},
doi = {10.3233/FI-2020-1938},
timestamp = {Sat, 30 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/fuin/DjordjevicIS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ice-itmc/AbburuBJRSS20,
author = {Sailesh Abburu and
Arne J. Berre and
Michael Jacoby and
Dumitru Roman and
Ljiljana Stojanovic and
Nenad Stojanovic},
title = {{COGNITWIN} - Hybrid and Cognitive Digital Twins for the Process Industry},
booktitle = {2020 {IEEE} International Conference on Engineering, Technology and
Innovation, {ICE/ITMC} 2020, Cardiff, United Kingdom, June 15-17,
2020},
pages = {1--8},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICE/ITMC49519.2020.9198403},
doi = {10.1109/ICE/ITMC49519.2020.9198403},
timestamp = {Tue, 29 Sep 2020 11:43:56 +0200},
biburl = {https://dblp.org/rec/conf/ice-itmc/AbburuBJRSS20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ice-itmc/EirinakisKLMRSZ20,
author = {Pavlos Eirinakis and
Kostas Kalaboukas and
Stavros Lounis and
Ioannis Mourtos and
Joze M. Rozanec and
Nenad Stojanovic and
Georgios Zois},
title = {Enhancing Cognition for Digital Twins},
booktitle = {2020 {IEEE} International Conference on Engineering, Technology and
Innovation, {ICE/ITMC} 2020, Cardiff, United Kingdom, June 15-17,
2020},
pages = {1--7},
publisher = {{IEEE}},
year = {2020},
url = {https://doi.org/10.1109/ICE/ITMC49519.2020.9198492},
doi = {10.1109/ICE/ITMC49519.2020.9198492},
timestamp = {Sat, 09 Apr 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ice-itmc/EirinakisKLMRSZ20.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19,
author = {Ziawasch Abedjan and
Nozha Boujemaa and
Stuart Campbell and
Patricia Casla and
Supriyo Chatterjea and
Sergio Consoli and
Crist{\'{o}}bal Costa Soria and
Paul Czech and
Marija Despenic and
Chiara Garattini and
Dirk Hamelinck and
Adrienne Heinrich and
Wessel Kraaij and
Jacek Kustra and
Aizea Lojo and
Marga Martin Sanchez and
Miguel Angel Mayer and
Matteo Melideo and
Ernestina Menasalvas and
Frank M{\o}ller Aarestrup and
Elvira Narro Artigot and
Milan Petkovic and
Diego Reforgiato Recupero and
Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
Gisele Roesems Kerremans and
Roland Roller and
M{\'{a}}rio Rom{\~{a}}o and
Stefan R{\"{u}}ping and
Felix Sasaki and
Wouter Spek and
Nenad Stojanovic and
Jack Thoms and
Andrejs Vasiljevs and
Wilfried Verachtert and
Roel Wuyts},
editor = {Sergio Consoli and
Diego Reforgiato Recupero and
Milan Petkovic},
title = {Data Science in Healthcare: Benefits, Challenges and Opportunities},
booktitle = {Data Science for Healthcare - Methodologies and Applications},
pages = {3--38},
publisher = {Springer},
year = {2019},
url = {https://doi.org/10.1007/978-3-030-05249-2\_1},
doi = {10.1007/978-3-030-05249-2\_1},
timestamp = {Fri, 22 Mar 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/flap/StojanovicID18,
author = {Nenad Stojanovic and
Nebojsa Ikodinovic and
Radosav Djordjevic},
title = {A Propositional Logic with Binary Metric Operators},
journal = {{FLAP}},
volume = {5},
number = {8},
pages = {1605--1622},
year = {2018},
url = {https://www.collegepublications.co.uk/downloads/ifcolog00028.pdf},
timestamp = {Thu, 12 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/flap/StojanovicID18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ubiquity/JohnsonTPMPSLBA18,
author = {Jeffrey H. Johnson and
Luca Tesei and
Marco Piangerelli and
Emanuela Merelli and
Riccardo Paci and
Nenad Stojanovic and
Paulo Leit{\~{a}}o and
Jos{\'{e}} Barbosa and
Marco Amador},
title = {Big Data: Business, Technology, Education, and Science: Big Data (Ubiquity
symposium)},
journal = {Ubiquity},
volume = {2018},
number = {July},
pages = {2:1--2:13},
year = {2018},
url = {http://doi.acm.org/10.1145/3158350},
doi = {10.1145/3158350},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ubiquity/JohnsonTPMPSLBA18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bigdataconf/StojanovicM18,
author = {Nenad Stojanovic and
Dejan Milenovic},
editor = {Naoki Abe and
Huan Liu and
Calton Pu and
Xiaohua Hu and
Nesreen K. Ahmed and
Mu Qiao and
Yang Song and
Donald Kossmann and
Bing Liu and
Kisung Lee and
Jiliang Tang and
Jingrui He and
Jeffrey S. Saltz},
title = {Data-driven Digital Twin approach for process optimization: an industry
use case},
booktitle = {{IEEE} International Conference on Big Data {(IEEE} BigData 2018),
Seattle, WA, USA, December 10-13, 2018},
pages = {4202--4211},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/BigData.2018.8622412},
doi = {10.1109/BIGDATA.2018.8622412},
timestamp = {Fri, 19 Nov 2021 16:08:20 +0100},
biburl = {https://dblp.org/rec/conf/bigdataconf/StojanovicM18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bigdataconf/StojanovicJ18,
author = {Nenad Stojanovic and
Milan Jovic},
editor = {Naoki Abe and
Huan Liu and
Calton Pu and
Xiaohua Hu and
Nesreen K. Ahmed and
Mu Qiao and
Yang Song and
Donald Kossmann and
Bing Liu and
Kisung Lee and
Jiliang Tang and
Jingrui He and
Jeffrey S. Saltz},
title = {Continuous real-time anomaly detection in the flexible production:
D2Lab-based use case},
booktitle = {{IEEE} International Conference on Big Data {(IEEE} BigData 2018),
Seattle, WA, USA, December 10-13, 2018},
pages = {4213--4222},
publisher = {{IEEE}},
year = {2018},
url = {https://doi.org/10.1109/BigData.2018.8622124},
doi = {10.1109/BIGDATA.2018.8622124},
timestamp = {Wed, 31 Mar 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bigdataconf/StojanovicJ18.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bigdataconf/StojanovicDS17,
author = {Nenad Stojanovic and
Marko Dinic and
Ljiljana Stojanovic},
editor = {Jian{-}Yun Nie and
Zoran Obradovic and
Toyotaro Suzumura and
Rumi Ghosh and
Raghunath Nambiar and
Chonggang Wang and
Hui Zang and
Ricardo Baeza{-}Yates and
Xiaohua Hu and
Jeremy Kepner and
Alfredo Cuzzocrea and
Jian Tang and
Masashi Toyoda},
title = {A data-driven approach for multivariate contextualized anomaly detection:
Industry use case},
booktitle = {2017 {IEEE} International Conference on Big Data {(IEEE} BigData 2017),
Boston, MA, USA, December 11-14, 2017},
pages = {1560--1569},
publisher = {{IEEE} Computer Society},
year = {2017},
url = {https://doi.org/10.1109/BigData.2017.8258090},
doi = {10.1109/BIGDATA.2017.8258090},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/bigdataconf/StojanovicDS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/closer/VerginadisAMS17,
author = {Yiannis Verginadis and
Iyad Alshabani and
Gregoris Mentzas and
Nenad Stojanovic},
editor = {Donald Ferguson and
V{\'{\i}}ctor M{\'{e}}ndez Mu{\~{n}}oz and
Jorge Cardoso and
Markus Helfert and
Claus Pahl},
title = {PrEstoCloud: Proactive Cloud Resources Management at the Edge for
Efficient Real-Time Big Data Processing},
booktitle = {{CLOSER} 2017 - Proceedings of the 7th International Conference on
Cloud Computing and Services Science, Porto, Portugal, April 24-26,
2017},
pages = {583--589},
publisher = {SciTePress},
year = {2017},
url = {https://doi.org/10.5220/0006359105830589},
doi = {10.5220/0006359105830589},
timestamp = {Thu, 03 Feb 2022 09:27:48 +0100},
biburl = {https://dblp.org/rec/conf/closer/VerginadisAMS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ice-itmc/StojanovicS17,
author = {Ljiljana Stojanovic and
Nenad Stojanovic},
title = {PREMIuM: Big data platform for enabling self-healing manufacturing},
booktitle = {International Conference on Engineering, Technology and Innovation,
{ICE/ITMC} 2017, Madeira Island, Portugal, June 27-29, 2017},
pages = {1501--1508},
publisher = {{IEEE}},
year = {2017},
url = {https://doi.org/10.1109/ICE.2017.8280060},
doi = {10.1109/ICE.2017.8280060},
timestamp = {Wed, 16 Oct 2019 14:14:53 +0200},
biburl = {https://dblp.org/rec/conf/ice-itmc/StojanovicS17.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bigdataconf/StojanovicDSS16,
author = {Ljiljana Stojanovic and
Marko Dinic and
Nenad Stojanovic and
Aleksandar Stojadinovic},
editor = {James Joshi and
George Karypis and
Ling Liu and
Xiaohua Hu and
Ronay Ak and
Yinglong Xia and
Weijia Xu and
Aki{-}Hiro Sato and
Sudarsan Rachuri and
Lyle H. Ungar and
Philip S. Yu and
Rama Govindaraju and
Toyotaro Suzumura},
title = {Big-data-driven anomaly detection in industry {(4.0):} An approach
and a case study},
booktitle = {2016 {IEEE} International Conference on Big Data {(IEEE} BigData 2016),
Washington DC, USA, December 5-8, 2016},
pages = {1647--1652},
publisher = {{IEEE} Computer Society},
year = {2016},
url = {https://doi.org/10.1109/BigData.2016.7840777},
doi = {10.1109/BIGDATA.2016.7840777},
timestamp = {Fri, 19 Nov 2021 16:08:20 +0100},
biburl = {https://dblp.org/rec/conf/bigdataconf/StojanovicDSS16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/otm/FigueirasGCBSJ16,
author = {Paulo Figueiras and
Guilherme Guerreiro and
Ruben Costa and
Luka Bradesko and
Nenad Stojanovic and
Ricardo Jardim{-}Gon{\c{c}}alves},
editor = {Ioana Ciuciu and
Christophe Debruyne and
Herv{\'{e}} Panetto and
Georg Weichhart and
Peter Bollen and
Anna Fensel and
Maria{-}Esther Vidal},
title = {Big Data Harmonization for Intelligent Mobility: {A} Dynamic Toll-Charging
Scenario},
booktitle = {On the Move to Meaningful Internet Systems: {OTM} 2016 Workshops -
Confederated International Workshops: EI2N, FBM, ICSP, Meta4eS, and
{OTMA} 2016, Rhodes, Greece, October 24-28, 2016, Revised Selected
Papers},
series = {Lecture Notes in Computer Science},
volume = {10034},
pages = {76--86},
publisher = {Springer},
year = {2016},
url = {https://doi.org/10.1007/978-3-319-55961-2\_8},
doi = {10.1007/978-3-319-55961-2\_8},
timestamp = {Sat, 19 Oct 2019 20:26:09 +0200},
biburl = {https://dblp.org/rec/conf/otm/FigueirasGCBSJ16.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bigdataconf/StojanovicDS15,
author = {Nenad Stojanovic and
Marko Dinic and
Ljiljana Stojanovic},
title = {Big data process analytics for continuous process improvement in manufacturing},
booktitle = {2015 {IEEE} International Conference on Big Data {(IEEE} BigData 2015),
Santa Clara, CA, USA, October 29 - November 1, 2015},
pages = {1398--1407},
publisher = {{IEEE} Computer Society},
year = {2015},
url = {https://doi.org/10.1109/BigData.2015.7363900},
doi = {10.1109/BIGDATA.2015.7363900},
timestamp = {Fri, 19 Nov 2021 16:08:20 +0100},
biburl = {https://dblp.org/rec/conf/bigdataconf/StojanovicDS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/StojadinovicSS15,
author = {Aleksandar Stojadinovic and
Nenad Stojanovic and
Ljiljana Stojanovic},
editor = {Frank Eliassen and
Roman Vitenberg},
title = {Dynamic monitoring for improving worker safety at the workplace: use
case from a manufacturing shop floor},
booktitle = {Proceedings of the 9th {ACM} International Conference on Distributed
Event-Based Systems, {DEBS} '15, Oslo, Norway, June 29 - July 3, 2015},
pages = {205--216},
publisher = {{ACM}},
year = {2015},
url = {https://doi.org/10.1145/2675743.2771881},
doi = {10.1145/2675743.2771881},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/StojadinovicSS15.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ruleml/2015c,
editor = {Nick Bassiliades and
Paul Fodor and
Adrian Giurca and
Georg Gottlob and
Tom{\'{a}}s Kliegr and
Grzegorz J. Nalepa and
Monica Palmirani and
Adrian Paschke and
Mark Proctor and
Dumitru Roman and
Fariba Sadri and
Nenad Stojanovic},
title = {Proceedings of the RuleML 2015 Challenge, the Special Track on Rule-based
Recommender Systems for the Web of Data, the Special Industry Track
and the RuleML 2015 Doctoral Consortium hosted by the 9th International
Web Rule Symposium (RuleML 2015), Berlin, Germany, August 2-5, 2015},
series = {{CEUR} Workshop Proceedings},
volume = {1417},
publisher = {CEUR-WS.org},
year = {2015},
url = {https://ceur-ws.org/Vol-1417},
urn = {urn:nbn:de:0074-1417-1},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ruleml/2015c.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/MagoutasSBAMS14,
author = {Babis Magoutas and
Nenad Stojanovic and
Alexandros Bousdekis and
Dimitris Apostolou and
Gregoris Mentzas and
Ljiljana Stojanovic},
editor = {Selmin Nurcan and
Elias Pimenidis and
Oscar Pastor and
Yannis Vassiliou},
title = {Anticipation-driven Architecture for Proactive Enterprise Decision
Making},
booktitle = {Joint Proceedings of the CAiSE 2014 Forum and CAiSE 2014 Doctoral
Consortium co-located with the 26th International Conference on Advanced
Information Systems Engineering (CAiSE 2014), Thessaloniki, Greece,
June 18-20, 2014},
series = {{CEUR} Workshop Proceedings},
volume = {1164},
pages = {121--128},
publisher = {CEUR-WS.org},
year = {2014},
url = {https://ceur-ws.org/Vol-1164/PaperVision16.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:35 +0100},
biburl = {https://dblp.org/rec/conf/caise/MagoutasSBAMS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/StojanovicXSS14,
author = {Nenad Stojanovic and
Yongchun Xu and
Aleksandar Stojadinovic and
Ljiljana Stojanovic},
editor = {Umesh Bellur and
Ravi Kothari},
title = {Using mobile-based complex event processing to realize collaborative
remote person monitoring},
booktitle = {The 8th {ACM} International Conference on Distributed Event-Based
Systems, {DEBS} '14, Mumbai, India, May 26-29, 2014},
pages = {225--235},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2611286.2611306},
doi = {10.1145/2611286.2611306},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/StojanovicXSS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/StojanovicSXS14,
author = {Nenad Stojanovic and
Ljiljana Stojanovic and
Yongchun Xu and
Boban Stajic Nissatech},
editor = {Umesh Bellur and
Ravi Kothari},
title = {Mobile {CEP} in real-time big data processing: challenges and opportunities},
booktitle = {The 8th {ACM} International Conference on Distributed Event-Based
Systems, {DEBS} '14, Mumbai, India, May 26-29, 2014},
pages = {256--265},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2611286.2611311},
doi = {10.1145/2611286.2611311},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/StojanovicSXS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/StojanovicXNS14,
author = {Nenad Stojanovic and
Yongchun Xu and
Boban Stajic Nissatech and
Ljiljana Stojanovic},
editor = {Umesh Bellur and
Ravi Kothari},
title = {Mobile {CEP} architecture: from intelligent sensing to collaborative
monitoring},
booktitle = {The 8th {ACM} International Conference on Distributed Event-Based
Systems, {DEBS} '14, Mumbai, India, May 26-29, 2014},
pages = {350--353},
publisher = {{ACM}},
year = {2014},
url = {https://doi.org/10.1145/2611286.2611322},
doi = {10.1145/2611286.2611322},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/StojanovicXNS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/soca/RiemerSS14,
author = {Dominik Riemer and
Ljiljana Stojanovic and
Nenad Stojanovic},
title = {{SEPP:} Semantics-Based Management of Fast Data Streams},
booktitle = {7th {IEEE} International Conference on Service-Oriented Computing
and Applications, {SOCA} 2014, Matsue, Japan, November 17-19, 2014},
pages = {113--118},
publisher = {{IEEE} Computer Society},
year = {2014},
url = {https://doi.org/10.1109/SOCA.2014.52},
doi = {10.1109/SOCA.2014.52},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/soca/RiemerSS14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/cogtech/StuderBS0Z14,
author = {Rudi Studer and
Catherina Burghart and
Nenad Stojanovic and
Thanh Tran and
Valentin Zacharias},
editor = {Wolfgang Wahlster and
Hans{-}Joachim Grallert and
Stefan Wess and
Hermann Friedrich and
Thomas Widenka},
title = {New Dimensions in Semantic Knowledge Management},
booktitle = {Towards the Internet of Services: The {THESEUS} Research Program},
series = {Cognitive Technologies},
pages = {37--50},
publisher = {Springer},
year = {2014},
url = {https://doi.org/10.1007/978-3-319-06755-1\_4},
doi = {10.1007/978-3-319-06755-1\_4},
timestamp = {Mon, 22 Jan 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/series/cogtech/StuderBS0Z14.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/RiemerSS13,
author = {Dominik Riemer and
Nenad Stojanovic and
Ljiljana Stojanovic},
editor = {Camille Salinesi and
Moira C. Norrie and
Oscar Pastor},
title = {A Methodology for Designing Events and Patterns in Fast Data Processing},
booktitle = {Advanced Information Systems Engineering - 25th International Conference,
CAiSE 2013, Valencia, Spain, June 17-21, 2013. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7908},
pages = {133--148},
publisher = {Springer},
year = {2013},
url = {https://doi.org/10.1007/978-3-642-38709-8\_9},
doi = {10.1007/978-3-642-38709-8\_9},
timestamp = {Mon, 18 Jan 2021 08:56:37 +0100},
biburl = {https://dblp.org/rec/conf/caise/RiemerSS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/StojanovicSS13,
author = {Nenad Stojanovic and
Ljiljana Stojanovic and
Roland Stuehmer},
editor = {Sharma Chakravarthy and
Susan Darling Urban and
Peter R. Pietzuch and
Elke A. Rundensteiner},
title = {Tutorial: personal big data management in the cyber-physical systems
- the role of event processing},
booktitle = {The 7th {ACM} International Conference on Distributed Event-Based
Systems, {DEBS} '13, Arlington, TX, {USA} - June 29 - July 03, 2013},
pages = {281--288},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2488222.2488348},
doi = {10.1145/2488222.2488348},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/StojanovicSS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/RiemerSS13,
author = {Dominik Riemer and
Ljiljana Stojanovic and
Nenad Stojanovic},
editor = {Sharma Chakravarthy and
Susan Darling Urban and
Peter R. Pietzuch and
Elke A. Rundensteiner},
title = {Demo: {ALERT} - real-time coordination in open source software development},
booktitle = {The 7th {ACM} International Conference on Distributed Event-Based
Systems, {DEBS} '13, Arlington, TX, {USA} - June 29 - July 03, 2013},
pages = {339--340},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2488222.2489278},
doi = {10.1145/2488222.2489278},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/RiemerSS13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/StojanovicRX13,
author = {Nenad Stojanovic and
Dominik Riemer and
Yongchun Xu},
editor = {Sharma Chakravarthy and
Susan Darling Urban and
Peter R. Pietzuch and
Elke A. Rundensteiner},
title = {Demo: a system for dynamic real-time personal fitness monitoring},
booktitle = {The 7th {ACM} International Conference on Distributed Event-Based
Systems, {DEBS} '13, Arlington, TX, {USA} - June 29 - July 03, 2013},
pages = {341--342},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2488222.2489279},
doi = {10.1145/2488222.2489279},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/StojanovicRX13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/momm/XuSSK13,
author = {Yongchun Xu and
Nenad Stojanovic and
Ljiljana Stojanovic and
Dusan Kostic},
editor = {Ren{\'{e}} Mayrhofer and
Luke Chen and
Matthias Steinbauer and
Gabriele Kotsis and
Ismail Khalil},
title = {An Approach for Dynamic Personal Monitoring based on Mobile Complex
Event Processing},
booktitle = {The 11th International Conference on Advances in Mobile Computing
{\&} Multimedia, MoMM '13, Vienna, Austria, December 2-4, 2013},
pages = {464},
publisher = {{ACM}},
year = {2013},
url = {https://doi.org/10.1145/2536853.2536866},
doi = {10.1145/2536853.2536866},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/momm/XuSSK13.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aai/AnicicRFS12,
author = {Darko Anicic and
Sebastian Rudolph and
Paul Fodor and
Nenad Stojanovic},
title = {Real-Time Complex Event Recognition and Reasoning-a Logic Programming
Approach},
journal = {Appl. Artif. Intell.},
volume = {26},
number = {1-2},
pages = {6--57},
year = {2012},
url = {https://doi.org/10.1080/08839514.2012.636616},
doi = {10.1080/08839514.2012.636616},
timestamp = {Tue, 25 Aug 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aai/AnicicRFS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/semweb/AnicicRFS12,
author = {Darko Anicic and
Sebastian Rudolph and
Paul Fodor and
Nenad Stojanovic},
title = {Stream reasoning and complex event processing in {ETALIS}},
journal = {Semantic Web},
volume = {3},
number = {4},
pages = {397--407},
year = {2012},
url = {https://doi.org/10.3233/SW-2011-0053},
doi = {10.3233/SW-2011-0053},
timestamp = {Mon, 28 Aug 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/semweb/AnicicRFS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bpm/MagoutasRAMMS12,
author = {Babis Magoutas and
Dominik Riemer and
Dimitris Apostolou and
Jun Ma and
Gregoris Mentzas and
Nenad Stojanovic},
editor = {Marcello La Rosa and
Pnina Soffer},
title = {An Event-Driven System for Business Awareness Management in the Logistics
Domain},
booktitle = {Business Process Management Workshops - {BPM} 2012 International Workshops,
Tallinn, Estonia, September 3, 2012. Revised Papers},
series = {Lecture Notes in Business Information Processing},
volume = {132},
pages = {402--413},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-36285-9\_43},
doi = {10.1007/978-3-642-36285-9\_43},
timestamp = {Sun, 21 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bpm/MagoutasRAMMS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/XuSSCS12,
author = {Yongchun Xu and
Nenad Stojanovic and
Ljiljana Stojanovic and
Ana Cabrera and
Tobias Schuchert},
editor = {Fran{\c{c}}ois Bry and
Adrian Paschke and
Patrick Th. Eugster and
Christof Fetzer and
Andreas Behrend},
title = {An approach for using complex event processing for adaptive augmented
reality in cultural heritage domain: experience report},
booktitle = {Proceedings of the Sixth {ACM} International Conference on Distributed
Event-Based Systems, {DEBS} 2012, Berlin, Germany, July 16-20, 2012},
pages = {139--148},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2335484.2335500},
doi = {10.1145/2335484.2335500},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/XuSSCS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/StojanovicSBG12,
author = {Nenad Stojanovic and
Roland St{\"{u}}hmer and
Fran{\c{c}}oise Baude and
Philippe Gibert},
editor = {Fran{\c{c}}ois Bry and
Adrian Paschke and
Patrick Th. Eugster and
Christof Fetzer and
Andreas Behrend},
title = {Where event processing grand challenge meets real-time web: {PLAY}
event marketplace},
booktitle = {Proceedings of the Sixth {ACM} International Conference on Distributed
Event-Based Systems, {DEBS} 2012, Berlin, Germany, July 16-20, 2012},
pages = {341--352},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2335484.2335521},
doi = {10.1145/2335484.2335521},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/StojanovicSBG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/XuSSS12,
author = {Yongchun Xu and
Nenad Stojanovic and
Ljiljana Stojanovic and
Tobias Schuchert},
editor = {Fran{\c{c}}ois Bry and
Adrian Paschke and
Patrick Th. Eugster and
Christof Fetzer and
Andreas Behrend},
title = {Efficient human attention detection based on intelligent complex event
processing},
booktitle = {Proceedings of the Sixth {ACM} International Conference on Distributed
Event-Based Systems, {DEBS} 2012, Berlin, Germany, July 16-20, 2012},
pages = {379--380},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2335484.2335531},
doi = {10.1145/2335484.2335531},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/XuSSS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/StuhmerSOG12,
author = {Roland St{\"{u}}hmer and
Nenad Stojanovic and
Stefan Obermeier and
Philippe Gibert},
editor = {Fran{\c{c}}ois Bry and
Adrian Paschke and
Patrick Th. Eugster and
Christof Fetzer and
Andreas Behrend},
title = {Where events meet events: {PLAY} event marketplace},
booktitle = {Proceedings of the Sixth {ACM} International Conference on Distributed
Event-Based Systems, {DEBS} 2012, Berlin, Germany, July 16-20, 2012},
pages = {383--384},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2335484.2335533},
doi = {10.1145/2335484.2335533},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/StuhmerSOG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/JerzakHFGHS12,
author = {Zbigniew Jerzak and
Thomas Heinze and
Matthias Fehr and
Daniel Gr{\"{o}}ber and
Raik Hartung and
Nenad Stojanovic},
editor = {Fran{\c{c}}ois Bry and
Adrian Paschke and
Patrick Th. Eugster and
Christof Fetzer and
Andreas Behrend},
title = {The {DEBS} 2012 grand challenge},
booktitle = {Proceedings of the Sixth {ACM} International Conference on Distributed
Event-Based Systems, {DEBS} 2012, Berlin, Germany, July 16-20, 2012},
pages = {393--398},
publisher = {{ACM}},
year = {2012},
url = {https://doi.org/10.1145/2335484.2335536},
doi = {10.1145/2335484.2335536},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/JerzakHFGHS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esws/PellegrinoABSS12,
author = {Laurent Pellegrino and
Iyad Alshabani and
Fran{\c{c}}oise Baude and
Roland St{\"{u}}hmer and
Nenad Stojanovic},
editor = {Elena Simperl and
Barry Norton and
Dunja Mladenic and
Emanuele Della Valle and
Irini Fundulaki and
Alexandre Passant and
Rapha{\"{e}}l Troncy},
title = {An Approach for Efficiently Combining Real-Time and Past Events for
Ubiquitous Business Processing},
booktitle = {The Semantic Web: {ESWC} 2012 Satellite Events - {ESWC} 2012 Satellite
Events, Heraklion, Crete, Greece, May 27-31, 2012. Revised Selected
Papers},
series = {Lecture Notes in Computer Science},
volume = {7540},
pages = {301--312},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-662-46641-4\_23},
doi = {10.1007/978-3-662-46641-4\_23},
timestamp = {Tue, 14 May 2019 10:00:44 +0200},
biburl = {https://dblp.org/rec/conf/esws/PellegrinoABSS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esws/XuSSS12,
author = {Yongchun Xu and
Ljiljana Stojanovic and
Nenad Stojanovic and
Tobias Schuchert},
editor = {Elena Simperl and
Barry Norton and
Dunja Mladenic and
Emanuele Della Valle and
Irini Fundulaki and
Alexandre Passant and
Rapha{\"{e}}l Troncy},
title = {A Demo for Efficient Human Attention Detection Based on Semantics
and Complex Event Processing},
booktitle = {The Semantic Web: {ESWC} 2012 Satellite Events - {ESWC} 2012 Satellite
Events, Heraklion, Crete, Greece, May 27-31, 2012. Revised Selected
Papers},
series = {Lecture Notes in Computer Science},
volume = {7540},
pages = {413--418},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-662-46641-4\_37},
doi = {10.1007/978-3-662-46641-4\_37},
timestamp = {Wed, 24 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/esws/XuSSS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/euromed/DamalaSSMCG12,
author = {Areti Damala and
Nenad Stojanovic and
Tobias Schuchert and
Jorge Moragues and
Ana Cabrera and
Kiel Gilleade},
editor = {Marinos Ioannides and
Dieter Fritsch and
Johanna Leissner and
Rob Davies and
Fabio Remondino and
Rossella Caffo},
title = {Adaptive Augmented Reality for Cultural Heritage: ARtSENSE Project},
booktitle = {Progress in Cultural Heritage Preservation - 4th International Conference,
EuroMed 2012, Limassol, Cyprus, October 29 - November 3, 2012. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {7616},
pages = {746--755},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-34234-9\_79},
doi = {10.1007/978-3-642-34234-9\_79},
timestamp = {Tue, 14 May 2019 10:00:53 +0200},
biburl = {https://dblp.org/rec/conf/euromed/DamalaSSMCG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ismar/StojanovicDSSFM12,
author = {Nenad Stojanovic and
Areti Damala and
Tobias Schuchert and
Ljiljana Stojanovic and
Stephen H. Fairclough and
John Moores},
title = {Tutorial 1: Adaptive augmented reality {(A2R):} Where {AR} meets user's
interest},
booktitle = {11th {IEEE} International Symposium on Mixed and Augmented Reality,
{ISMAR} 2012, Atlanta, GA, USA, November 5-8, 2012},
publisher = {{IEEE} Computer Society},
year = {2012},
url = {https://doi.org/10.1109/ISMAR.2012.6402522},
doi = {10.1109/ISMAR.2012.6402522},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ismar/StojanovicDSSFM12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semweb/XuSSS12,
author = {Yongchun Xu and
Nenad Stojanovic and
Ljiljana Stojanovic and
Tobias Schuchert},
editor = {Birte Glimm and
David Huynh},
title = {Demo: Efficient Human Attention Detection in Museums based on Semantics
and Complex Event Processing},
booktitle = {Proceedings of the {ISWC} 2012 Posters {\&} Demonstrations Track,
Boston, USA, November 11-15, 2012},
series = {{CEUR} Workshop Proceedings},
volume = {914},
publisher = {CEUR-WS.org},
year = {2012},
url = {https://ceur-ws.org/Vol-914/paper\_18.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:05 +0100},
biburl = {https://dblp.org/rec/conf/semweb/XuSSS12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/daglib/p/TrampusSSG12,
author = {Mitja Trampus and
Sinan Sen and
Nenad Stojanovic and
Marko Grobelnik},
editor = {Yannis Charalabidis and
Sotirios Koussouris},
title = {Visualisation of Online Discussion Forums},
booktitle = {Empowering Open and Collaborative Governance - Technologies and Methods
for Online Citizen Engagement in Public Policy Making},
pages = {157--179},
publisher = {Springer},
year = {2012},
url = {https://doi.org/10.1007/978-3-642-27219-6\_9},
doi = {10.1007/978-3-642-27219-6\_9},
timestamp = {Thu, 14 Oct 2021 08:45:49 +0200},
biburl = {https://dblp.org/rec/books/daglib/p/TrampusSSG12.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/birthday/StojanovicSAMSS11,
author = {Nenad Stojanovic and
Ljiljana Stojanovic and
Darko Anicic and
Jun Ma and
Sinan Sen and
Roland St{\"{u}}hmer},
editor = {Dieter Fensel},
title = {Semantic Complex Event Reasoning - Beyond Complex Event Processing},
booktitle = {Foundations for the Web of Information and Services - {A} Review of
20 Years of Semantic Web Research},
pages = {253--279},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-19797-0\_14},
doi = {10.1007/978-3-642-19797-0\_14},
timestamp = {Wed, 14 Nov 2018 10:58:57 +0100},
biburl = {https://dblp.org/rec/conf/birthday/StojanovicSAMSS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/StojanovicMXSAS11,
author = {Nenad Stojanovic and
Dejan Milenovic and
Yongchun Xu and
Ljiljana Stojanovic and
Darko Anicic and
Rudi Studer},
editor = {David M. Eyers and
Opher Etzion and
Avigdor Gal and
Stanley B. Zdonik and
Paul Vincent},
title = {An intelligent event-driven approach for efficient energy consumption
in commercial buildings: smart office use case},
booktitle = {Proceedings of the Fifth {ACM} International Conference on Distributed
Event-Based Systems, {DEBS} 2011, New York, NY, USA, July 11-15, 2011},
pages = {303--312},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2002259.2002299},
doi = {10.1145/2002259.2002299},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/StojanovicMXSAS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/BizarroCS11,
author = {Pedro Bizarro and
K. Mani Chandy and
Nenad Stojanovic},
editor = {David M. Eyers and
Opher Etzion and
Avigdor Gal and
Stanley B. Zdonik and
Paul Vincent},
title = {Event processing grand challenges},
booktitle = {Proceedings of the Fifth {ACM} International Conference on Distributed
Event-Based Systems, {DEBS} 2011, New York, NY, USA, July 11-15, 2011},
pages = {361--362},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2002259.2002308},
doi = {10.1145/2002259.2002308},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/BizarroCS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/Stojanovic11,
author = {Nenad Stojanovic},
editor = {David M. Eyers and
Opher Etzion and
Avigdor Gal and
Stanley B. Zdonik and
Paul Vincent},
title = {{DEBS} challenge},
booktitle = {Proceedings of the Fifth {ACM} International Conference on Distributed
Event-Based Systems, {DEBS} 2011, New York, NY, USA, July 11-15, 2011},
pages = {369--370},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2002259.2002313},
doi = {10.1145/2002259.2002313},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/Stojanovic11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/StuhmerS11,
author = {Roland St{\"{u}}hmer and
Nenad Stojanovic},
editor = {David M. Eyers and
Opher Etzion and
Avigdor Gal and
Stanley B. Zdonik and
Paul Vincent},
title = {Large-scale, situation-driven and quality-aware event marketplace:
the concept, challenges and opportunities},
booktitle = {Proceedings of the Fifth {ACM} International Conference on Distributed
Event-Based Systems, {DEBS} 2011, New York, NY, USA, July 11-15, 2011},
pages = {403--404},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/2002259.2002332},
doi = {10.1145/2002259.2002332},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/StuhmerS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esws/XuSSAS11,
author = {Yongchun Xu and
Nenad Stojanovic and
Ljiljana Stojanovic and
Darko Anicic and
Rudi Studer},
editor = {Grigoris Antoniou and
Marko Grobelnik and
Elena Simperl and
Bijan Parsia and
Dimitris Plexousakis and
Pieter De Leenheer and
Jeff Z. Pan},
title = {An Approach for More Efficient Energy Consumption Based on Real-Time
Situational Awareness},
booktitle = {The Semanic Web: Research and Applications - 8th Extended Semantic
Web Conference, {ESWC} 2011, Heraklion, Crete, Greece, May 29 - June
2, 2011, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {6644},
pages = {270--284},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-21064-8\_19},
doi = {10.1007/978-3-642-21064-8\_19},
timestamp = {Mon, 28 Aug 2023 21:17:38 +0200},
biburl = {https://dblp.org/rec/conf/esws/XuSSAS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fia/GluhakHKSBNHPRC11,
author = {Alexander Gluhak and
Manfred Hauswirth and
Srdjan Krco and
Nenad Stojanovic and
Martin Bauer and
Rasmus H. Nielsen and
Stephan Haller and
Neeli R. Prasad and
Vinny Reynolds and
{\'{O}}scar Corcho},
editor = {John Domingue and
Alex Galis and
Anastasius Gavras and
Theodore B. Zahariadis and
Dave Lambert and
Frances Cleary and
Petros Daras and
Srdjan Krco and
Henning M{\"{u}}ller and
Man{-}Sze Li and
Hans Schaffers and
Volkmar Lotz and
Federico Alvarez and
Burkhard Stiller and
Stamatis Karnouskos and
Susanna Avessta and
Michael Nilsson},
title = {An Architectural Blueprint for a Real-World Internet},
booktitle = {The Future Internet - Future Internet Assembly 2011: Achievements
and Technological Promises},
series = {Lecture Notes in Computer Science},
volume = {6656},
pages = {67--80},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-20898-0\_5},
doi = {10.1007/978-3-642-20898-0\_5},
timestamp = {Mon, 15 Jun 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/fia/GluhakHKSBNHPRC11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ruleml/StojanovicA11,
author = {Nenad Stojanovic and
Alexander Artikis},
editor = {Nick Bassiliades and
Guido Governatori and
Adrian Paschke},
title = {On Complex Event Processing for Real-Time Situational Awareness},
booktitle = {Rule-Based Reasoning, Programming, and Applications - 5th International
Symposium, RuleML 2011 - Europe, Barcelona, Spain, July 19-21, 2011.
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6826},
pages = {114--121},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-22546-8\_10},
doi = {10.1007/978-3-642-22546-8\_10},
timestamp = {Tue, 14 May 2019 10:00:39 +0200},
biburl = {https://dblp.org/rec/conf/ruleml/StojanovicA11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ruleml/AnicicRFS11,
author = {Darko Anicic and
Sebastian Rudolph and
Paul Fodor and
Nenad Stojanovic},
editor = {Nick Bassiliades and
Guido Governatori and
Adrian Paschke},
title = {Retractable Complex Event Processing and Stream Reasoning},
booktitle = {Rule-Based Reasoning, Programming, and Applications - 5th International
Symposium, RuleML 2011 - Europe, Barcelona, Spain, July 19-21, 2011.
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6826},
pages = {122--137},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-22546-8\_11},
doi = {10.1007/978-3-642-22546-8\_11},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ruleml/AnicicRFS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ruleml/AnicicRFS11a,
author = {Darko Anicic and
Sebastian Rudolph and
Paul Fodor and
Nenad Stojanovic},
editor = {Nick Bassiliades and
Guido Governatori and
Adrian Paschke},
title = {A Declarative Framework for Matching Iterative and Aggregative Patterns
against Event Streams},
booktitle = {Rule-Based Reasoning, Programming, and Applications - 5th International
Symposium, RuleML 2011 - Europe, Barcelona, Spain, July 19-21, 2011.
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6826},
pages = {138--153},
publisher = {Springer},
year = {2011},
url = {https://doi.org/10.1007/978-3-642-22546-8\_12},
doi = {10.1007/978-3-642-22546-8\_12},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/ruleml/AnicicRFS11a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/AnicicFRS11,
author = {Darko Anicic and
Paul Fodor and
Sebastian Rudolph and
Nenad Stojanovic},
editor = {Sadagopan Srinivasan and
Krithi Ramamritham and
Arun Kumar and
M. P. Ravindra and
Elisa Bertino and
Ravi Kumar},
title = {{EP-SPARQL:} a unified language for event processing and stream reasoning},
booktitle = {Proceedings of the 20th International Conference on World Wide Web,
{WWW} 2011, Hyderabad, India, March 28 - April 1, 2011},
pages = {635--644},
publisher = {{ACM}},
year = {2011},
url = {https://doi.org/10.1145/1963405.1963495},
doi = {10.1145/1963405.1963495},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/www/AnicicFRS11.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/amcc/StojanovicBMH10,
author = {Nenad Stojanovic and
Jordan M. Berg and
D. H. S. Maithripala and
Mark Holtz},
title = {Least-squares parameter estimation algorithm for a microelectrothermal
bridge circuit},
booktitle = {American Control Conference, {ACC} 2010, Baltimore, Maryland, USA,
June 30 - July 2, 2010},
pages = {3423--3428},
publisher = {{IEEE}},
year = {2010},
url = {https://doi.org/10.1109/ACC.2010.5531106},
doi = {10.1109/ACC.2010.5531106},
timestamp = {Thu, 23 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/amcc/StojanovicBMH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/SenS10,
author = {Sinan Sen and
Nenad Stojanovic},
editor = {Barbara Pernici},
title = {GRUVe: {A} Methodology for Complex Event Pattern Life Cycle Management},
booktitle = {Advanced Information Systems Engineering, 22nd International Conference,
CAiSE 2010, Hammamet, Tunisia, June 7-9, 2010. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6051},
pages = {209--223},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-13094-6\_17},
doi = {10.1007/978-3-642-13094-6\_17},
timestamp = {Tue, 14 May 2019 10:00:36 +0200},
biburl = {https://dblp.org/rec/conf/caise/SenS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/SenSS10,
author = {Sinan Sen and
Nenad Stojanovic and
Bijan Fahimi Shemrani},
editor = {Jean Bacon and
Peter R. Pietzuch and
Joe Sventek and
Ugur {\c{C}}etintemel},
title = {EchoPAT: a system for real-time complex event pattern monitoring},
booktitle = {Proceedings of the Fourth {ACM} International Conference on Distributed
Event-Based Systems, {DEBS} 2010, Cambridge, United Kingdom, July
12-15, 2010},
pages = {107--108},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1827418.1827442},
doi = {10.1145/1827418.1827442},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/SenSS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/SenSS10a,
author = {Sinan Sen and
Nenad Stojanovic and
Ljiljana Stojanovic},
editor = {Jean Bacon and
Peter R. Pietzuch and
Joe Sventek and
Ugur {\c{C}}etintemel},
title = {An approach for iterative event pattern recommendation},
booktitle = {Proceedings of the Fourth {ACM} International Conference on Distributed
Event-Based Systems, {DEBS} 2010, Cambridge, United Kingdom, July
12-15, 2010},
pages = {196--205},
publisher = {{ACM}},
year = {2010},
url = {https://doi.org/10.1145/1827418.1827459},
doi = {10.1145/1827418.1827459},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/SenSS10a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esws/AnicicSS10,
author = {Darko Anicic and
Nenad Stojanovic and
Ljiljana Stojanovic},
editor = {Nenad Stojanovic and
Barry Norton},
title = {Logic-based ad-hoc Business Process Management: Concepts and Challenges},
booktitle = {Proceedings of the 5th International Workshop on Semantic Business
Process Management {SBPM} 2010, held in conjunction with the European
Semantic Web Conference {(ESWC} 2010), Heraklion, Greece, May 31,
2010},
series = {{CEUR} Workshop Proceedings},
volume = {682},
pages = {48--49},
publisher = {CEUR-WS.org},
year = {2010},
url = {https://ceur-ws.org/Vol-682/paper8.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:14 +0100},
biburl = {https://dblp.org/rec/conf/esws/AnicicSS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fia/WagnerASSHS10,
author = {Andreas Wagner and
Darko Anicic and
Roland St{\"{u}}hmer and
Nenad Stojanovic and
Andreas Harth and
Rudi Studer},
editor = {S{\"{o}}ren Auer and
Stefan Decker and
Manfred Hauswirth},
title = {Linked Data and Complex Event Processing for the Smart Energy Grid},
booktitle = {Proceedings of the Workshop on Linked Data in the Future Internet
at the Future Internet Assembly, Ghent, Belgium, December 16-17, 2010},
series = {{CEUR} Workshop Proceedings},
volume = {700},
publisher = {CEUR-WS.org},
year = {2010},
url = {https://ceur-ws.org/Vol-700/Paper10.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:22 +0100},
biburl = {https://dblp.org/rec/conf/fia/WagnerASSHS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rr/AnicicFRSSS10,
author = {Darko Anicic and
Paul Fodor and
Sebastian Rudolph and
Roland St{\"{u}}hmer and
Nenad Stojanovic and
Rudi Studer},
editor = {Pascal Hitzler and
Thomas Lukasiewicz},
title = {A Rule-Based Language for Complex Event Processing and Reasoning},
booktitle = {Web Reasoning and Rule Systems - Fourth International Conference,
{RR} 2010, Bressanone/Brixen, Italy, September 22-24, 2010. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {6333},
pages = {42--57},
publisher = {Springer},
year = {2010},
url = {https://doi.org/10.1007/978-3-642-15918-3\_5},
doi = {10.1007/978-3-642-15918-3\_5},
timestamp = {Sat, 19 Oct 2019 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/rr/AnicicFRSSS10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semweb/XuWSH10,
author = {Yongchun Xu and
Peter Wolf and
Nenad Stojanovic and
Hans{-}J{\"{o}}rg Happel},
editor = {Axel Polleres and
Huajun Chen},
title = {Semantic-based Complex Event Processing in the {AAL} Domain},
booktitle = {Proceedings of the {ISWC} 2010 Posters {\&} Demonstrations Track:
Collected Abstracts, Shanghai, China, November 9, 2010},
series = {{CEUR} Workshop Proceedings},
volume = {658},
publisher = {CEUR-WS.org},
year = {2010},
url = {https://ceur-ws.org/Vol-658/paper463.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:09 +0100},
biburl = {https://dblp.org/rec/conf/semweb/XuWSH10.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/esws/2010sbpm,
editor = {Nenad Stojanovic and
Barry Norton},
title = {Proceedings of the 5th International Workshop on Semantic Business
Process Management {SBPM} 2010, held in conjunction with the European
Semantic Web Conference {(ESWC} 2010), Heraklion, Greece, May 31,
2010},
series = {{CEUR} Workshop Proceedings},
volume = {682},
publisher = {CEUR-WS.org},
year = {2010},
url = {https://ceur-ws.org/Vol-682},
urn = {urn:nbn:de:0074-682-4},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/esws/2010sbpm.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aim/BaoBCDGKLMNNORSSSTTW09,
author = {Jie Bao and
Uldis Bojars and
Tanzeem Choudhury and
Li Ding and
Mark Greaves and
Ashish Kapoor and
Sandy Louchart and
Manish Mehta and
Bernhard Nebel and
Sergei Nirenburg and
Tim Oates and
David L. Roberts and
Antonio Sanfilippo and
Nenad Stojanovic and
Kristen Stubbs and
Andrea Lockerd Thomaz and
Katherine M. Tsui and
Stefan W{\"{o}}lfl},
title = {Reports of the {AAAI} 2009 Spring Symposia},
journal = {{AI} Mag.},
volume = {30},
number = {3},
pages = {89--95},
year = {2009},
url = {https://doi.org/10.1609/aimag.v30i3.2253},
doi = {10.1609/AIMAG.V30I3.2253},
timestamp = {Sun, 16 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/aim/BaoBCDGKLMNNORSSSTTW09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/expert/ApostolouSA09,
author = {Dimitris Apostolou and
Nenad Stojanovic and
Darko Anicic},
title = {Responsive Knowledge Management for Public Administration: An Event-Driven
Approach},
journal = {{IEEE} Intell. Syst.},
volume = {24},
number = {5},
pages = {20--30},
year = {2009},
url = {https://doi.org/10.1109/MIS.2009.101},
doi = {10.1109/MIS.2009.101},
timestamp = {Fri, 06 Mar 2020 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/expert/ApostolouSA09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaiss/AnicicS09,
author = {Darko Anicic and
Nenad Stojanovic},
title = {Expressive Logical Framework for Reasoning about Complex Events and
Situations},
booktitle = {Intelligent Event Processing, Papers from the 2009 {AAAI} Spring Symposium,
Technical Report SS-09-05, Stanford, California, USA, March 23-25,
2009},
pages = {14--20},
publisher = {{AAAI}},
year = {2009},
url = {http://www.aaai.org/Library/Symposia/Spring/2009/ss09-05-003.php},
timestamp = {Fri, 17 Feb 2012 13:46:59 +0100},
biburl = {https://dblp.org/rec/conf/aaaiss/AnicicS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaiss/KharbiliS09,
author = {Marwane El Kharbili and
Nenad Stojanovic},
title = {Semantic Event-Based Decision Management in Compliance Management
for Business Processes},
booktitle = {Intelligent Event Processing, Papers from the 2009 {AAAI} Spring Symposium,
Technical Report SS-09-05, Stanford, California, USA, March 23-25,
2009},
pages = {35--40},
publisher = {{AAAI}},
year = {2009},
url = {http://www.aaai.org/Library/Symposia/Spring/2009/ss09-05-006.php},
timestamp = {Fri, 17 Feb 2012 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aaaiss/KharbiliS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaiss/StojanovicAEP09,
author = {Nenad Stojanovic and
Andreas Abecker and
Opher Etzion and
Adrian Paschke},
title = {Organizing Committee},
booktitle = {Intelligent Event Processing, Papers from the 2009 {AAAI} Spring Symposium,
Technical Report SS-09-05, Stanford, California, USA, March 23-25,
2009},
publisher = {{AAAI}},
year = {2009},
url = {http://www.aaai.org/Library/Symposia/Spring/2009/ss09-05-000.php},
timestamp = {Fri, 17 Feb 2012 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aaaiss/StojanovicAEP09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bpm/AmmonELPS09,
author = {Rainer von Ammon and
Opher Etzion and
Heiko Ludwig and
Adrian Paschke and
Nenad Stojanovic},
editor = {Stefanie Rinderle{-}Ma and
Shazia Wasim Sadiq and
Frank Leymann},
title = {Introduction to the Second International Workshop on Event-Driven
Business Process Management (edBPM09)},
booktitle = {Business Process Management Workshops, {BPM} 2009 International Workshops,
Ulm, Germany, September 7, 2009. Revised Papers},
series = {Lecture Notes in Business Information Processing},
volume = {43},
pages = {345--346},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-12186-9\_32},
doi = {10.1007/978-3-642-12186-9\_32},
timestamp = {Sun, 21 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/bpm/AmmonELPS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cse/AnicicFSS09,
author = {Darko Anicic and
Paul Fodor and
Roland St{\"{u}}hmer and
Nenad Stojanovic},
title = {Event-Driven Approach for Logic-Based Complex Event Processing},
booktitle = {Proceedings of the 12th {IEEE} International Conference on Computational
Science and Engineering, {CSE} 2009, Vancouver, BC, Canada, August
29-31, 2009},
pages = {56--63},
publisher = {{IEEE} Computer Society},
year = {2009},
url = {https://doi.org/10.1109/CSE.2009.402},
doi = {10.1109/CSE.2009.402},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/cse/AnicicFSS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/AnicicFSS09,
author = {Darko Anicic and
Paul Fodor and
Nenad Stojanovic and
Roland St{\"{u}}hmer},
editor = {Aniruddha S. Gokhale and
Douglas C. Schmidt},
title = {An approach for data-driven and logic-based complex Event Processing},
booktitle = {Proceedings of the Third {ACM} International Conference on Distributed
Event-Based Systems, {DEBS} 2009, Nashville, Tennessee, USA, July
6-9, 2009},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1619258.1619293},
doi = {10.1145/1619258.1619293},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/AnicicFSS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/AnicicFSS09a,
author = {Darko Anicic and
Paul Fodor and
Nenad Stojanovic and
Roland St{\"{u}}hmer},
editor = {Aniruddha S. Gokhale and
Douglas C. Schmidt},
title = {Computing complex events in an event-driven and logic-based approach},
booktitle = {Proceedings of the Third {ACM} International Conference on Distributed
Event-Based Systems, {DEBS} 2009, Nashville, Tennessee, USA, July
6-9, 2009},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1619258.1619304},
doi = {10.1145/1619258.1619304},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/AnicicFSS09a.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/SenSL09,
author = {Sinan Sen and
Nenad Stojanovic and
Ruofeng Lin},
editor = {Aniruddha S. Gokhale and
Douglas C. Schmidt},
title = {A graphical editor for complex event pattern generation},
booktitle = {Proceedings of the Third {ACM} International Conference on Distributed
Event-Based Systems, {DEBS} 2009, Nashville, Tennessee, USA, July
6-9, 2009},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1619258.1619309},
doi = {10.1145/1619258.1619309},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/SenSL09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/debs/StuhmerASS09,
author = {Roland St{\"{u}}hmer and
Darko Anicic and
Nenad Stojanovic and
Sinan Sen},
editor = {Aniruddha S. Gokhale and
Douglas C. Schmidt},
title = {Client-side event processing for personalized web advertisement},
booktitle = {Proceedings of the Third {ACM} International Conference on Distributed
Event-Based Systems, {DEBS} 2009, Nashville, Tennessee, USA, July
6-9, 2009},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1619258.1619307},
doi = {10.1145/1619258.1619307},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/debs/StuhmerASS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esws/StojanovicMS09,
author = {Ljiljana Stojanovic and
Jun Ma and
Nenad Stojanovic},
editor = {Martin Hepp and
Knut Hinkelmann and
Nenad Stojanovic},
title = {Semantic-based enterprise attention management systems},
booktitle = {Proceedings of the 4th International Workshop on Semantic Business
Process Management, {SBPM} '09, Heraklion, Greece, June 1, 2009},
pages = {17--24},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1944968.1944972},
doi = {10.1145/1944968.1944972},
timestamp = {Tue, 18 Jan 2022 16:41:46 +0100},
biburl = {https://dblp.org/rec/conf/esws/StojanovicMS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esws/MarkovicJECS09,
author = {Ivan Markovic and
Sukesh Jain and
Mahmoud El{-}Gayyar and
Armin B. Cremers and
Nenad Stojanovic},
editor = {Lora Aroyo and
Paolo Traverso and
Fabio Ciravegna and
Philipp Cimiano and
Tom Heath and
Eero Hyv{\"{o}}nen and
Riichiro Mizoguchi and
Eyal Oren and
Marta Sabou and
Elena Simperl},
title = {Modeling and Enforcement of Business Policies on Process Models with
Maestro},
booktitle = {The Semantic Web: Research and Applications, 6th European Semantic
Web Conference, {ESWC} 2009, Heraklion, Crete, Greece, May 31-June
4, 2009, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5554},
pages = {873--877},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-02121-3\_73},
doi = {10.1007/978-3-642-02121-3\_73},
timestamp = {Fri, 23 Jun 2023 11:56:12 +0200},
biburl = {https://dblp.org/rec/conf/esws/MarkovicJECS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/otm/StuhmerASMSS09,
author = {Roland St{\"{u}}hmer and
Darko Anicic and
Sinan Sen and
Jun Ma and
Kay{-}Uwe Schmidt and
Nenad Stojanovic},
editor = {Robert Meersman and
Tharam S. Dillon and
Pilar Herrero},
title = {Client-Side Event Processing for Personalized Web Advertisement},
booktitle = {On the Move to Meaningful Internet Systems: {OTM} 2009, Confederated
International Conferences, CoopIS, DOA, IS, and {ODBASE} 2009, Vilamoura,
Portugal, November 1-6, 2009, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {5871},
pages = {1069--1086},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-05151-7\_23},
doi = {10.1007/978-3-642-05151-7\_23},
timestamp = {Thu, 14 Oct 2021 10:28:26 +0200},
biburl = {https://dblp.org/rec/conf/otm/StuhmerASMSS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semweb/StuhmerASMSS09,
author = {Roland St{\"{u}}hmer and
Darko Anicic and
Sinan Sen and
Jun Ma and
Kay{-}Uwe Schmidt and
Nenad Stojanovic},
editor = {Abraham Bernstein and
David R. Karger and
Tom Heath and
Lee Feigenbaum and
Diana Maynard and
Enrico Motta and
Krishnaprasad Thirunarayan},
title = {Lifting Events in {RDF} from Interactions with Annotated Web Pages},
booktitle = {The Semantic Web - {ISWC} 2009, 8th International Semantic Web Conference,
{ISWC} 2009, Chantilly, VA, USA, October 25-29, 2009. Proceedings},
series = {Lecture Notes in Computer Science},
volume = {5823},
pages = {893--908},
publisher = {Springer},
year = {2009},
url = {https://doi.org/10.1007/978-3-642-04930-9\_56},
doi = {10.1007/978-3-642-04930-9\_56},
timestamp = {Tue, 07 Sep 2021 13:47:49 +0200},
biburl = {https://dblp.org/rec/conf/semweb/StuhmerASMSS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wirtschaftsinformatik/MarkovicHJS09,
author = {Ivan Markovic and
Florian Hasibether and
Sukesh Jain and
Nenad Stojanovic},
editor = {Hans Robert Hansen and
Dimitris Karagiannis and
Hans{-}Georg Fill},
title = {Process-oriented Semantic Business Modeling},
booktitle = {Business Services: Konzepte, Technologien, Anwendungen. 9. Internationale
Tagung Wirtschaftsinformatik 25.-27. Februar 2009, Wien},
series = {books@ocg.at},
volume = {246},
pages = {683--694},
publisher = {{\"{O}}sterreichische Computer Gesellschaft},
year = {2009},
url = {http://aisel.aisnet.org/wi2009/63},
timestamp = {Mon, 27 Feb 2012 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wirtschaftsinformatik/MarkovicHJS09.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/esws/2009sbpm,
editor = {Martin Hepp and
Knut Hinkelmann and
Nenad Stojanovic},
title = {Proceedings of the 4th International Workshop on Semantic Business
Process Management, {SBPM} '09, Heraklion, Greece, June 1, 2009},
publisher = {{ACM}},
year = {2009},
url = {https://doi.org/10.1145/1944968},
doi = {10.1145/1944968},
isbn = {978-1-60558-513-0},
timestamp = {Tue, 18 Jan 2022 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/esws/2009sbpm.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fis/AnicicS08,
author = {Darko Anicic and
Nenad Stojanovic},
editor = {John Domingue and
Dieter Fensel and
Paolo Traverso},
title = {Future Internet Collaboration Workflow},
booktitle = {Future Internet - {FIS} 2008, First Future Internet Symposium, {FIS}
2008, Vienna, Austria, September 29-30, 2008, Revised Selected Papers},
series = {Lecture Notes in Computer Science},
volume = {5468},
pages = {141--151},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-642-00985-3\_12},
doi = {10.1007/978-3-642-00985-3\_12},
timestamp = {Sat, 19 Oct 2019 20:23:48 +0200},
biburl = {https://dblp.org/rec/conf/fis/AnicicS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iceis/AnicicS08,
author = {Darko Anicic and
Nenad Stojanovic},
editor = {Jos{\'{e}} Cordeiro and
Joaquim Filipe},
title = {Towards Creation of Logical Framework for Event-Driven Information
Systems},
booktitle = {{ICEIS} 2008 - Proceedings of the Tenth International Conference on
Enterprise Information Systems, Volume ISAS-2, Barcelona, Spain, June
12-16, 2008},
pages = {394--401},
year = {2008},
timestamp = {Mon, 15 Jun 2015 19:00:08 +0200},
biburl = {https://dblp.org/rec/conf/iceis/AnicicS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iesa/PopplewellSAAMH08,
author = {Keith Popplewell and
Nenad Stojanovic and
Andreas Abecker and
Dimitris Apostolou and
Gregoris Mentzas and
Jenny A. Harding},
editor = {Kai Mertins and
Rainer Ruggaber and
Keith Popplewell and
Xiaofei Xu},
title = {Supporting Adaptive Enterprise Collaboration through Semantic Knowledge
Services},
booktitle = {Enterprise Interoperability {III} - New Challenges and Industrial
Approaches, Proceedings of the 4th International Conference on Interoperability
for Enterprise Software and Applications, {IESA} 2008, March 26-28,
2008, Berlin, Germany},
pages = {381--393},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-1-84800-221-0\_30},
doi = {10.1007/978-1-84800-221-0\_30},
timestamp = {Sun, 21 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/iesa/PopplewellSAAMH08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mkwi/MarkovicPS08,
author = {Ivan Markovic and
Alessandro Costa Pereira and
Nenad Stojanovic},
editor = {Martin Bichler and
Thomas Hess and
Helmut Krcmar and
Ulrike Lechner and
Florian Matthes and
Arnold Picot and
Benjamin Speitkamp and
Petra Wolf},
title = {A Framework for Querying in Business Process Modelling},
booktitle = {Multikonferenz Wirtschaftsinformatik, {MKWI} 2008, M{\"{u}}nchen,
26.2.2008 - 28.2.2008, Proceedings},
publisher = {GITO-Verlag, Berlin},
year = {2008},
url = {http://ibis.in.tum.de/mkwi08/23\_Semantic\_Web\_Technology\_in\_Business\_Information\_Systems/03\_Markovic.pdf},
timestamp = {Fri, 16 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mkwi/MarkovicPS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mkwi/NamiriS08,
author = {Kioumars Namiri and
Nenad Stojanovic},
editor = {Martin Bichler and
Thomas Hess and
Helmut Krcmar and
Ulrike Lechner and
Florian Matthes and
Arnold Picot and
Benjamin Speitkamp and
Petra Wolf},
title = {Towards {A} Formal Framework for Business Process Compliance},
booktitle = {Multikonferenz Wirtschaftsinformatik, {MKWI} 2008, M{\"{u}}nchen,
26.2.2008 - 28.2.2008, Proceedings},
publisher = {GITO-Verlag, Berlin},
year = {2008},
url = {http://ibis.in.tum.de/mkwi08/17\_IT-Risikomanagement\_-\_IT-Projekte\_und\_IT-Compliance/09\_Namiri.pdf},
timestamp = {Fri, 16 Feb 2024 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/mkwi/NamiriS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/StojanovicSM08,
author = {Nenad Stojanovic and
Ljiljana Stojanovic and
Jun Ma},
editor = {Roger L. Wainwright and
Hisham Haddad},
title = {On the conceptual tag refinement},
booktitle = {Proceedings of the 2008 {ACM} Symposium on Applied Computing (SAC),
Fortaleza, Ceara, Brazil, March 16-20, 2008},
pages = {2331--2335},
publisher = {{ACM}},
year = {2008},
url = {https://doi.org/10.1145/1363686.1364238},
doi = {10.1145/1363686.1364238},
timestamp = {Tue, 06 Nov 2018 11:06:48 +0100},
biburl = {https://dblp.org/rec/conf/sac/StojanovicSM08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:series/sci/ApostolouKS08,
author = {Dimitris Apostolou and
Stelios Karapiperis and
Nenad Stojanovic},
editor = {George A. Tsihrintzis and
Maria Virvou and
Robert J. Howlett and
Lakhmi C. Jain},
title = {On Managing Users' Attention in Knowledge-Intensive Organizations},
booktitle = {New Directions in Intelligent Interactive Multimedia},
series = {Studies in Computational Intelligence},
volume = {142},
pages = {239--248},
publisher = {Springer},
year = {2008},
url = {https://doi.org/10.1007/978-3-540-68127-4\_25},
doi = {10.1007/978-3-540-68127-4\_25},
timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/series/sci/ApostolouKS08.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/NamiriS07,
author = {Kioumars Namiri and
Nenad Stojanovic},
editor = {Johann Eder and
Stein L. Tomassen and
Andreas L. Opdahl and
Guttorm Sindre},
title = {A Semantic-based Approach for Compliance Management of Internal Controls
in Business Processes},
booktitle = {CAiSE'07 Forum, Proceedings of the CAiSE'07 Forum at the 19th International
Conference on Advanced Information Systems Engineering, Trondheim,
Norway, 11-15 June 2007},
series = {{CEUR} Workshop Proceedings},
volume = {247},
publisher = {CEUR-WS.org},
year = {2007},
url = {https://ceur-ws.org/Vol-247/FORUM\_16.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:34 +0100},
biburl = {https://dblp.org/rec/conf/caise/NamiriS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esws/NamiriS07,
author = {Kioumars Namiri and
Nenad Stojanovic},
editor = {Martin Hepp and
Knut Hinkelmann and
Dimitris Karagiannis and
R{\"{u}}diger Klein and
Nenad Stojanovic},
title = {A Model-driven Approach for Internal Controls Compliance in Business
Processes},
booktitle = {Proceedings of the Workshop on Semantic Business Process and Product
Lifecycle Management {SBPM} 2007, held in conjunction with the 3rd
European Semantic Web Conference {(ESWC} 2007), Innsbruck, Austria,
June 7, 2007},
series = {{CEUR} Workshop Proceedings},
volume = {251},
publisher = {CEUR-WS.org},
year = {2007},
url = {https://ceur-ws.org/Vol-251/paper5.pdf},
timestamp = {Fri, 10 Mar 2023 16:23:13 +0100},
biburl = {https://dblp.org/rec/conf/esws/NamiriS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/esws/SchmidtSST07,
author = {Kay{-}Uwe Schmidt and
Ljiljana Stojanovic and
Nenad Stojanovic and
Susan Thomas},
editor = {Enrico Franconi and
Michael Kifer and
Wolfgang May},
title = {On Enriching Ajax with Semantics: The Web Personalization Use Case},
booktitle = {The Semantic Web: Research and Applications, 4th European Semantic
Web Conference, {ESWC} 2007, Innsbruck, Austria, June 3-7, 2007, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4519},
pages = {686--700},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-72667-8\_48},
doi = {10.1007/978-3-540-72667-8\_48},
timestamp = {Tue, 14 May 2019 10:00:44 +0200},
biburl = {https://dblp.org/rec/conf/esws/SchmidtSST07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gi/NamiriS07,
author = {Kioumars Namiri and
Nenad Stojanovic},
editor = {Rainer Koschke and
Otthein Herzog and
Karl{-}Heinz R{\"{o}}diger and
Marc Ronthaler},
title = {Applying Semantics to Sarbanes Oxley Internal Controls Compliance},
booktitle = {37. Jahrestagung der Gesellschaft f{\"{u}}r Informatik, Informatik
trifft Logistik, {INFORMATIK} 2007, Bremen, Germany, September 24-27,
2007, Band 1},
series = {{LNI}},
volume = {{P-109}},
pages = {222--226},
publisher = {{GI}},
year = {2007},
url = {https://dl.gi.de/handle/20.500.12116/22584},
timestamp = {Tue, 04 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gi/NamiriS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gi/NamiriKS07,
author = {Kioumars Namiri and
M.{-}M. K{\"{u}}gler and
Nenad Stojanovic},
editor = {Rainer Koschke and
Otthein Herzog and
Karl{-}Heinz R{\"{o}}diger and
Marc Ronthaler},
title = {A Static Business Level Verification Framework for Cross-Organizational
Business Process Models using {SWRL}},
booktitle = {37. Jahrestagung der Gesellschaft f{\"{u}}r Informatik, Informatik
trifft Logistik, {INFORMATIK} 2007, Bremen, Germany, September 24-27,
2007, Band 1},
series = {{LNI}},
volume = {{P-109}},
pages = {232--236},
publisher = {{GI}},
year = {2007},
url = {https://dl.gi.de/handle/20.500.12116/22587},
timestamp = {Tue, 04 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gi/NamiriKS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kcap/HappelSS07,
author = {Hans{-}J{\"{o}}rg Happel and
Ljiljana Stojanovic and
Nenad Stojanovic},
editor = {Derek H. Sleeman and
Ken Barker},
title = {Fostering knowledge sharing by inverse search},
booktitle = {Proceedings of the 4th International Conference on Knowledge Capture
{(K-CAP} 2007), October 28-31, 2007, Whistler, BC, Canada},
pages = {181--182},
publisher = {{ACM}},
year = {2007},
url = {https://doi.org/10.1145/1298406.1298444},
doi = {10.1145/1298406.1298444},
timestamp = {Mon, 24 Aug 2020 15:16:10 +0200},
biburl = {https://dblp.org/rec/conf/kcap/HappelSS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mtsr/StojanovicANM07,
author = {Nenad Stojanovic and
Dimitris Apostolou and
Spyridon Ntioudis and
Gregoris Mentzas},
editor = {Miguel{-}{\'{A}}ngel Sicilia and
Miltiadis D. Lytras},
title = {A semantics-based software framework for ensuring consistent access
to up-to-date knowledge resources in Public Administrations},
booktitle = {Metadata and Semantics, Post-proceedings of the 2nd International
Conference on Metadata and Semantics Research, {MTSR} 2007, Corfu
Island in Greece, 1-2 October 2007},
pages = {319--328},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-0-387-77745-0\_31},
doi = {10.1007/978-0-387-77745-0\_31},
timestamp = {Sun, 25 Oct 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/mtsr/StojanovicANM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/otm/NamiriS07,
author = {Kioumars Namiri and
Nenad Stojanovic},
editor = {Robert Meersman and
Zahir Tari},
title = {Pattern-Based Design and Validation of Business Process Compliance},
booktitle = {On the Move to Meaningful Internet Systems 2007: CoopIS, DOA, ODBASE,
GADA, and IS, {OTM} Confederated International Conferences CoopIS,
DOA, ODBASE, GADA, and {IS} 2007, Vilamoura, Portugal, November 25-30,
2007, Proceedings, Part {I}},
series = {Lecture Notes in Computer Science},
volume = {4803},
pages = {59--76},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-76848-7\_6},
doi = {10.1007/978-3-540-76848-7\_6},
timestamp = {Tue, 14 May 2019 10:00:54 +0200},
biburl = {https://dblp.org/rec/conf/otm/NamiriS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/webi/StojanovicSM07,
author = {Ljiljana Stojanovic and
Nenad Stojanovic and
Jun Ma},
title = {On the Conceptual Tagging: An Ontology Pruning Use Case},
booktitle = {2007 {IEEE} / {WIC} / {ACM} International Conference on Web Intelligence,
{WI} 2007, 2-5 November 2007, Silicon Valley, CA, USA, Main Conference
Proceedings},
pages = {344--350},
publisher = {{IEEE} Computer Society},
year = {2007},
url = {https://doi.org/10.1109/WI.2007.123},
doi = {10.1109/WI.2007.123},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/webi/StojanovicSM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wise/NamiriS07,
author = {Kioumars Namiri and
Nenad Stojanovic},
editor = {Mathias Weske and
Mohand{-}Said Hacid and
Claude Godart},
title = {Using Control Patterns in Business Processes Compliance},
booktitle = {Web Information Systems Engineering - {WISE} 2007 Workshops, {WISE}
2007 International Workshops, Nancy, France, December 3, 2007, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4832},
pages = {178--190},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-77010-7\_18},
doi = {10.1007/978-3-540-77010-7\_18},
timestamp = {Tue, 14 May 2019 10:00:52 +0200},
biburl = {https://dblp.org/rec/conf/wise/NamiriS07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wise/StojanovicSM07,
author = {Ljiljana Stojanovic and
Nenad Stojanovic and
Jun Ma},
editor = {Boualem Benatallah and
Fabio Casati and
Dimitrios Georgakopoulos and
Claudio Bartolini and
Wasim Sadiq and
Claude Godart},
title = {An Approach for Combining Ontology Learning and Semantic Tagging in
the Ontology Development Process: eGovernment Use Case},
booktitle = {Web Information Systems Engineering - {WISE} 2007, 8th International
Conference on Web Information Systems Engineering, Nancy, France,
December 3-7, 2007, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {4831},
pages = {249--260},
publisher = {Springer},
year = {2007},
url = {https://doi.org/10.1007/978-3-540-76993-4\_21},
doi = {10.1007/978-3-540-76993-4\_21},
timestamp = {Fri, 15 Mar 2024 12:30:44 +0100},
biburl = {https://dblp.org/rec/conf/wise/StojanovicSM07.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/esws/2007sbpm,
editor = {Martin Hepp and
Knut Hinkelmann and
Dimitris Karagiannis and
R{\"{u}}diger Klein and
Nenad Stojanovic},
title = {Proceedings of the Workshop on Semantic Business Process and Product
Lifecycle Management {SBPM} 2007, held in conjunction with the 3rd
European Semantic Web Conference {(ESWC} 2007), Innsbruck, Austria,
June 7, 2007},
series = {{CEUR} Workshop Proceedings},
volume = {251},
publisher = {CEUR-WS.org},
year = {2007},
url = {https://ceur-ws.org/Vol-251},
urn = {urn:nbn:de:0074-251-8},
timestamp = {Fri, 10 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/esws/2007sbpm.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eg/StojanovicSA06,
author = {Ljiljana Stojanovic and
Nenad Stojanovic and
Dimitris Apostolou},
title = {Change management in e-government: OntoGov case study},
journal = {Electron. Gov. an Int. J.},
volume = {3},
number = {1},
pages = {74--92},
year = {2006},
url = {https://doi.org/10.1504/EG.2006.008493},
doi = {10.1504/EG.2006.008493},
timestamp = {Sat, 25 Apr 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/eg/StojanovicSA06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaiss/StojanovicSHMA06,
author = {Nenad Stojanovic and
Ljiljana Stojanovic and
Knut Hinkelmann and
Gregoris Mentzas and
Andreas Abecker},
title = {Fostering Self-Adaptive e-Government Service Improvement using Semantic
Technologies},
booktitle = {Semantic Web Meets eGovernment, Papers from the 2006 {AAAI} Spring
Symposium, Technical Report SS-06-06, Stanford, California, USA, March
27-29, 2006},
pages = {129--131},
publisher = {{AAAI}},
year = {2006},
url = {http://www.aaai.org/Library/Symposia/Spring/2006/ss06-06-021.php},
timestamp = {Sat, 18 Feb 2012 12:30:46 +0100},
biburl = {https://dblp.org/rec/conf/aaaiss/StojanovicSHMA06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/aaaiss/StojanovicMA06,
author = {Nenad Stojanovic and
Gregoris Mentzas and
Dimitris Apostolou},
title = {Semantic-Enabled Agile Knowledge-based e-Government},
booktitle = {Semantic Web Meets eGovernment, Papers from the 2006 {AAAI} Spring
Symposium, Technical Report SS-06-06, Stanford, California, USA, March
27-29, 2006},
pages = {132--134},
publisher = {{AAAI}},
year = {2006},
url = {http://www.aaai.org/Library/Symposia/Spring/2006/ss06-06-022.php},
timestamp = {Sat, 18 Feb 2012 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/aaaiss/StojanovicMA06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wecwis/KnuchelS06,
author = {Jorn Philipp Kn{\"{u}}chel and
Nenad Stojanovic},
title = {A learning-based hybrid approach for anonymous recommendation},
booktitle = {Eighth {IEEE} International Conference on E-Commerce Technology {(CEC}
2006) / Third {IEEE} International Conference on Enterprise Computing,
E-Commerce and E-Services {(EEE} 2006) and Workshops, 26-29 June 2006,
Palo Alto, California, {USA}},
pages = {36},
publisher = {{IEEE} Computer Society},
year = {2006},
url = {https://doi.org/10.1109/CEC-EEE.2006.4},
doi = {10.1109/CEC-EEE.2006.4},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wecwis/KnuchelS06.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@phdthesis{DBLP:phd/de/Stojanovic2005,
author = {Nenad Stojanovic},
title = {Ontology-based information retrieval: methods and tools for cooperative
query answering},
school = {Karlsruhe Institute of Technology, Germany},
year = {2005},
url = {http://digbib.ubka.uni-karlsruhe.de/volltexte/1000004667},
urn = {urn:nbn:de:swb:90-46670},
timestamp = {Sat, 17 Jul 2021 01:00:00 +0200},
biburl = {https://dblp.org/rec/phd/de/Stojanovic2005.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/is/Stojanovic05,
author = {Nenad Stojanovic},
title = {On the query refinement in the ontology-based searching for information},
journal = {Inf. Syst.},
volume = {30},
number = {7},
pages = {543--563},
year = {2005},
url = {https://doi.org/10.1016/j.is.2004.11.004},
doi = {10.1016/J.IS.2004.11.004},
timestamp = {Sat, 20 May 2017 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/is/Stojanovic05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ki/Stojanovic05,
author = {Nenad Stojanovic},
title = {{EKAW} 2004},
journal = {K{\"{u}}nstliche Intell.},
volume = {19},
number = {1},
pages = {71},
year = {2005},
url = {http://www.kuenstliche-intelligenz.de/index.php?id=no-6423\&\#38;tx\_ki\_pi1\%5BshowUid\%5D=1071\&\#38;cHash=15988e0e5a},
timestamp = {Thu, 09 Jun 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/ki/Stojanovic05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/wias/Stojanovic05,
author = {Nenad Stojanovic},
title = {Information-need driven query refinement},
journal = {Web Intell. Agent Syst.},
volume = {3},
number = {3},
pages = {155--169},
year = {2005},
url = {http://content.iospress.com/articles/web-intelligence-and-agent-systems-an-international-journal/wia00066},
timestamp = {Thu, 21 May 2020 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/wias/Stojanovic05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/birthday/HartmannSSS05,
author = {Jens Hartmann and
Nenad Stojanovic and
Rudi Studer and
Lars Schmidt{-}Thieme},
editor = {Matthias L. Hemmje and
Claudia Nieder{\'{e}}e and
Thomas Risse},
title = {Ontology-Based Query Refinement for Semantic Portals},
booktitle = {From Integrated Publication and Information Systems to Virtual Information
and Knowledge Environments, Essays Dedicated to Erich J. Neuhold on
the Occasion of His 65th Birthday},
series = {Lecture Notes in Computer Science},
volume = {3379},
pages = {41--50},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/978-3-540-31842-2\_5},
doi = {10.1007/978-3-540-31842-2\_5},
timestamp = {Wed, 28 Apr 2021 18:05:35 +0200},
biburl = {https://dblp.org/rec/conf/birthday/HartmannSSS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecis/EhrigHHS05,
author = {Marc Ehrig and
Peter Haase and
Mark Hefke and
Nenad Stojanovic},
editor = {Dieter Bartmann and
Federico Rajola and
Jannis Kallinikos and
David E. Avison and
Robert Winter and
Phillip Ein{-}Dor and
J{\"{o}}rg Becker and
Freimut Bodendorf and
Christof Weinhardt},
title = {Similarity for Ontologies - {A} Comprehensive Framework},
booktitle = {Proceedings of the 13th European Conference on Information Systems,
Information Systems in a Rapidly Changing Economy, {ECIS} 2005, Regensburg,
Germany, May 26-28, 2005},
pages = {1509--1518},
year = {2005},
url = {http://aisel.aisnet.org/ecis2005/127},
timestamp = {Wed, 24 Jul 2019 16:44:04 +0200},
biburl = {https://dblp.org/rec/conf/ecis/EhrigHHS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/egov/StojanovicS05,
author = {Nenad Stojanovic and
Ljiljana Stojanovic},
editor = {Kim Viborg Andersen and
{\AA}ke Gr{\"{o}}nlund and
Roland Traunm{\"{u}}ller and
Maria Wimmer},
title = {A Change-Aware Framework for the Knowledge Management in eGovernment},
booktitle = {Electronic Government - Workshop and Poster Proceedings of the Fourth
International {EGOV} Conference 2005, August 22-26, 2005, Copenhagen,
Denmark},
series = {Schriftenreihe Informatik},
volume = {13},
pages = {3--10},
publisher = {Universit{\"{a}}tsverlag Rudolf Trauner, Linz, Austria},
year = {2005},
timestamp = {Mon, 09 Sep 2019 15:35:36 +0200},
biburl = {https://dblp.org/rec/conf/egov/StojanovicS05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gi/FankhauserFHJKKKKL0MOOPRRSBSSSSSVWW05,
author = {Peter Fankhauser and
Norbert Fuhr and
Jens Hartmann and
Anthony Jameson and
Claus{-}Peter Klas and
Stefan Klink and
Agnes Koschmider and
Sascha Kriewel and
Patrick Lehti and
Peter Luksch and
Ernst W. Mayr and
Andreas Oberweis and
Paul Ortyl and
Stefan Pfingstl and
Patrick Reuther and
Ute Rusnak and
Guido Sautter and
Klemens B{\"{o}}hm and
Andr{\'{e}} Schaefer and
Lars Schmidt{-}Thieme and
Eric Schwarzkopf and
Nenad Stojanovic and
Rudi Studer and
Roland Vollmar and
Bernd Walter and
Alexander Weber},
editor = {Armin B. Cremers and
Rainer Manthey and
Peter Martini and
Volker Steinhage},
title = {Fachinformationssystem Informatik {(FIS-I)} und Semantische Technologien
f{\"{u}}r Informationsportale (SemIPort)},
booktitle = {35. Jahrestagung der Gesellschaft f{\"{u}}r Informatik, Informatik
LIVE!, {INFORMATIK} 2005, Bonn, Germany, September 19-22, 2005, Band
2},
series = {{LNI}},
volume = {{P-68}},
pages = {698--712},
publisher = {{GI}},
year = {2005},
timestamp = {Tue, 12 Jan 2021 19:25:57 +0100},
biburl = {https://dblp.org/rec/conf/gi/FankhauserFHJKKKKL0MOOPRRSBSSSSSVWW05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kcap/Stojanovic05,
author = {Nenad Stojanovic},
editor = {Peter Clark and
Guus Schreiber},
title = {On the role of a user's knowledge gap in an information retrieval
process},
booktitle = {Proceedings of the 3rd International Conference on Knowledge Capture
{(K-CAP} 2005), October 2-5, 2005, Banff, Alberta, Canada},
pages = {83--90},
publisher = {{ACM}},
year = {2005},
url = {https://doi.org/10.1145/1088622.1088638},
doi = {10.1145/1088622.1088638},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/kcap/Stojanovic05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/webi/Stojanovic05,
author = {Nenad Stojanovic},
editor = {Andrzej Skowron and
Rakesh Agrawal and
Michael Luck and
Takahira Yamaguchi and
Pierre Morizet{-}Mahoudeaux and
Jiming Liu and
Ning Zhong},
title = {An Approach for Defining Relevance in the Ontology-Based Information
Retrieval},
booktitle = {2005 {IEEE} / {WIC} / {ACM} International Conference on Web Intelligence
{(WI} 2005), 19-22 September 2005, Compiegne, France},
pages = {359--365},
publisher = {{IEEE} Computer Society},
year = {2005},
url = {https://doi.org/10.1109/WI.2005.25},
doi = {10.1109/WI.2005.25},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/webi/Stojanovic05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wirtschaftsinformatik/Stojanovic05,
author = {Nenad Stojanovic},
editor = {Otto K. Ferstl and
Elmar J. Sinz and
Sven Eckert and
Tilman Isselhorst},
title = {On the Query Refinement in Searching a Bibliographic Database},
booktitle = {Wirtschaftsinformatik 2005: eEconomy, eGovernment, eSociety, 7. Internationale
Tagung Wirtschaftsinformatik 2005, Bamberg, 23.2.2005 - 25.2.2005},
pages = {1329--1346},
publisher = {Physica-Verlag},
year = {2005},
url = {http://aisel.aisnet.org/wi2005/70},
timestamp = {Mon, 27 Feb 2012 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wirtschaftsinformatik/Stojanovic05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wise/Stojanovic05,
author = {Nenad Stojanovic},
editor = {Anne H. H. Ngu and
Masaru Kitsuregawa and
Erich J. Neuhold and
Jen{-}Yao Chung and
Quan Z. Sheng},
title = {Conceptual Query Refinement: The Basic Model},
booktitle = {Web Information Systems Engineering - {WISE} 2005, 6th International
Conference on Web Information Systems Engineering, New York, NY, USA,
November 20-22, 2005, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3806},
pages = {404--417},
publisher = {Springer},
year = {2005},
url = {https://doi.org/10.1007/11581062\_30},
doi = {10.1007/11581062\_30},
timestamp = {Tue, 14 May 2019 10:00:52 +0200},
biburl = {https://dblp.org/rec/conf/wise/Stojanovic05.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ws/VolzHSSS04,
author = {Raphael Volz and
Siegfried Handschuh and
Steffen Staab and
Ljiljana Stojanovic and
Nenad Stojanovic},
title = {Unveiling the hidden bride: deep annotation for mapping and migrating
legacy data to the Semantic Web},
journal = {J. Web Semant.},
volume = {1},
number = {2},
pages = {187--206},
year = {2004},
url = {https://doi.org/10.1016/j.websem.2003.11.005},
doi = {10.1016/J.WEBSEM.2003.11.005},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/journals/ws/VolzHSSS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coopis/StojanovicASS04,
author = {Ljiljana Stojanovic and
Andreas Abecker and
Nenad Stojanovic and
Rudi Studer},
editor = {Robert Meersman and
Zahir Tari},
title = {On Managing Changes in the Ontology-Based E-government},
booktitle = {On the Move to Meaningful Internet Systems 2004: CoopIS, DOA, and
ODBASE, {OTM} Confederated International Conferences, Agia Napa, Cyprus,
October 25-29, 2004, Proceedings, Part {II}},
series = {Lecture Notes in Computer Science},
volume = {3291},
pages = {1080--1097},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-30469-2\_16},
doi = {10.1007/978-3-540-30469-2\_16},
timestamp = {Tue, 14 May 2019 10:00:51 +0200},
biburl = {https://dblp.org/rec/conf/coopis/StojanovicASS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/eee/Stojanovic04,
author = {Nenad Stojanovic},
title = {On Using Query Neighbourhood for Better Navigation through a Product
Catalog: {SMART} Approach},
booktitle = {2004 {IEEE} International Conference on e-Technology, e-Commerce,
and e-Services {(EEE} 04), 29-31 March 2004, Taipei, Taiwan},
pages = {405--412},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/EEE.2004.1287339},
doi = {10.1109/EEE.2004.1287339},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/eee/Stojanovic04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ekaw/StojanovicS04,
author = {Nenad Stojanovic and
Rudi Studer},
editor = {Enrico Motta and
Nigel Shadbolt and
Arthur Stutt and
Nicholas Gibbins},
title = {On the Knowledge Level of an On-line Shop Assistant},
booktitle = {Engineering Knowledge in the Age of the Semantic Web, 14th International
Conference, {EKAW} 2004, Whittlebury Hall, UK, October 5-8, 2004,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3257},
pages = {354--370},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-30202-5\_24},
doi = {10.1007/978-3-540-30202-5\_24},
timestamp = {Tue, 14 May 2019 10:00:39 +0200},
biburl = {https://dblp.org/rec/conf/ekaw/StojanovicS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/er/StojanovicS04,
author = {Nenad Stojanovic and
Ljiljana Stojanovic},
editor = {Paolo Atzeni and
Wesley W. Chu and
Hongjun Lu and
Shuigeng Zhou and
Tok Wang Ling},
title = {On Modelling Cooperative Retrieval Using an Ontology-Based Query Refinement
Process},
booktitle = {Conceptual Modeling - {ER} 2004, 23rd International Conference on
Conceptual Modeling, Shanghai, China, November 2004, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3288},
pages = {434--449},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-30464-7\_34},
doi = {10.1007/978-3-540-30464-7\_34},
timestamp = {Tue, 14 May 2019 10:00:50 +0200},
biburl = {https://dblp.org/rec/conf/er/StojanovicS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gi/Stojanovic04,
author = {Nenad Stojanovic},
editor = {Peter Dadam and
Manfred Reichert},
title = {On discovering user's needs in the ontology-based portals using implicit
relevance feedback},
booktitle = {34. Jahrestagung der Gesellschaft f{\"{u}}r Informatik, Informatik
verbindet, {INFORMATIK} 2004, Ulm, Germany, September 20-24, 2004,
Band 2},
series = {{LNI}},
volume = {{P-51}},
pages = {182--186},
publisher = {{GI}},
year = {2004},
url = {https://dl.gi.de/handle/20.500.12116/28752},
timestamp = {Tue, 04 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gi/Stojanovic04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icac/StojanovicASS04,
author = {Ljiljana Stojanovic and
Andreas Abecker and
Nenad Stojanovic and
Rudi Studer},
title = {Ontology-Based Correlation Engines},
booktitle = {1st International Conference on Autonomic Computing {(ICAC} 2004),
17-19 May 2004, New York, NY, {USA}},
pages = {304--305},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.ieeecomputersociety.org/10.1109/ICAC.2004.43},
doi = {10.1109/ICAC.2004.43},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icac/StojanovicASS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/icdm/Stojanovic04,
author = {Nenad Stojanovic},
title = {n Ranking Refinements in the Step-by-Step Searching through a Product
Catalogue},
booktitle = {Proceedings of the 4th {IEEE} International Conference on Data Mining
{(ICDM} 2004), 1-4 November 2004, Brighton, {UK}},
pages = {527--530},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/ICDM.2004.10017},
doi = {10.1109/ICDM.2004.10017},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/icdm/Stojanovic04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ictai/StojanovicS04,
author = {Nenad Stojanovic and
Ljiljana Stojanovic},
title = {A Logic-Based Approach for Query Refinement in Ontology-Based Information
Retrieval {S}},
booktitle = {16th {IEEE} International Conference on Tools with Artificial Intelligence
{(ICTAI} 2004), 15-17 November 2004, Boca Raton, FL, {USA}},
pages = {450--457},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/ICTAI.2004.13},
doi = {10.1109/ICTAI.2004.13},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ictai/StojanovicS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ictai/Stojanovic04,
author = {Nenad Stojanovic},
title = {An Approach for Ontology-Enhanced Query Refinement in Information
Portals},
booktitle = {16th {IEEE} International Conference on Tools with Artificial Intelligence
{(ICTAI} 2004), 15-17 November 2004, Boca Raton, FL, {USA}},
pages = {531--534},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/ICTAI.2004.25},
doi = {10.1109/ICTAI.2004.25},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ictai/Stojanovic04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pakm/Stojanovic04,
author = {Nenad Stojanovic},
editor = {Dimitris Karagiannis and
Ulrich Reimer},
title = {An Approach for the Efficient Retrieval in Ontology-Enhanced Information
Portals},
booktitle = {Practical Aspects of Knowledge Management, 5th International Conference,
{PAKM} 2004, Vienna, Austria, December 2-3, 2004, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {3336},
pages = {414--424},
publisher = {Springer},
year = {2004},
url = {https://doi.org/10.1007/978-3-540-30545-3\_39},
doi = {10.1007/978-3-540-30545-3\_39},
timestamp = {Tue, 14 May 2019 10:00:43 +0200},
biburl = {https://dblp.org/rec/conf/pakm/Stojanovic04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/seke/Stojanovic04,
author = {Nenad Stojanovic},
editor = {Frank Maurer and
G{\"{u}}nther Ruhe},
title = {On Modelling an e-shop Application on the Knowledge Level: e-ShopAgent
Approach},
booktitle = {Proceedings of the Sixteenth International Conference on Software
Engineering {\&} Knowledge Engineering (SEKE'2004), Banff, Alberta,
Canada, June 20-24, 2004},
pages = {232--237},
year = {2004},
timestamp = {Thu, 12 Mar 2020 11:30:50 +0100},
biburl = {https://dblp.org/rec/conf/seke/Stojanovic04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/webi/StojanovicSS04,
author = {Nenad Stojanovic and
Rudi Studer and
Ljiljana Stojanovic},
title = {An Approach for Step-By-Step Query Refinement in the Ontology-Based
Information Retrieval},
booktitle = {2004 {IEEE/WIC/ACM} International Conference on Web Intelligence {(WI}
2004), 20-24 September 2004, Beijing, China},
pages = {36--43},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/WI.2004.10161},
doi = {10.1109/WI.2004.10161},
timestamp = {Thu, 23 Mar 2023 14:30:18 +0100},
biburl = {https://dblp.org/rec/conf/webi/StojanovicSS04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/webi/Stojanovic04,
author = {Nenad Stojanovic},
title = {A Logic-Based Approach for Query Refinement},
booktitle = {2004 {IEEE/WIC/ACM} International Conference on Web Intelligence {(WI}
2004), 20-24 September 2004, Beijing, China},
pages = {477--480},
publisher = {{IEEE} Computer Society},
year = {2004},
url = {https://doi.org/10.1109/WI.2004.10151},
doi = {10.1109/WI.2004.10151},
timestamp = {Thu, 23 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/webi/Stojanovic04.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jucs/Stojanovic03,
author = {Nenad Stojanovic},
title = {On the Role of the Librarian Agent in Ontology-based Knowledge Management
Systems},
journal = {J. Univers. Comput. Sci.},
volume = {9},
number = {7},
pages = {697--718},
year = {2003},
url = {https://doi.org/10.3217/jucs-009-07-0697},
doi = {10.3217/JUCS-009-07-0697},
timestamp = {Thu, 07 Sep 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/journals/jucs/Stojanovic03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/caise/Stojanovic03,
author = {Nenad Stojanovic},
editor = {Johann Eder and
Michele Missikoff},
title = {On the Query Refinement in the Ontology-Based Searching for Information},
booktitle = {Advanced Information Systems Engineering, 15th International Conference,
CAiSE 2003, Klagenfurt, Austria, June 16-18, 2003, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2681},
pages = {324--339},
publisher = {Springer},
year = {2003},
url = {https://doi.org/10.1007/3-540-45017-3\_23},
doi = {10.1007/3-540-45017-3\_23},
timestamp = {Tue, 14 May 2019 10:00:36 +0200},
biburl = {https://dblp.org/rec/conf/caise/Stojanovic03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coopis/StojanovicSGS03,
author = {Ljiljana Stojanovic and
Nenad Stojanovic and
Jorge Gonzalez and
Rudi Studer},
editor = {Robert Meersman and
Zahir Tari and
Douglas C. Schmidt},
title = {OntoManager - {A} System for the Usage-Based Ontology Management},
booktitle = {On The Move to Meaningful Internet Systems 2003: CoopIS, DOA, and
{ODBASE} - {OTM} Confederated International Conferences, CoopIS, DOA,
and {ODBASE} 2003, Catania, Sicily, Italy, November 3-7, 2003},
series = {Lecture Notes in Computer Science},
volume = {2888},
pages = {858--875},
publisher = {Springer},
year = {2003},
url = {https://doi.org/10.1007/978-3-540-39964-3\_54},
doi = {10.1007/978-3-540-39964-3\_54},
timestamp = {Fri, 30 Apr 2021 14:59:15 +0200},
biburl = {https://dblp.org/rec/conf/coopis/StojanovicSGS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dagstuhl/MaedcheSSSS03,
author = {Alexander Maedche and
Steffen Staab and
Nenad Stojanovic and
Rudi Studer and
York Sure},
editor = {Dieter Fensel and
James A. Hendler and
Henry Lieberman and
Wolfgang Wahlster},
title = {SEmantic portAL: The {SEAL} Approach},
booktitle = {Spinning the Semantic Web: Bringing the World Wide Web to Its Full
Potential [outcome of a Dagstuhl seminar]},
pages = {317--359},
publisher = {{MIT} Press},
year = {2003},
timestamp = {Thu, 27 Mar 2003 11:07:45 +0100},
biburl = {https://dblp.org/rec/conf/dagstuhl/MaedcheSSSS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dexa/Stojanovic03,
author = {Nenad Stojanovic},
editor = {Vladim{\'{\i}}r Mar{\'{\i}}k and
Werner Retschitzegger and
Olga Step{\'{a}}nkov{\'{a}}},
title = {An Explanation-Based Ranking Approach for Ontology-Based Querying},
booktitle = {Database and Expert Systems Applications, 14th International Conference,
{DEXA} 2003, Prague, Czech Republic, September 1-5, 2003, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2736},
pages = {641--650},
publisher = {Springer},
year = {2003},
url = {https://doi.org/10.1007/978-3-540-45227-0\_63},
doi = {10.1007/978-3-540-45227-0\_63},
timestamp = {Tue, 14 May 2019 10:00:46 +0200},
biburl = {https://dblp.org/rec/conf/dexa/Stojanovic03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/er/Stojanovic03,
author = {Nenad Stojanovic},
editor = {Il{-}Yeol Song and
Stephen W. Liddle and
Tok Wang Ling and
Peter Scheuermann},
title = {On Analysing Query Ambiguity for Query Refinement: The Librarian Agent
Approach},
booktitle = {Conceptual Modeling - {ER} 2003, 22nd International Conference on
Conceptual Modeling, Chicago, IL, USA, October 13-16, 2003, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2813},
pages = {490--505},
publisher = {Springer},
year = {2003},
url = {https://doi.org/10.1007/978-3-540-39648-2\_38},
doi = {10.1007/978-3-540-39648-2\_38},
timestamp = {Tue, 14 May 2019 10:00:50 +0200},
biburl = {https://dblp.org/rec/conf/er/Stojanovic03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/gi/AgarwalFGHHJKLLRSSSSSWW03,
author = {Sudhir Agarwal and
Peter Fankhauser and
Jorge Gonzalez{-}Ollala and
Jens Hartmann and
Silvia Hollfelder and
Anthony Jameson and
Stefan Klink and
Patrick Lehti and
Michael Ley and
Emma Rabbidge and
Eric Schwarzkopf and
Nitesh Shrestha and
Nenad Stojanovic and
Rudi Studer and
Gerd Stumme and
Bernd Walter and
Alexander Weber},
editor = {Klaus R. Dittrich and
Wolfgang K{\"{o}}nig and
Andreas Oberweis and
Kai Rannenberg and
Wolfgang Wahlster},
title = {Semantic Methods and Tools for Information Portals},
booktitle = {33. Jahrestagung der Gesellschaft f{\"{u}}r Informatik, Innovative
Informatikanwendungen, {INFORMATIK} 2003, Frankfurt am Main, Germany,
September 29 - October 2, 2003, Band 1},
series = {{LNI}},
volume = {{P-34}},
pages = {116--131},
publisher = {{GI}},
year = {2003},
url = {https://dl.gi.de/handle/20.500.12116/29747},
timestamp = {Tue, 04 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/gi/AgarwalFGHHJKLLRSSSSSWW03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kcap/StojanovicMSS03,
author = {Ljiljana Stojanovic and
Alexander Maedche and
Nenad Stojanovic and
Rudi Studer},
editor = {John H. Gennari and
Bruce W. Porter and
Yolanda Gil},
title = {Ontology evolution as reconfiguration-design problem solving},
booktitle = {Proceedings of the 2nd International Conference on Knowledge Capture
{(K-CAP} 2003), October 23-25, 2003, Sanibel Island, FL, {USA}},
pages = {162--171},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/945645.945669},
doi = {10.1145/945645.945669},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/kcap/StojanovicMSS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kcap/StojanovicGS03,
author = {Nenad Stojanovic and
Jorge Gonzalez and
Ljiljana Stojanovic},
editor = {John H. Gennari and
Bruce W. Porter and
Yolanda Gil},
title = {{ONTOLOGER:} a system for usage-driven management of ontology-based
information portals},
booktitle = {Proceedings of the 2nd International Conference on Knowledge Capture
{(K-CAP} 2003), October 23-25, 2003, Sanibel Island, FL, {USA}},
pages = {172--179},
publisher = {{ACM}},
year = {2003},
url = {https://doi.org/10.1145/945645.945670},
doi = {10.1145/945645.945670},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/kcap/StojanovicGS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/semweb/StojanovicSS03,
author = {Nenad Stojanovic and
Rudi Studer and
Ljiljana Stojanovic},
editor = {Dieter Fensel and
Katia P. Sycara and
John Mylopoulos},
title = {An Approach for the Ranking of Query Results in the Semantic Web},
booktitle = {The Semantic Web - {ISWC} 2003, Second International Semantic Web
Conference, Sanibel Island, FL, USA, October 20-23, 2003, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2870},
pages = {500--516},
publisher = {Springer},
year = {2003},
url = {https://doi.org/10.1007/978-3-540-39718-2\_32},
doi = {10.1007/978-3-540-39718-2\_32},
timestamp = {Tue, 07 Sep 2021 13:48:16 +0200},
biburl = {https://dblp.org/rec/conf/semweb/StojanovicSS03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/webi/Stojanovic03,
author = {Nenad Stojanovic},
title = {Information-Need Driven Query Refinement},
booktitle = {2003 {IEEE} / {WIC} International Conference on Web Intelligence,
{(WI} 2003), 13-17 October 2003, Halifax, Canada},
pages = {388--395},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/WI.2003.1241220},
doi = {10.1109/WI.2003.1241220},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/webi/Stojanovic03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wise/Stojanovic03,
author = {Nenad Stojanovic},
title = {On the Role of Query Refinement in Searching for Information: The
Librarian Agent Query Refinement Process},
booktitle = {4th International Conference on Web Information Systems Engineering,
{WISE} 2003, Rome, Italy, December 10-12, 2003},
pages = {41--52},
publisher = {{IEEE} Computer Society},
year = {2003},
url = {https://doi.org/10.1109/WISE.2003.1254467},
doi = {10.1109/WISE.2003.1254467},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wise/Stojanovic03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wm/Stojanovic03,
author = {Nenad Stojanovic},
editor = {Ulrich Reimer and
Andreas Abecker and
Steffen Staab and
Gerd Stumme},
title = {On the role of a Librarian Agent in Ontology-based Knowledge Management
Systems},
booktitle = {{WM} 2003: Professionelles Wissensmanagement - Erfahrungen und Visionen,
Beitr{\"{a}}ge der 2. Konferenz Professionelles Wissensmanagement,
2.-4. April 2003, Luzern, Switzerland},
series = {{LNI}},
volume = {{P-28}},
pages = {35--42},
publisher = {{GI}},
year = {2003},
url = {https://dl.gi.de/handle/20.500.12116/30014},
timestamp = {Tue, 04 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/wm/Stojanovic03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wow/Stojanovic03,
author = {Nenad Stojanovic},
editor = {York Sure and
Hans{-}Peter Schnurr},
title = {On the role of Librarian Agent in ontology-based Knowledge Management
Systems},
booktitle = {WOW2003, Workshop Ontologie-basiertes Wissensmanagement (German Workshop
on Ontology-based Knowledge Management), Proceedings, Luzern, 2.-4.
April, 2003},
series = {{CEUR} Workshop Proceedings},
volume = {68},
publisher = {CEUR-WS.org},
year = {2003},
url = {https://ceur-ws.org/Vol-68/WOW2003\_Stojanovic.pdf},
timestamp = {Fri, 10 Mar 2023 16:22:30 +0100},
biburl = {https://dblp.org/rec/conf/wow/Stojanovic03.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/coopis/StojanovicS02,
author = {Nenad Stojanovic and
Ljiljana Stojanovic},
editor = {Robert Meersman and
Zahir Tari},
title = {Usage-Oriented Evolution of Ontology-Based Knowledge Management Systems},
booktitle = {On the Move to Meaningful Internet Systems, 2002 - DOA/CoopIS/ODBASE
2002 Confederated International Conferences DOA, CoopIS and {ODBASE}
2002 Irvine, California, USA, October 30 - November 1, 2002, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2519},
pages = {1186--1204},
publisher = {Springer},
year = {2002},
url = {https://doi.org/10.1007/3-540-36124-3\_75},
doi = {10.1007/3-540-36124-3\_75},
timestamp = {Thu, 14 Oct 2021 10:25:23 +0200},
biburl = {https://dblp.org/rec/conf/coopis/StojanovicS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecis/StojanovicSH02,
author = {Nenad Stojanovic and
Ljiljana Stojanovic and
Siegfried Handschuh},
editor = {Stanislaw Wrycza},
title = {Evolution in the ontology-based knowledge management systems},
booktitle = {Proceedings of the 10th European Conference on Information Systems,
Information Systems and the Future of the Digital Economy, {ECIS}
2002, Gdansk, Poland, June 6-8, 2002},
pages = {840--850},
year = {2002},
url = {http://aisel.aisnet.org/ecis2002/123},
timestamp = {Mon, 05 Dec 2016 15:14:00 +0100},
biburl = {https://dblp.org/rec/conf/ecis/StojanovicSH02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecweb/BozsakEHHMMOSSSSSSSTVZ02,
author = {Erol Bozsak and
Marc Ehrig and
Siegfried Handschuh and
Andreas Hotho and
Alexander Maedche and
Boris Motik and
Daniel Oberle and
Christoph Schmitz and
Steffen Staab and
Ljiljana Stojanovic and
Nenad Stojanovic and
Rudi Studer and
Gerd Stumme and
York Sure and
Julien Tane and
Raphael Volz and
Valentin Zacharias},
editor = {Kurt Bauknecht and
A Min Tjoa and
Gerald Quirchmayr},
title = {{KAON} - Towards a Large Scale Semantic Web},
booktitle = {E-Commerce and Web Technologies, Third International Conference, EC-Web
2002, Aix-en-Provence, France, September 2-6, 2002, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2455},
pages = {304--313},
publisher = {Springer},
year = {2002},
url = {https://doi.org/10.1007/3-540-45705-4\_32},
doi = {10.1007/3-540-45705-4\_32},
timestamp = {Sun, 12 Nov 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/ecweb/BozsakEHHMMOSSSSSSSTVZ02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ekaw/StojanovicMMS02,
author = {Ljiljana Stojanovic and
Alexander Maedche and
Boris Motik and
Nenad Stojanovic},
editor = {Asunci{\'{o}}n G{\'{o}}mez{-}P{\'{e}}rez and
V. Richard Benjamins},
title = {User-Driven Ontology Evolution Management},
booktitle = {Knowledge Engineering and Knowledge Management. Ontologies and the
Semantic Web, 13th International Conference, {EKAW} 2002, Siguenza,
Spain, October 1-4, 2002, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2473},
pages = {285--300},
publisher = {Springer},
year = {2002},
url = {https://doi.org/10.1007/3-540-45810-7\_27},
doi = {10.1007/3-540-45810-7\_27},
timestamp = {Tue, 14 May 2019 10:00:39 +0200},
biburl = {https://dblp.org/rec/conf/ekaw/StojanovicMMS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/em/StojanovicSH02,
author = {Ljiljana Stojanovic and
Nenad Stojanovic and
Siegfried Handschuh},
editor = {Mirjam Minor and
Steffen Staab},
title = {Evolution of the Metadata in the Ontology-based Knowledge Management
Systems},
booktitle = {1st German Workshop on Experience Management: Sharing Experiences
about the Sharing of Experience, Berlin, Germany, March 7-8, 2002,
Proceedings},
series = {{LNI}},
volume = {{P-10}},
pages = {65--77},
publisher = {{GI}},
year = {2002},
url = {https://dl.gi.de/handle/20.500.12116/30909},
timestamp = {Tue, 04 Jul 2023 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/em/StojanovicSH02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/er/StojanovicSM02,
author = {Ljiljana Stojanovic and
Nenad Stojanovic and
Alexander Maedche},
editor = {Marcela Genero and
Fabio Grandi and
Willem{-}Jan van den Heuvel and
John Krogstie and
Kalle Lyytinen and
Heinrich C. Mayr and
Jim Nelson and
Antoni Oliv{\'{e}} and
Mario Piattini and
Geert Poels and
John F. Roddick and
Keng Siau and
Masatoshi Yoshikawa and
Eric S. K. Yu},
title = {Change Discovery in Ontology-Based Knowledge Management Systems},
booktitle = {Advanced Conceptual Modeling Techniques, {ER} 2002 Workshops: ECDM,
MobIMod, IWCMQ, and eCOMO, Tampere, Finland, October 7-11, 2002, Revised
Papers},
series = {Lecture Notes in Computer Science},
volume = {2784},
pages = {51--62},
publisher = {Springer},
year = {2002},
url = {https://doi.org/10.1007/978-3-540-45275-1\_5},
doi = {10.1007/978-3-540-45275-1\_5},
timestamp = {Tue, 30 Jun 2020 07:48:06 +0200},
biburl = {https://dblp.org/rec/conf/er/StojanovicSM02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/flairs/SollazzoHSFS02,
author = {Tanja Sollazzo and
Siegfried Handschuh and
Steffen Staab and
Martin R. Frank and
Nenad Stojanovic},
editor = {Susan M. Haller and
Gene Simmons},
title = {Semantic Web Service Architecture -- Evolving Web Service Standards
toward the Semantic Web},
booktitle = {Proceedings of the Fifteenth International Florida Artificial Intelligence
Research Society Conference, May 14-16, 2002, Pensacola Beach, Florida,
{USA}},
pages = {425--429},
publisher = {{AAAI} Press},
year = {2002},
url = {http://www.aaai.org/Library/FLAIRS/2002/flairs02-083.php},
timestamp = {Wed, 26 Oct 2022 08:35:33 +0200},
biburl = {https://dblp.org/rec/conf/flairs/SollazzoHSFS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/flairs/StojanovicS02,
author = {Nenad Stojanovic and
Ljiljana Stojanovic},
editor = {Susan M. Haller and
Gene Simmons},
title = {Searching for the Knowledge in the Semantic Web},
booktitle = {Proceedings of the Fifteenth International Florida Artificial Intelligence
Research Society Conference, May 14-16, 2002, Pensacola Beach, Florida,
{USA}},
pages = {435--439},
publisher = {{AAAI} Press},
year = {2002},
url = {http://www.aaai.org/Library/FLAIRS/2002/flairs02-085.php},
timestamp = {Wed, 26 Oct 2022 01:00:00 +0200},
biburl = {https://dblp.org/rec/conf/flairs/StojanovicS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip12/StojanovicSV02,
author = {Nenad Stojanovic and
Ljiljana Stojanovic and
Raphael Volz},
editor = {Mark A. Musen and
Bernd Neumann and
Rudi Studer},
title = {A Reverse Engineering Approach for Migrating Data-intensive Web Sites
to the Semantic Web},
booktitle = {Intelligent Information Processing, {IFIP} 17\({}^{\mbox{th}}\) World
Computer Congress - {TC12} Stream on Intelligent Information Processing,
August 25-30, 2002, Montr{\'{e}}al, Qu{\'{e}}bec, Canada},
series = {{IFIP} Conference Proceedings},
volume = {221},
pages = {141--154},
publisher = {Kluwer},
year = {2002},
timestamp = {Fri, 06 Sep 2002 09:25:38 +0200},
biburl = {https://dblp.org/rec/conf/ifip12/StojanovicSV02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ifip5-12/HeisigCGKKS02,
author = {Peter Heisig and
Martine Callot and
Jan Goossenaerts and
Kurt Kosanke and
John Krogstie and
Nenad Stojanovic},
editor = {Kurt Kosanke and
Roland Jochem and
James G. Nell and
{\'{A}}ngel Ortiz Bas},
title = {Anchoring Knowledge in Business-Process Models to support Interoperability
of Virtual Organizations},
booktitle = {Enterprise Inter- and Intra-Organizational Integration: Building International
Consensus, {IFIP} {TC5/WG5.12} International Conference on Enterprise
Integration and Modeling Technique (ICEIMT'02), April 24-26, 2002,
Valencia, Spain},
series = {{IFIP} Conference Proceedings},
volume = {236},
pages = {51--60},
publisher = {Kluwer},
year = {2002},
timestamp = {Thu, 28 Feb 2019 15:59:22 +0100},
biburl = {https://dblp.org/rec/conf/ifip5-12/HeisigCGKKS02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pakm/StojanovicSG02,
author = {Nenad Stojanovic and
Ljiljana Stojanovic and
Jorge Gonzalez},
editor = {Dimitris Karagiannis and
Ulrich Reimer},
title = {More Efficient Searching in a Knowledge Portal - An Approach Based
on the Analysis of Users' Queries},
booktitle = {Practical Aspects of Knowledge Management, 4th International Conference,
{PAKM} 2002, Vienna, Austria, December 2-3, 2002, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2569},
pages = {513--524},
publisher = {Springer},
year = {2002},
url = {https://doi.org/10.1007/3-540-36277-0\_45},
doi = {10.1007/3-540-36277-0\_45},
timestamp = {Tue, 14 May 2019 10:00:43 +0200},
biburl = {https://dblp.org/rec/conf/pakm/StojanovicSG02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sac/StojanovicSV02,
author = {Ljiljana Stojanovic and
Nenad Stojanovic and
Raphael Volz},
editor = {Gary B. Lamont and
Hisham Haddad and
George A. Papadopoulos and
Brajendra Panda},
title = {Migrating data-intensive web sites into the Semantic Web},
booktitle = {Proceedings of the 2002 {ACM} Symposium on Applied Computing (SAC),
March 10-14, 2002, Madrid, Spain},
pages = {1100--1107},
publisher = {{ACM}},
year = {2002},
url = {https://doi.org/10.1145/508791.509008},
doi = {10.1145/508791.509008},
timestamp = {Tue, 06 Nov 2018 11:06:47 +0100},
biburl = {https://dblp.org/rec/conf/sac/StojanovicSV02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wise/StojanovicSG02,
author = {Nenad Stojanovic and
Ljiljana Stojanovic and
Jorge Gonzalez},
editor = {Bo Huang and
Tok Wang Ling and
Mukesh K. Mohania and
Wee Keong Ng and
Ji{-}Rong Wen and
Shyam K. Gupta},
title = {On Enhancing Searching for Information in an Information Portal by
Tracking Users' Activities},
booktitle = {3rd International Conference on Web Information Systems Engineering
Workshops, {WISE} 2002 Workshops, Singapore, December 11, 2002, Proceedings},
pages = {246--256},
publisher = {{IEEE} Computer Society},
year = {2002},
url = {https://doi.org/10.1109/WISEW.2002.1177869},
doi = {10.1109/WISEW.2002.1177869},
timestamp = {Fri, 24 Mar 2023 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/wise/StojanovicSG02.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bncod/MaedcheSSSS01,
author = {Alexander Maedche and
Steffen Staab and
Nenad Stojanovic and
Rudi Studer and
York Sure},
editor = {Brian J. Read},
title = {{SEAL} - {A} Framework for Developing SEmantic Web PortALs},
booktitle = {Advances in Databases, 18th British National Conference on Databases,
{BNCOD} 18, Chilton, UK, July 9-11, 2001, Proceedings},
series = {Lecture Notes in Computer Science},
volume = {2097},
pages = {1--22},
publisher = {Springer},
year = {2001},
url = {https://doi.org/10.1007/3-540-45754-2\_1},
doi = {10.1007/3-540-45754-2\_1},
timestamp = {Tue, 14 May 2019 10:00:50 +0200},
biburl = {https://dblp.org/rec/conf/bncod/MaedcheSSSS01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/kcap/StojanovicMSSS01,
author = {Nenad Stojanovic and
Alexander Maedche and
Steffen Staab and
Rudi Studer and
York Sure},
title = {{SEAL:} a framework for developing SEmantic PortALs},
booktitle = {Proceedings of the First International Conference on Knowledge Capture
{(K-CAP} 2001), October 21-23, 2001, Victoria, BC, Canada},
pages = {155--162},
publisher = {{ACM}},
year = {2001},
url = {https://doi.org/10.1145/500737.500762},
doi = {10.1145/500737.500762},
timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
biburl = {https://dblp.org/rec/conf/kcap/StojanovicMSSS01.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ki/StojanovicSMS97,
author = {Nenad Stojanovic and
Ljiljana Stoiljkovic and
Dejan Milenovic and
V. Stoiljkovic},
editor = {Gerhard Brewka and
Christopher Habel and
Bernhard Nebel},
title = {Expert System in Additional Finishing},
booktitle = {{KI-97:} Advances in Artificial Intelligence, 21st Annual German Conference
on Artificial Intelligence, Freiburg, Germany, September 9-12, 1997,
Proceedings},
series = {Lecture Notes in Computer Science},
volume = {1303},
pages = {401--404},
publisher = {Springer},
year = {1997},
url = {https://doi.org/10.1007/3540634932\_37},
doi = {10.1007/3540634932\_37},
timestamp = {Tue, 14 May 2019 10:00:49 +0200},
biburl = {https://dblp.org/rec/conf/ki/StojanovicSMS97.bib},
bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of 
manage site settings
To protect your privacy, all features that rely on external API calls from your browser are turned off by default. You need to opt-in for them to become active. All settings here will be stored as cookies with your web browser. For more information see our F.A.Q.
last updated on 2024-05-05 02:36 CEST by the dblp team
all metadata released as open data under CC0 1.0 license
see also: Terms of Use | Privacy Policy | Imprint
dblp was originally created in 1993 at:
since 2018, dblp has been operated and maintained by:
the dblp computer science bibliography is funded and supported by:
