BibTeX records: Stephen E. Robertson

download as .bib file

@article{DBLP:journals/annals/Robertson19,
  author    = {Stephen Robertson},
  title     = {A Brief History of Search Results Ranking},
  journal   = {{IEEE} Annals of the History of Computing},
  volume    = {41},
  number    = {2},
  pages     = {22--28},
  year      = {2019},
  url       = {https://doi.org/10.1109/MAHC.2019.2897559},
  doi       = {10.1109/MAHC.2019.2897559},
  timestamp = {Thu, 06 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/annals/Robertson19.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/db/CraswellR18,
  author    = {Nick Craswell and
               Stephen Robertson},
  editor    = {Ling Liu and
               M. Tamer {\"{O}}zsu},
  title     = {Average Precision at n},
  booktitle = {Encyclopedia of Database Systems, Second Edition},
  publisher = {Springer},
  year      = {2018},
  url       = {https://doi.org/10.1007/978-1-4614-8265-9\_487},
  doi       = {10.1007/978-1-4614-8265-9\_487},
  timestamp = {Thu, 14 Feb 2019 09:43:36 +0100},
  biburl    = {https://dblp.org/rec/reference/db/CraswellR18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/db/Roelleke0R18,
  author    = {Thomas Roelleke and
               Jun Wang and
               Stephen Robertson},
  editor    = {Ling Liu and
               M. Tamer {\"{O}}zsu},
  title     = {Probabilistic Retrieval Models and Binary Independence Retrieval {(BIR)}
               Model},
  booktitle = {Encyclopedia of Database Systems, Second Edition},
  publisher = {Springer},
  year      = {2018},
  url       = {https://doi.org/10.1007/978-1-4614-8265-9\_919},
  doi       = {10.1007/978-1-4614-8265-9\_919},
  timestamp = {Wed, 18 Dec 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/reference/db/Roelleke0R18.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/Robertson17,
  author    = {Stephen Robertson},
  editor    = {Noriko Kando and
               Tetsuya Sakai and
               Hideo Joho and
               Hang Li and
               Arjen P. de Vries and
               Ryen W. White},
  title     = {Forward to the Past: Notes towards a Pre-history of Web Search},
  booktitle = {Proceedings of the 40th International {ACM} {SIGIR} Conference on
               Research and Development in Information Retrieval, Shinjuku, Tokyo,
               Japan, August 7-11, 2017},
  pages     = {1},
  publisher = {{ACM}},
  year      = {2017},
  url       = {https://doi.org/10.1145/3077136.3080643},
  doi       = {10.1145/3077136.3080643},
  timestamp = {Tue, 06 Nov 2018 11:07:22 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/Robertson17.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ir/AlyDR14,
  author    = {Robin Aly and
               Thomas Demeester and
               Stephen Robertson},
  title     = {Probabilistic models in {IR} and their relationships},
  journal   = {Inf. Retr.},
  volume    = {17},
  number    = {2},
  pages     = {177--201},
  year      = {2014},
  url       = {https://doi.org/10.1007/s10791-013-9226-3},
  doi       = {10.1007/s10791-013-9226-3},
  timestamp = {Wed, 14 Jun 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ir/AlyDR14.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tois/PaikPPR13,
  author    = {Jiaul H. Paik and
               Swapan K. Parui and
               Dipasree Pal and
               Stephen E. Robertson},
  title     = {Effective and Robust Query-Based Stemming},
  journal   = {{ACM} Trans. Inf. Syst.},
  volume    = {31},
  number    = {4},
  pages     = {18:1--18:29},
  year      = {2013},
  url       = {https://doi.org/10.1145/2536736.2536738},
  doi       = {10.1145/2536736.2536738},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/tois/PaikPPR13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ictir/BertoMR13,
  author    = {Andrea Berto and
               Stefano Mizzaro and
               Stephen Robertson},
  editor    = {Oren Kurland and
               Donald Metzler and
               Christina Lioma and
               Birger Larsen and
               Peter Ingwersen},
  title     = {On Using Fewer Topics in Information Retrieval Evaluations},
  booktitle = {International Conference on the Theory of Information Retrieval, {ICTIR}
               '13, Copenhagen, Denmark, September 29 - October 02, 2013},
  pages     = {9},
  publisher = {{ACM}},
  year      = {2013},
  url       = {https://doi.org/10.1145/2499178.2499184},
  doi       = {10.1145/2499178.2499184},
  timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/conf/ictir/BertoMR13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ictir/RobertsonKY13,
  author    = {Stephen Robertson and
               Evangelos Kanoulas and
               Emine Yilmaz},
  editor    = {Oren Kurland and
               Donald Metzler and
               Christina Lioma and
               Birger Larsen and
               Peter Ingwersen},
  title     = {Modelling Score Distributions Without Actual Scores},
  booktitle = {International Conference on the Theory of Information Retrieval, {ICTIR}
               '13, Copenhagen, Denmark, September 29 - October 02, 2013},
  pages     = {20},
  publisher = {{ACM}},
  year      = {2013},
  url       = {https://doi.org/10.1145/2499178.2499181},
  doi       = {10.1145/2499178.2499181},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/ictir/RobertsonKY13.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/www/GorlaLR013,
  author    = {Jagadeesh Gorla and
               Neal Lathia and
               Stephen Robertson and
               Jun Wang},
  editor    = {Daniel Schwabe and
               Virg{\'{\i}}lio A. F. Almeida and
               Hartmut Glaser and
               Ricardo Baeza{-}Yates and
               Sue B. Moon},
  title     = {Probabilistic group recommendation via information matching},
  booktitle = {22nd International World Wide Web Conference, {WWW} '13, Rio de Janeiro,
               Brazil, May 13-17, 2013},
  pages     = {495--504},
  publisher = {International World Wide Web Conferences Steering Committee / {ACM}},
  year      = {2013},
  url       = {https://doi.org/10.1145/2488388.2488432},
  doi       = {10.1145/2488388.2488432},
  timestamp = {Sun, 22 Sep 2019 18:15:38 +0200},
  biburl    = {https://dblp.org/rec/conf/www/GorlaLR013.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/VechtomovaR12,
  author    = {Olga Vechtomova and
               Stephen E. Robertson},
  title     = {A domain-independent approach to finding related entities},
  journal   = {Inf. Process. Manage.},
  volume    = {48},
  number    = {4},
  pages     = {654--670},
  year      = {2012},
  url       = {https://doi.org/10.1016/j.ipm.2011.12.003},
  doi       = {10.1016/j.ipm.2011.12.003},
  timestamp = {Thu, 18 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ipm/VechtomovaR12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecir/Robertson12,
  author    = {Stephen Robertson},
  editor    = {Ricardo Baeza{-}Yates and
               Arjen P. de Vries and
               Hugo Zaragoza and
               Berkant Barla Cambazoglu and
               Vanessa Murdock and
               Ronny Lempel and
               Fabrizio Silvestri},
  title     = {On Smoothing Average Precision},
  booktitle = {Advances in Information Retrieval - 34th European Conference on {IR}
               Research, {ECIR} 2012, Barcelona, Spain, April 1-5, 2012. Proceedings},
  series    = {Lecture Notes in Computer Science},
  volume    = {7224},
  pages     = {158--169},
  publisher = {Springer},
  year      = {2012},
  url       = {https://doi.org/10.1007/978-3-642-28997-2\_14},
  doi       = {10.1007/978-3-642-28997-2\_14},
  timestamp = {Sun, 22 Sep 2019 18:15:38 +0200},
  biburl    = {https://dblp.org/rec/conf/ecir/Robertson12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/RobertsonK12,
  author    = {Stephen E. Robertson and
               Evangelos Kanoulas},
  editor    = {William R. Hersh and
               Jamie Callan and
               Yoelle Maarek and
               Mark Sanderson},
  title     = {On per-topic variance in {IR} evaluation},
  booktitle = {The 35th International {ACM} {SIGIR} conference on research and development
               in Information Retrieval, {SIGIR} '12, Portland, OR, USA, August 12-16,
               2012},
  pages     = {891--900},
  publisher = {{ACM}},
  year      = {2012},
  url       = {https://doi.org/10.1145/2348283.2348402},
  doi       = {10.1145/2348283.2348402},
  timestamp = {Wed, 14 Nov 2018 10:58:10 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/RobertsonK12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/RobertsonK12a,
  author    = {Stephen E. Robertson and
               Evangelos Kanoulas},
  editor    = {William R. Hersh and
               Jamie Callan and
               Yoelle Maarek and
               Mark Sanderson},
  title     = {On real-time ad-hoc retrieval evaluation},
  booktitle = {The 35th International {ACM} {SIGIR} conference on research and development
               in Information Retrieval, {SIGIR} '12, Portland, OR, USA, August 12-16,
               2012},
  pages     = {1119--1120},
  publisher = {{ACM}},
  year      = {2012},
  url       = {https://doi.org/10.1145/2348283.2348498},
  doi       = {10.1145/2348283.2348498},
  timestamp = {Wed, 14 Nov 2018 10:58:10 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/RobertsonK12a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/daglib/p/Robertson12,
  author    = {Stephen Robertson},
  editor    = {Richard Harper},
  title     = {The Web, the Home and the Search Engine},
  booktitle = {The Connected Home - The Future of Domestic Life},
  pages     = {79--91},
  publisher = {Springer},
  year      = {2012},
  url       = {https://doi.org/10.1007/978-0-85729-476-0\_5},
  doi       = {10.1007/978-0-85729-476-0\_5},
  timestamp = {Tue, 16 May 2017 14:01:33 +0200},
  biburl    = {https://dblp.org/rec/books/daglib/p/Robertson12.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1205-5569,
  author    = {Jagadeesh Gorla and
               Stephen Robertson and
               Jun Wang and
               Tamas Jambor},
  title     = {A Theory of Information Matching},
  journal   = {CoRR},
  volume    = {abs/1205.5569},
  year      = {2012},
  url       = {http://arxiv.org/abs/1205.5569},
  archivePrefix = {arXiv},
  eprint    = {1205.5569},
  timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/corr/abs-1205-5569.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ir/AzzopardiSKRRSY11,
  author    = {Leif Azzopardi and
               Dawei Song and
               Gabriella Kazai and
               Stephen Robertson and
               Stefan M. R{\"{u}}ger and
               Milad Shokouhi and
               Emine Yilmaz},
  title     = {Introduction to special issue on the second international conference
               on the theory of information retrieval},
  journal   = {Inf. Retr.},
  volume    = {14},
  number    = {1},
  pages     = {1--4},
  year      = {2011},
  url       = {https://doi.org/10.1007/s10791-010-9142-8},
  doi       = {10.1007/s10791-010-9142-8},
  timestamp = {Tue, 24 Oct 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ir/AzzopardiSKRRSY11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ir/ArampatzisR11,
  author    = {Avi Arampatzis and
               Stephen Robertson},
  title     = {Modeling score distributions in information retrieval},
  journal   = {Inf. Retr.},
  volume    = {14},
  number    = {1},
  pages     = {26--46},
  year      = {2011},
  url       = {https://doi.org/10.1007/s10791-010-9145-5},
  doi       = {10.1007/s10791-010-9145-5},
  timestamp = {Sat, 16 Sep 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ir/ArampatzisR11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecir/Robertson11,
  author    = {Stephen Robertson},
  editor    = {Paul D. Clough and
               Colum Foley and
               Cathal Gurrin and
               Gareth J. F. Jones and
               Wessel Kraaij and
               Hyowon Lee and
               Vanessa Murdock},
  title     = {On the Contributions of Topics to System Evaluation},
  booktitle = {Advances in Information Retrieval - 33rd European Conference on {IR}
               Research, {ECIR} 2011, Dublin, Ireland, April 18-21, 2011. Proceedings},
  series    = {Lecture Notes in Computer Science},
  volume    = {6611},
  pages     = {129--140},
  publisher = {Springer},
  year      = {2011},
  url       = {https://doi.org/10.1007/978-3-642-20161-5\_14},
  doi       = {10.1007/978-3-642-20161-5\_14},
  timestamp = {Tue, 14 May 2019 10:00:37 +0200},
  biburl    = {https://dblp.org/rec/conf/ecir/Robertson11.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1106-2946,
  author    = {Jagadeesh Gorla and
               Stephen Robertson and
               Jun Wang},
  title     = {A Unified Relevance Retrieval Model by Eliteness Hypothesis},
  journal   = {CoRR},
  volume    = {abs/1106.2946},
  year      = {2011},
  url       = {http://arxiv.org/abs/1106.2946},
  archivePrefix = {arXiv},
  eprint    = {1106.2946},
  timestamp = {Mon, 13 Aug 2018 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/corr/abs-1106-2946.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ir/YilmazR10,
  author    = {Emine Yilmaz and
               Stephen Robertson},
  title     = {On the choice of effectiveness measures for learning to rank},
  journal   = {Inf. Retr.},
  volume    = {13},
  number    = {3},
  pages     = {271--290},
  year      = {2010},
  url       = {https://doi.org/10.1007/s10791-009-9116-x},
  doi       = {10.1007/s10791-009-9116-x},
  timestamp = {Sat, 27 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ir/YilmazR10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/YilmazSCR10,
  author    = {Emine Yilmaz and
               Milad Shokouhi and
               Nick Craswell and
               Stephen Robertson},
  editor    = {Jimmy Huang and
               Nick Koudas and
               Gareth J. F. Jones and
               Xindong Wu and
               Kevyn Collins{-}Thompson and
               Aijun An},
  title     = {Expected browsing utility for web search evaluation},
  booktitle = {Proceedings of the 19th {ACM} Conference on Information and Knowledge
               Management, {CIKM} 2010, Toronto, Ontario, Canada, October 26-30,
               2010},
  pages     = {1561--1564},
  publisher = {{ACM}},
  year      = {2010},
  url       = {https://doi.org/10.1145/1871437.1871672},
  doi       = {10.1145/1871437.1871672},
  timestamp = {Mon, 07 Jan 2019 17:17:42 +0100},
  biburl    = {https://dblp.org/rec/conf/cikm/YilmazSCR10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ntcir/SakaiCSRDL10,
  author    = {Tetsuya Sakai and
               Nick Craswell and
               Ruihua Song and
               Stephen Robertson and
               Zhicheng Dou and
               Chin{-}Yew Lin},
  editor    = {Tetsuya Sakai and
               Mark Sanderson and
               William Webber},
  title     = {Simple Evaluation Metrics for Diversified Search Results},
  booktitle = {Proceedings of the 3rd International Workshop on Evaluating Information
               Access, {EVIA} 2010, National Center of Sciences, Tokyo, Japan, June
               15, 2010},
  pages     = {42--50},
  publisher = {National Institute of Informatics {(NII)}},
  year      = {2010},
  url       = {http://research.nii.ac.jp/ntcir/workshop/OnlineProceedings8/EVIA/07-EVIA2010-SakaiT.pdf},
  timestamp = {Fri, 22 May 2015 14:26:22 +0200},
  biburl    = {https://dblp.org/rec/conf/ntcir/SakaiCSRDL10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/RobertsonKY10,
  author    = {Stephen E. Robertson and
               Evangelos Kanoulas and
               Emine Yilmaz},
  editor    = {Fabio Crestani and
               St{\'{e}}phane Marchand{-}Maillet and
               Hsin{-}Hsi Chen and
               Efthimis N. Efthimiadis and
               Jacques Savoy},
  title     = {Extending average precision to graded relevance judgments},
  booktitle = {Proceeding of the 33rd International {ACM} {SIGIR} Conference on Research
               and Development in Information Retrieval, {SIGIR} 2010, Geneva, Switzerland,
               July 19-23, 2010},
  pages     = {603--610},
  publisher = {{ACM}},
  year      = {2010},
  url       = {https://doi.org/10.1145/1835449.1835550},
  doi       = {10.1145/1835449.1835550},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/RobertsonKY10.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ftir/RobertsonZ09,
  author    = {Stephen E. Robertson and
               Hugo Zaragoza},
  title     = {The Probabilistic Relevance Framework: {BM25} and Beyond},
  journal   = {Foundations and Trends in Information Retrieval},
  volume    = {3},
  number    = {4},
  pages     = {333--389},
  year      = {2009},
  url       = {https://doi.org/10.1561/1500000019},
  doi       = {10.1561/1500000019},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/ftir/RobertsonZ09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tois/GuiverMR09,
  author    = {John Guiver and
               Stefano Mizzaro and
               Stephen Robertson},
  title     = {A few good topics: Experiments in topic set reduction for retrieval
               evaluation},
  journal   = {{ACM} Trans. Inf. Syst.},
  volume    = {27},
  number    = {4},
  pages     = {21:1--21:26},
  year      = {2009},
  url       = {https://doi.org/10.1145/1629096.1629099},
  doi       = {10.1145/1629096.1629099},
  timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/tois/GuiverMR09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/chi/RobertsonVW09,
  author    = {Stephen Robertson and
               Milan Vojnovic and
               Ingmar Weber},
  editor    = {Dan R. Olsen Jr. and
               Richard B. Arthur and
               Ken Hinckley and
               Meredith Ringel Morris and
               Scott E. Hudson and
               Saul Greenberg},
  title     = {Rethinking the {ESP} game},
  booktitle = {Proceedings of the 27th International Conference on Human Factors
               in Computing Systems, {CHI} 2009, Extended Abstracts Volume, Boston,
               MA, USA, April 4-9, 2009},
  pages     = {3937--3942},
  publisher = {{ACM}},
  year      = {2009},
  url       = {https://doi.org/10.1145/1520340.1520597},
  doi       = {10.1145/1520340.1520597},
  timestamp = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/conf/chi/RobertsonVW09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ictir/ArampatzisRK09,
  author    = {Avi Arampatzis and
               Stephen Robertson and
               Jaap Kamps},
  editor    = {Leif Azzopardi and
               Gabriella Kazai and
               Stephen E. Robertson and
               Stefan M. R{\"{u}}ger and
               Milad Shokouhi and
               Dawei Song and
               Emine Yilmaz},
  title     = {Score Distributions in Information Retrieval},
  booktitle = {Advances in Information Retrieval Theory, Second International Conference
               on the Theory of Information Retrieval, {ICTIR} 2009, Cambridge, UK,
               September 10-12, 2009, Proceedings},
  series    = {Lecture Notes in Computer Science},
  volume    = {5766},
  pages     = {139--151},
  publisher = {Springer},
  year      = {2009},
  url       = {https://doi.org/10.1007/978-3-642-04417-5\_13},
  doi       = {10.1007/978-3-642-04417-5\_13},
  timestamp = {Tue, 14 May 2019 10:00:40 +0200},
  biburl    = {https://dblp.org/rec/conf/ictir/ArampatzisRK09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/ArampatzisKR09,
  author    = {Avi Arampatzis and
               Jaap Kamps and
               Stephen Robertson},
  editor    = {James Allan and
               Javed A. Aslam and
               Mark Sanderson and
               ChengXiang Zhai and
               Justin Zobel},
  title     = {Where to stop reading a ranked list?: threshold optimization using
               truncated score distributions},
  booktitle = {Proceedings of the 32nd Annual International {ACM} {SIGIR} Conference
               on Research and Development in Information Retrieval, {SIGIR} 2009,
               Boston, MA, USA, July 19-23, 2009},
  pages     = {524--531},
  publisher = {{ACM}},
  year      = {2009},
  url       = {https://doi.org/10.1145/1571941.1572031},
  doi       = {10.1145/1571941.1572031},
  timestamp = {Wed, 14 Nov 2018 10:58:10 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/ArampatzisKR09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/YilmazR09,
  author    = {Emine Yilmaz and
               Stephen Robertson},
  editor    = {James Allan and
               Javed A. Aslam and
               Mark Sanderson and
               ChengXiang Zhai and
               Justin Zobel},
  title     = {Deep versus shallow judgments in learning to rank},
  booktitle = {Proceedings of the 32nd Annual International {ACM} {SIGIR} Conference
               on Research and Development in Information Retrieval, {SIGIR} 2009,
               Boston, MA, USA, July 19-23, 2009},
  pages     = {662--663},
  publisher = {{ACM}},
  year      = {2009},
  url       = {https://doi.org/10.1145/1571941.1572066},
  doi       = {10.1145/1571941.1572066},
  timestamp = {Wed, 14 Nov 2018 10:58:10 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/YilmazR09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/YilmazSCR09,
  author    = {Emine Yilmaz and
               Milad Shokouhi and
               Nick Craswell and
               Stephen Robertson},
  editor    = {Nicholas J. Belkin and
               Ralf Bierig and
               Georg Buscher and
               Ludger van Elst and
               Jacek Gwizdka and
               Joemon M. Jose and
               Jaime Teevan},
  title     = {Incorporating User Behavior Information in {IR} Evaluation},
  booktitle = {Proceedings of the Workshop on Understanding the User - Logging and
               Interpreting User Interactions in Information Search and Retrieval
               {(} {UIIR-2009} ), Boston, MA, USA, July 23, 2009. Workshop in Conjunction
               with {SIGIR-2009} , Boston, MA, USA, July 19-23 2009},
  series    = {{CEUR} Workshop Proceedings},
  volume    = {512},
  publisher = {CEUR-WS.org},
  year      = {2009},
  url       = {http://ceur-ws.org/Vol-512/paper03.pdf},
  timestamp = {Tue, 28 May 2019 16:23:39 +0200},
  biburl    = {https://dblp.org/rec/conf/sigir/YilmazSCR09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/CraswellFNRY09,
  author    = {Nick Craswell and
               Dennis Fetterly and
               Marc Najork and
               Stephen Robertson and
               Emine Yilmaz},
  editor    = {Ellen M. Voorhees and
               Lori P. Buckland},
  title     = {Microsoft Research at {TREC} 2009: Web and Relevance Feedback Track},
  booktitle = {Proceedings of The Eighteenth Text REtrieval Conference, {TREC} 2009,
               Gaithersburg, Maryland, USA, November 17-20, 2009},
  volume    = {Special Publication 500-278},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {2009},
  url       = {http://trec.nist.gov/pubs/trec18/papers/microsoft.WEB.RF.pdf},
  timestamp = {Tue, 07 Apr 2015 13:04:04 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/CraswellFNRY09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/ictir/2009,
  editor    = {Leif Azzopardi and
               Gabriella Kazai and
               Stephen E. Robertson and
               Stefan M. R{\"{u}}ger and
               Milad Shokouhi and
               Dawei Song and
               Emine Yilmaz},
  title     = {Advances in Information Retrieval Theory, Second International Conference
               on the Theory of Information Retrieval, {ICTIR} 2009, Cambridge, UK,
               September 10-12, 2009, Proceedings},
  series    = {Lecture Notes in Computer Science},
  volume    = {5766},
  publisher = {Springer},
  year      = {2009},
  url       = {https://doi.org/10.1007/978-3-642-04417-5},
  doi       = {10.1007/978-3-642-04417-5},
  isbn      = {978-3-642-04416-8},
  timestamp = {Tue, 14 May 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/conf/ictir/2009.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/db/CraswellR09,
  author    = {Nick Craswell and
               Stephen Robertson},
  editor    = {Ling Liu and
               M. Tamer {\"{O}}zsu},
  title     = {Average Precision at n},
  booktitle = {Encyclopedia of Database Systems},
  pages     = {193--194},
  publisher = {Springer {US}},
  year      = {2009},
  url       = {https://doi.org/10.1007/978-0-387-39940-9\_487},
  doi       = {10.1007/978-0-387-39940-9\_487},
  timestamp = {Sun, 02 Jun 2019 21:10:27 +0200},
  biburl    = {https://dblp.org/rec/reference/db/CraswellR09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:reference/db/RoellekeWR09,
  author    = {Thomas Roelleke and
               Jun Wang and
               Stephen Robertson},
  editor    = {Ling Liu and
               M. Tamer {\"{O}}zsu},
  title     = {Probabilistic Retrieval Models and Binary Independence Retrieval {(BIR)}
               Model},
  booktitle = {Encyclopedia of Database Systems},
  pages     = {2156--2160},
  publisher = {Springer {US}},
  year      = {2009},
  url       = {https://doi.org/10.1007/978-0-387-39940-9\_919},
  doi       = {10.1007/978-0-387-39940-9\_919},
  timestamp = {Wed, 18 Dec 2019 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/reference/db/RoellekeWR09.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ir/WangRVR08,
  author    = {Jun Wang and
               Stephen Robertson and
               Arjen P. de Vries and
               Marcel J. T. Reinders},
  title     = {Probabilistic relevance ranking for collaborative filtering},
  journal   = {Inf. Retr.},
  volume    = {11},
  number    = {6},
  pages     = {477--497},
  year      = {2008},
  url       = {https://doi.org/10.1007/s10791-008-9060-1},
  doi       = {10.1007/s10791-008-9060-1},
  timestamp = {Tue, 06 Jun 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ir/WangRVR08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/RobertsonT08,
  author    = {Stephen Robertson and
               John Tait},
  title     = {Karen Sp{\"{a}}rck Jones},
  journal   = {{JASIST}},
  volume    = {59},
  number    = {5},
  pages     = {852--854},
  year      = {2008},
  url       = {https://doi.org/10.1002/asi.20784},
  doi       = {10.1002/asi.20784},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/jasis/RobertsonT08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jis/Robertson08,
  author    = {Stephen Robertson},
  title     = {On the history of evaluation in {IR}},
  journal   = {J. Inf. Sci.},
  volume    = {34},
  number    = {4},
  pages     = {439--456},
  year      = {2008},
  url       = {https://doi.org/10.1177/0165551507086989},
  doi       = {10.1177/0165551507086989},
  timestamp = {Thu, 06 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/jis/Robertson08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/acl/CaoRN08,
  author    = {Guihong Cao and
               Stephen Robertson and
               Jian{-}Yun Nie},
  editor    = {Kathleen R. McKeown and
               Johanna D. Moore and
               Simone Teufel and
               James Allan and
               Sadaoki Furui},
  title     = {Selecting Query Term Alternations for Web Search by Exploiting Query
               Contexts},
  booktitle = {{ACL} 2008, Proceedings of the 46th Annual Meeting of the Association
               for Computational Linguistics, June 15-20, 2008, Columbus, Ohio, {USA}},
  pages     = {148--155},
  publisher = {The Association for Computer Linguistics},
  year      = {2008},
  url       = {https://www.aclweb.org/anthology/P08-1018/},
  timestamp = {Fri, 13 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/conf/acl/CaoRN08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/RitchieRT08,
  author    = {Anna Ritchie and
               Stephen Robertson and
               Simone Teufel},
  editor    = {James G. Shanahan and
               Sihem Amer{-}Yahia and
               Ioana Manolescu and
               Yi Zhang and
               David A. Evans and
               Aleksander Kolcz and
               Key{-}Sun Choi and
               Abdur Chowdhury},
  title     = {Comparing citation contexts for information retrieval},
  booktitle = {Proceedings of the 17th {ACM} Conference on Information and Knowledge
               Management, {CIKM} 2008, Napa Valley, California, USA, October 26-30,
               2008},
  pages     = {213--222},
  publisher = {{ACM}},
  year      = {2008},
  url       = {https://doi.org/10.1145/1458082.1458113},
  doi       = {10.1145/1458082.1458113},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/cikm/RitchieRT08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecir/RitchieTR08,
  author    = {Anna Ritchie and
               Simone Teufel and
               Stephen Robertson},
  editor    = {Craig Macdonald and
               Iadh Ounis and
               Vassilis Plachouras and
               Ian Ruthven and
               Ryen W. White},
  title     = {Using Terms from Citations for {IR:} Some First Results},
  booktitle = {Advances in Information Retrieval , 30th European Conference on {IR}
               Research, {ECIR} 2008, Glasgow, UK, March 30-April 3, 2008. Proceedings},
  series    = {Lecture Notes in Computer Science},
  volume    = {4956},
  pages     = {211--221},
  publisher = {Springer},
  year      = {2008},
  url       = {https://doi.org/10.1007/978-3-540-78646-7\_21},
  doi       = {10.1007/978-3-540-78646-7\_21},
  timestamp = {Tue, 14 May 2019 10:00:37 +0200},
  biburl    = {https://dblp.org/rec/conf/ecir/RitchieTR08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iiix/Robertson08,
  author    = {Stephen Robertson},
  editor    = {Mounia Lalmas and
               Anastasios Tombros and
               Pia Borlund and
               Jesper W. Schneider and
               Diane Kelly and
               John Feather and
               Arjen P. de Vries},
  title     = {The study of information retrieval: a long view},
  booktitle = {Proceedings of the 2nd International Conference on Information Interaction
               in Context, IIiX 2008, London, UK, October 14-17, 2008},
  series    = {{ACM} International Conference Proceeding Series},
  volume    = {348},
  pages     = {1--2},
  publisher = {{ACM}},
  year      = {2008},
  url       = {https://doi.org/10.1145/1414694.1414696},
  doi       = {10.1145/1414694.1414696},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/iiix/Robertson08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ntcir/SakaiR08,
  author    = {Tetsuya Sakai and
               Stephen Robertson},
  editor    = {Tetsuya Sakai and
               Mark Sanderson and
               Noriko Kando},
  title     = {Modelling {A} User Population for Designing Information Retrieval
               Metrics},
  booktitle = {Proceedings of the 2nd International Workshop on Evaluating Information
               Access, {EVIA} 2008, National Center of Sciences, Tokyo, Japan, December
               16, 2008},
  publisher = {National Institute of Informatics {(NII)}},
  year      = {2008},
  url       = {http://research.nii.ac.jp/ntcir/workshop/OnlineProceedings7/pdf/EVIA2008/07-EVIA2008-SakaiT.pdf},
  timestamp = {Mon, 25 May 2015 13:32:44 +0200},
  biburl    = {https://dblp.org/rec/conf/ntcir/SakaiR08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/CaoNGR08,
  author    = {Guihong Cao and
               Jian{-}Yun Nie and
               Jianfeng Gao and
               Stephen Robertson},
  editor    = {Sung{-}Hyon Myaeng and
               Douglas W. Oard and
               Fabrizio Sebastiani and
               Tat{-}Seng Chua and
               Mun{-}Kew Leong},
  title     = {Selecting good expansion terms for pseudo-relevance feedback},
  booktitle = {Proceedings of the 31st Annual International {ACM} {SIGIR} Conference
               on Research and Development in Information Retrieval, {SIGIR} 2008,
               Singapore, July 20-24, 2008},
  pages     = {243--250},
  publisher = {{ACM}},
  year      = {2008},
  url       = {https://doi.org/10.1145/1390334.1390377},
  doi       = {10.1145/1390334.1390377},
  timestamp = {Tue, 06 Nov 2018 11:07:25 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/CaoNGR08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/YilmazAR08,
  author    = {Emine Yilmaz and
               Javed A. Aslam and
               Stephen Robertson},
  editor    = {Sung{-}Hyon Myaeng and
               Douglas W. Oard and
               Fabrizio Sebastiani and
               Tat{-}Seng Chua and
               Mun{-}Kew Leong},
  title     = {A new rank correlation coefficient for information retrieval},
  booktitle = {Proceedings of the 31st Annual International {ACM} {SIGIR} Conference
               on Research and Development in Information Retrieval, {SIGIR} 2008,
               Singapore, July 20-24, 2008},
  pages     = {587--594},
  publisher = {{ACM}},
  year      = {2008},
  url       = {https://doi.org/10.1145/1390334.1390435},
  doi       = {10.1145/1390334.1390435},
  timestamp = {Tue, 06 Nov 2018 11:07:25 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/YilmazAR08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/Robertson08,
  author    = {Stephen Robertson},
  editor    = {Sung{-}Hyon Myaeng and
               Douglas W. Oard and
               Fabrizio Sebastiani and
               Tat{-}Seng Chua and
               Mun{-}Kew Leong},
  title     = {A new interpretation of average precision},
  booktitle = {Proceedings of the 31st Annual International {ACM} {SIGIR} Conference
               on Research and Development in Information Retrieval, {SIGIR} 2008,
               Singapore, July 20-24, 2008},
  pages     = {689--690},
  publisher = {{ACM}},
  year      = {2008},
  url       = {https://doi.org/10.1145/1390334.1390453},
  doi       = {10.1145/1390334.1390453},
  timestamp = {Tue, 06 Nov 2018 11:07:25 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/Robertson08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/wsdm/TaylorGRM08,
  author    = {Michael J. Taylor and
               John Guiver and
               Stephen Robertson and
               Tom Minka},
  editor    = {Marc Najork and
               Andrei Z. Broder and
               Soumen Chakrabarti},
  title     = {SoftRank: optimizing non-smooth rank metrics},
  booktitle = {Proceedings of the International Conference on Web Search and Web
               Data Mining, {WSDM} 2008, Palo Alto, California, USA, February 11-12,
               2008},
  pages     = {77--86},
  publisher = {{ACM}},
  year      = {2008},
  url       = {https://doi.org/10.1145/1341531.1341544},
  doi       = {10.1145/1341531.1341544},
  timestamp = {Tue, 21 May 2019 11:38:33 +0200},
  biburl    = {https://dblp.org/rec/conf/wsdm/TaylorGRM08.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aslib/MacFarlaneMR07,
  author    = {Andrew MacFarlane and
               Julie A. McCann and
               Stephen E. Robertson},
  title     = {Parallel methods for the update of partitioned inverted files},
  journal   = {Aslib Proceedings},
  volume    = {59},
  number    = {4/5},
  pages     = {367--396},
  year      = {2007},
  url       = {https://doi.org/10.1108/00012530710817582},
  doi       = {10.1108/00012530710817582},
  timestamp = {Sat, 27 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/aslib/MacFarlaneMR07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/RobertsonT07,
  author    = {Stephen Robertson and
               John Tait},
  title     = {In Memoriam: Karen Sp{\"{a}}rck Jones},
  journal   = {Inf. Process. Manage.},
  volume    = {43},
  number    = {6},
  pages     = {1441--1444},
  year      = {2007},
  url       = {https://doi.org/10.1016/j.ipm.2007.07.006},
  doi       = {10.1016/j.ipm.2007.07.006},
  timestamp = {Thu, 18 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ipm/RobertsonT07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ir/RobertsonZ07,
  author    = {Stephen Robertson and
               Hugo Zaragoza},
  title     = {On rank-based effectiveness measures and optimization},
  journal   = {Inf. Retr.},
  volume    = {10},
  number    = {3},
  pages     = {321--339},
  year      = {2007},
  url       = {https://doi.org/10.1007/s10791-007-9025-9},
  doi       = {10.1007/s10791-007-9025-9},
  timestamp = {Sat, 27 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ir/RobertsonZ07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jd/WillettR07,
  author    = {Peter Willett and
               Stephen Robertson},
  title     = {In memoriam: Karen Sp{\"{a}}rck Jones},
  journal   = {Journal of Documentation},
  volume    = {63},
  number    = {5},
  year      = {2007},
  url       = {https://doi.org/10.1108/jd.2007.27863eaa.001},
  doi       = {10.1108/jd.2007.27863eaa.001},
  timestamp = {Sat, 24 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/jd/WillettR07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jis/WillettR07,
  author    = {Peter Willett and
               Stephen Robertson},
  title     = {In memoriam: Karen Sp{\"{a}}rck Jones},
  journal   = {J. Inf. Sci.},
  volume    = {33},
  number    = {5},
  pages     = {637--639},
  year      = {2007},
  url       = {https://doi.org/10.1177/0165551507082681},
  doi       = {10.1177/0165551507082681},
  timestamp = {Thu, 06 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/jis/WillettR07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/JonesRS07,
  author    = {Karen Sparck Jones and
               Stephen E. Robertson and
               Mark Sanderson},
  title     = {Ambiguous requests: implications for retrieval tests, systems and
               theories},
  journal   = {{SIGIR} Forum},
  volume    = {41},
  number    = {2},
  pages     = {8--17},
  year      = {2007},
  url       = {https://doi.org/10.1145/1328964.1328965},
  doi       = {10.1145/1328964.1328965},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/JonesRS07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecir/Robertson07,
  author    = {Stephen Robertson},
  editor    = {Giambattista Amati and
               Claudio Carpineto and
               Giovanni Romano},
  title     = {The Last Half-Century: {A} Perspective on Experimentation in Information
               Retrieval},
  booktitle = {Advances in Information Retrieval, 29th European Conference on {IR}
               Research, {ECIR} 2007, Rome, Italy, April 2-5, 2007, Proceedings},
  series    = {Lecture Notes in Computer Science},
  volume    = {4425},
  pages     = {2},
  publisher = {Springer},
  year      = {2007},
  url       = {https://doi.org/10.1007/978-3-540-71496-5\_2},
  doi       = {10.1007/978-3-540-71496-5\_2},
  timestamp = {Tue, 14 May 2019 10:00:37 +0200},
  biburl    = {https://dblp.org/rec/conf/ecir/Robertson07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecir/Robertson07a,
  author    = {Stephen Robertson},
  editor    = {Giambattista Amati and
               Claudio Carpineto and
               Giovanni Romano},
  title     = {On Score Distributions and Relevance},
  booktitle = {Advances in Information Retrieval, 29th European Conference on {IR}
               Research, {ECIR} 2007, Rome, Italy, April 2-5, 2007, Proceedings},
  series    = {Lecture Notes in Computer Science},
  volume    = {4425},
  pages     = {40--51},
  publisher = {Springer},
  year      = {2007},
  url       = {https://doi.org/10.1007/978-3-540-71496-5\_7},
  doi       = {10.1007/978-3-540-71496-5\_7},
  timestamp = {Tue, 14 May 2019 10:00:37 +0200},
  biburl    = {https://dblp.org/rec/conf/ecir/Robertson07a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/inex/KampsPKLR07,
  author    = {Jaap Kamps and
               Jovan Pehcevski and
               Gabriella Kazai and
               Mounia Lalmas and
               Stephen Robertson},
  editor    = {Norbert Fuhr and
               Jaap Kamps and
               Mounia Lalmas and
               Andrew Trotman},
  title     = {{INEX} 2007 Evaluation Measures},
  booktitle = {Focused Access to {XML} Documents, 6th International Workshop of the
               Initiative for the Evaluation of {XML} Retrieval, {INEX} 2007, Dagstuhl
               Castle, Germany, December 17-19, 2007. Selected Papers},
  series    = {Lecture Notes in Computer Science},
  volume    = {4862},
  pages     = {24--33},
  publisher = {Springer},
  year      = {2007},
  url       = {https://doi.org/10.1007/978-3-540-85902-4\_2},
  doi       = {10.1007/978-3-540-85902-4\_2},
  timestamp = {Tue, 14 May 2019 10:00:49 +0200},
  biburl    = {https://dblp.org/rec/conf/inex/KampsPKLR07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/riao/RitchieRT07,
  author    = {Anna Ritchie and
               Stephen Robertson and
               Simone Teufel},
  editor    = {David A. Evans and
               Sadaoki Furui and
               Chantal Soul{\'{e}}{-}Dupuy},
  title     = {Expanding a Test Collection for Citation-based {IR} Experiments},
  booktitle = {Computer-Assisted Information Retrieval (Recherche d'Information et
               ses Applications) - {RIAO} 2007, 8th International Conference, Carnegie
               Mellon University, Pittsburgh, PA, USA, May 30 - June 1, 2007. Proceedings,
               {CD-ROM}},
  publisher = {{CID}},
  year      = {2007},
  timestamp = {Tue, 13 Mar 2018 14:43:53 +0100},
  biburl    = {https://dblp.org/rec/conf/riao/RitchieRT07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/MizzaroR07,
  author    = {Stefano Mizzaro and
               Stephen Robertson},
  editor    = {Wessel Kraaij and
               Arjen P. de Vries and
               Charles L. A. Clarke and
               Norbert Fuhr and
               Noriko Kando},
  title     = {Hits hits {TREC:} exploring {IR} evaluation results with network analysis},
  booktitle = {{SIGIR} 2007: Proceedings of the 30th Annual International {ACM} {SIGIR}
               Conference on Research and Development in Information Retrieval, Amsterdam,
               The Netherlands, July 23-27, 2007},
  pages     = {479--486},
  publisher = {{ACM}},
  year      = {2007},
  url       = {https://doi.org/10.1145/1277741.1277824},
  doi       = {10.1145/1277741.1277824},
  timestamp = {Wed, 25 Sep 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/conf/sigir/MizzaroR07.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/VechtomovaKR06,
  author    = {Olga Vechtomova and
               Murat Karamuftuoglu and
               Stephen E. Robertson},
  title     = {On document relevance and lexical cohesion between query terms},
  journal   = {Inf. Process. Manage.},
  volume    = {42},
  number    = {5},
  pages     = {1230--1247},
  year      = {2006},
  url       = {https://doi.org/10.1016/j.ipm.2006.01.008},
  doi       = {10.1016/j.ipm.2006.01.008},
  timestamp = {Thu, 18 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ipm/VechtomovaKR06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/Robertson06,
  author    = {Stephen Robertson},
  editor    = {Philip S. Yu and
               Vassilis J. Tsotras and
               Edward A. Fox and
               Bing Liu},
  title     = {On {GMAP:} and other transformations},
  booktitle = {Proceedings of the 2006 {ACM} {CIKM} International Conference on Information
               and Knowledge Management, Arlington, Virginia, USA, November 6-11,
               2006},
  pages     = {78--83},
  publisher = {{ACM}},
  year      = {2006},
  url       = {https://doi.org/10.1145/1183614.1183630},
  doi       = {10.1145/1183614.1183630},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/cikm/Robertson06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/TaylorZCRB06,
  author    = {Michael J. Taylor and
               Hugo Zaragoza and
               Nick Craswell and
               Stephen Robertson and
               Chris Burges},
  editor    = {Philip S. Yu and
               Vassilis J. Tsotras and
               Edward A. Fox and
               Bing Liu},
  title     = {Optimisation methods for ranking functions with multiple parameters},
  booktitle = {Proceedings of the 2006 {ACM} {CIKM} International Conference on Information
               and Knowledge Management, Arlington, Virginia, USA, November 6-11,
               2006},
  pages     = {585--593},
  publisher = {{ACM}},
  year      = {2006},
  url       = {https://doi.org/10.1145/1183614.1183698},
  doi       = {10.1145/1183614.1183698},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/cikm/TaylorZCRB06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/fqas/RobertsonLM06,
  author    = {Stephen E. Robertson and
               Wei Lu and
               Andrew MacFarlane},
  editor    = {Henrik Legind Larsen and
               Gabriella Pasi and
               Daniel Ortiz Arroyo and
               Troels Andreasen and
               Henning Christiansen},
  title     = {XML-Structured Documents: Retrievable Units and Inheritance},
  booktitle = {Flexible Query Answering Systems, 7th International Conference, {FQAS}
               2006, Milan, Italy, June 7-10, 2006, Proceedings},
  series    = {Lecture Notes in Computer Science},
  volume    = {4027},
  pages     = {121--132},
  publisher = {Springer},
  year      = {2006},
  url       = {https://doi.org/10.1007/11766254\_11},
  doi       = {10.1007/11766254\_11},
  timestamp = {Tue, 14 May 2019 10:00:54 +0200},
  biburl    = {https://dblp.org/rec/conf/fqas/RobertsonLM06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/inex/LalmasKKPPR06,
  author    = {Mounia Lalmas and
               Gabriella Kazai and
               Jaap Kamps and
               Jovan Pehcevski and
               Benjamin Piwowarski and
               Stephen Robertson},
  editor    = {Norbert Fuhr and
               Mounia Lalmas and
               Andrew Trotman},
  title     = {{INEX} 2006 Evaluation Measures},
  booktitle = {Comparative Evaluation of {XML} Information Retrieval Systems, 5th
               International Workshop of the Initiative for the Evaluation of {XML}
               Retrieval, {INEX} 2006, Dagstuhl Castle, Germany, December 17-20,
               2006, Revised and Selected Papers},
  series    = {Lecture Notes in Computer Science},
  volume    = {4518},
  pages     = {20--34},
  publisher = {Springer},
  year      = {2006},
  url       = {https://doi.org/10.1007/978-3-540-73888-6\_3},
  doi       = {10.1007/978-3-540-73888-6\_3},
  timestamp = {Tue, 14 May 2019 10:00:49 +0200},
  biburl    = {https://dblp.org/rec/conf/inex/LalmasKKPPR06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/inex/LuRM06,
  author    = {Wei Lu and
               Stephen E. Robertson and
               Andrew MacFarlane},
  editor    = {Norbert Fuhr and
               Mounia Lalmas and
               Andrew Trotman},
  title     = {{CISR} at {INEX} 2006},
  booktitle = {Comparative Evaluation of {XML} Information Retrieval Systems, 5th
               International Workshop of the Initiative for the Evaluation of {XML}
               Retrieval, {INEX} 2006, Dagstuhl Castle, Germany, December 17-20,
               2006, Revised and Selected Papers},
  series    = {Lecture Notes in Computer Science},
  volume    = {4518},
  pages     = {57--63},
  publisher = {Springer},
  year      = {2006},
  url       = {https://doi.org/10.1007/978-3-540-73888-6\_6},
  doi       = {10.1007/978-3-540-73888-6\_6},
  timestamp = {Tue, 14 May 2019 10:00:49 +0200},
  biburl    = {https://dblp.org/rec/conf/inex/LuRM06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwridl/Robertson06,
  author    = {Stephen Robertson},
  editor    = {Prasenjit Majumder and
               Mandar Mitra and
               Swapan K. Parui},
  title     = {On the science of search: statistical approaches, evaluation, optimisation},
  booktitle = {Proceedings of the International Workshop on Research Issues in Digital
               Libraries, {IWRIDL} 2006, in association with {ACM} SIGIR, Kolkata,
               India, December 12 - 15, 2006},
  series    = {{ACM} International Conference Proceeding Series},
  pages     = {2},
  publisher = {{ACM}},
  year      = {2006},
  url       = {https://doi.org/10.1145/1364742.1364745},
  doi       = {10.1145/1364742.1364745},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/iwridl/Robertson06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/naacl/RitchieTR06,
  author    = {Anna Ritchie and
               Simone Teufel and
               Stephen Robertson},
  editor    = {Robert C. Moore and
               Jeff A. Bilmes and
               Jennifer Chu{-}Carroll and
               Mark Sanderson},
  title     = {Creating a Test Collection for Citation-based {IR} Experiments},
  booktitle = {Human Language Technology Conference of the North American Chapter
               of the Association of Computational Linguistics, Proceedings, June
               4-9, 2006, New York, New York, {USA}},
  publisher = {The Association for Computational Linguistics},
  year      = {2006},
  url       = {https://www.aclweb.org/anthology/N06-1050/},
  timestamp = {Mon, 16 Sep 2019 17:08:53 +0200},
  biburl    = {https://dblp.org/rec/conf/naacl/RitchieTR06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/LuRMZ06,
  author    = {Wei Lu and
               Stephen E. Robertson and
               Andrew MacFarlane and
               Haozhen Zhao},
  editor    = {Ellen M. Voorhees and
               Lori P. Buckland},
  title     = {Window-based Enterprise Expert Search},
  booktitle = {Proceedings of the Fifteenth Text REtrieval Conference, {TREC} 2006,
               Gaithersburg, Maryland, USA, November 14-17, 2006},
  volume    = {Special Publication 500-272},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {2006},
  url       = {http://trec.nist.gov/pubs/trec15/papers/cityu-london.ent.pdf},
  timestamp = {Wed, 04 Nov 2015 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/trec/LuRMZ06.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aslib/MacFarlaneMR05,
  author    = {Andrew MacFarlane and
               Julie A. McCann and
               Stephen E. Robertson},
  title     = {Parallel methods for the generation of partitioned inverted files},
  journal   = {Aslib Proceedings},
  volume    = {57},
  number    = {5},
  pages     = {434--459},
  year      = {2005},
  url       = {https://doi.org/10.1108/00012530510621888},
  doi       = {10.1108/00012530510621888},
  timestamp = {Sat, 27 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/aslib/MacFarlaneMR05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ir/Robertson05,
  author    = {Stephen E. Robertson},
  title     = {On Event Spaces and Probabilistic Models in Information Retrieval},
  journal   = {Inf. Retr.},
  volume    = {8},
  number    = {2},
  pages     = {319--329},
  year      = {2005},
  url       = {https://doi.org/10.1007/s10791-005-5665-9},
  doi       = {10.1007/s10791-005-5665-9},
  timestamp = {Sat, 27 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ir/Robertson05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/inex/LuRM05,
  author    = {Wei Lu and
               Stephen E. Robertson and
               Andrew MacFarlane},
  editor    = {Norbert Fuhr and
               Mounia Lalmas and
               Saadia Malik and
               Gabriella Kazai},
  title     = {Field-Weighted {XML} Retrieval Based on {BM25}},
  booktitle = {Advances in {XML} Information Retrieval and Evaluation, 4th International
               Workshop of the Initiative for the Evaluation of {XML} Retrieval,
               {INEX} 2005, Dagstuhl Castle, Germany, November 28-30, 2005, Revised
               Selected Papers},
  series    = {Lecture Notes in Computer Science},
  volume    = {3977},
  pages     = {161--171},
  publisher = {Springer},
  year      = {2005},
  url       = {https://doi.org/10.1007/978-3-540-34963-1\_12},
  doi       = {10.1007/978-3-540-34963-1\_12},
  timestamp = {Tue, 14 May 2019 10:00:49 +0200},
  biburl    = {https://dblp.org/rec/conf/inex/LuRM05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/CraswellRZT05,
  author    = {Nick Craswell and
               Stephen E. Robertson and
               Hugo Zaragoza and
               Michael J. Taylor},
  editor    = {Ricardo A. Baeza{-}Yates and
               Nivio Ziviani and
               Gary Marchionini and
               Alistair Moffat and
               John Tait},
  title     = {Relevance weighting for query independent evidence},
  booktitle = {{SIGIR} 2005: Proceedings of the 28th Annual International {ACM} {SIGIR}
               Conference on Research and Development in Information Retrieval, Salvador,
               Brazil, August 15-19, 2005},
  pages     = {416--423},
  publisher = {{ACM}},
  year      = {2005},
  url       = {https://doi.org/10.1145/1076034.1076106},
  doi       = {10.1145/1076034.1076106},
  timestamp = {Tue, 06 Nov 2018 11:07:23 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/CraswellRZT05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/CraswellZR05,
  author    = {Nick Craswell and
               Hugo Zaragoza and
               Stephen Robertson},
  editor    = {Ellen M. Voorhees and
               Lori P. Buckland},
  title     = {Microsoft Cambridge at {TREC} 14: Enterprise Track},
  booktitle = {Proceedings of the Fourteenth Text REtrieval Conference, {TREC} 2005,
               Gaithersburg, Maryland, USA, November 15-18, 2005},
  volume    = {Special Publication 500-266},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {2005},
  url       = {http://trec.nist.gov/pubs/trec14/papers/microsoft-cambridge.enterprise.pdf},
  timestamp = {Tue, 07 Apr 2015 13:04:04 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/CraswellZR05.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/aslib/MacFarlaneRM04,
  author    = {Andrew MacFarlane and
               Stephen E. Robertson and
               Julie A. McCann},
  title     = {Parallel computing for passage retrieval},
  journal   = {Aslib Proceedings},
  volume    = {56},
  number    = {4},
  pages     = {201--211},
  year      = {2004},
  url       = {https://doi.org/10.1108/00012530410549231},
  doi       = {10.1108/00012530410549231},
  timestamp = {Sat, 27 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/aslib/MacFarlaneRM04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/BodoffR04,
  author    = {David Bodoff and
               Stephen E. Robertson},
  title     = {A new unified probabilistic model},
  journal   = {{JASIST}},
  volume    = {55},
  number    = {6},
  pages     = {471--487},
  year      = {2004},
  url       = {https://doi.org/10.1002/asi.10398},
  doi       = {10.1002/asi.10398},
  timestamp = {Fri, 30 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/jasis/BodoffR04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jd/Robertson04,
  author    = {Stephen Robertson},
  title     = {Understanding inverse document frequency: on theoretical arguments
               for {IDF}},
  journal   = {Journal of Documentation},
  volume    = {60},
  number    = {5},
  pages     = {503--520},
  year      = {2004},
  url       = {https://doi.org/10.1108/00220410410560582},
  doi       = {10.1108/00220410410560582},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/jd/Robertson04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cikm/RobertsonZT04,
  author    = {Stephen E. Robertson and
               Hugo Zaragoza and
               Michael J. Taylor},
  editor    = {David A. Grossman and
               Luis Gravano and
               ChengXiang Zhai and
               Otthein Herzog and
               David A. Evans},
  title     = {Simple {BM25} extension to multiple weighted fields},
  booktitle = {Proceedings of the 2004 {ACM} {CIKM} International Conference on Information
               and Knowledge Management, Washington, DC, USA, November 8-13, 2004},
  pages     = {42--49},
  publisher = {{ACM}},
  year      = {2004},
  url       = {https://doi.org/10.1145/1031171.1031181},
  doi       = {10.1145/1031171.1031181},
  timestamp = {Wed, 28 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/cikm/RobertsonZT04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/HiemstraRZ04,
  author    = {Djoerd Hiemstra and
               Stephen E. Robertson and
               Hugo Zaragoza},
  editor    = {Mark Sanderson and
               Kalervo J{\"{a}}rvelin and
               James Allan and
               Peter Bruza},
  title     = {Parsimonious language models for information retrieval},
  booktitle = {{SIGIR} 2004: Proceedings of the 27th Annual International {ACM} {SIGIR}
               Conference on Research and Development in Information Retrieval, Sheffield,
               UK, July 25-29, 2004},
  pages     = {178--185},
  publisher = {{ACM}},
  year      = {2004},
  url       = {https://doi.org/10.1145/1008992.1009025},
  doi       = {10.1145/1008992.1009025},
  timestamp = {Tue, 06 Nov 2018 11:07:22 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/HiemstraRZ04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/UpstillR04,
  author    = {Trystan Upstill and
               Stephen E. Robertson},
  editor    = {Mark Sanderson and
               Kalervo J{\"{a}}rvelin and
               James Allan and
               Peter Bruza},
  title     = {Exploiting hyperlink recommendation evidence in navigational web search},
  booktitle = {{SIGIR} 2004: Proceedings of the 27th Annual International {ACM} {SIGIR}
               Conference on Research and Development in Information Retrieval, Sheffield,
               UK, July 25-29, 2004},
  pages     = {576--577},
  publisher = {{ACM}},
  year      = {2004},
  url       = {https://doi.org/10.1145/1008992.1009128},
  doi       = {10.1145/1008992.1009128},
  timestamp = {Tue, 06 Nov 2018 11:07:22 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/UpstillR04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/ZaragozaCTSR04,
  author    = {Hugo Zaragoza and
               Nick Craswell and
               Michael J. Taylor and
               Suchi Saria and
               Stephen E. Robertson},
  editor    = {Ellen M. Voorhees and
               Lori P. Buckland},
  title     = {Microsoft Cambridge at {TREC} 13: Web and Hard Tracks},
  booktitle = {Proceedings of the Thirteenth Text REtrieval Conference, {TREC} 2004,
               Gaithersburg, Maryland, USA, November 16-19, 2004},
  volume    = {Special Publication 500-261},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {2004},
  url       = {http://trec.nist.gov/pubs/trec13/papers/microsoft-cambridge.web.hard.pdf},
  timestamp = {Tue, 07 Apr 2015 13:04:03 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/ZaragozaCTSR04.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ir/HawkingR03,
  author    = {David Hawking and
               Stephen E. Robertson},
  title     = {On Collection Size and Retrieval Effectiveness},
  journal   = {Inf. Retr.},
  volume    = {6},
  number    = {1},
  pages     = {99--105},
  year      = {2003},
  url       = {https://doi.org/10.1023/A:1022904715765},
  doi       = {10.1023/A:1022904715765},
  timestamp = {Sat, 27 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ir/HawkingR03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ir/VechtomovaRJ03,
  author    = {Olga Vechtomova and
               Stephen E. Robertson and
               Susan Jones},
  title     = {Query Expansion with Long-Span Collocates},
  journal   = {Inf. Retr.},
  volume    = {6},
  number    = {2},
  pages     = {251--273},
  year      = {2003},
  url       = {https://doi.org/10.1023/A:1023936321956},
  doi       = {10.1023/A:1023936321956},
  timestamp = {Sat, 27 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ir/VechtomovaRJ03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ir/HuangPSCR03,
  author    = {Xiangji Huang and
               Fuchun Peng and
               Dale Schuurmans and
               Nick Cercone and
               Stephen E. Robertson},
  title     = {Applying Machine Learning to Text Segmentation for Information Retrieval},
  journal   = {Inf. Retr.},
  volume    = {6},
  number    = {3-4},
  pages     = {333--362},
  year      = {2003},
  url       = {https://doi.org/10.1023/A:1026028229881},
  doi       = {10.1023/A:1026028229881},
  timestamp = {Sat, 27 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ir/HuangPSCR03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03,
  author    = {James Allan and
               Jay Aslam and
               Nicholas J. Belkin and
               Chris Buckley and
               James P. Callan and
               W. Bruce Croft and
               Susan T. Dumais and
               Norbert Fuhr and
               Donna Harman and
               David J. Harper and
               Djoerd Hiemstra and
               Thomas Hofmann and
               Eduard H. Hovy and
               Wessel Kraaij and
               John D. Lafferty and
               Victor Lavrenko and
               David D. Lewis and
               Liz Liddy and
               R. Manmatha and
               Andrew McCallum and
               Jay M. Ponte and
               John M. Prager and
               Dragomir R. Radev and
               Philip Resnik and
               Stephen E. Robertson and
               Ronald Rosenfeld and
               Salim Roukos and
               Mark Sanderson and
               Richard M. Schwartz and
               Amit Singhal and
               Alan F. Smeaton and
               Howard R. Turtle and
               Ellen M. Voorhees and
               Ralph M. Weischedel and
               Jinxi Xu and
               ChengXiang Zhai},
  title     = {Challenges in information retrieval and language modeling: report
               of a workshop held at the center for intelligent information retrieval,
               University of Massachusetts Amherst, September 2002},
  journal   = {{SIGIR} Forum},
  volume    = {37},
  number    = {1},
  pages     = {31--47},
  year      = {2003},
  url       = {https://doi.org/10.1145/945546.945549},
  doi       = {10.1145/945546.945549},
  timestamp = {Fri, 30 Aug 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/sigir/AllanABBCCDFHHHHHKLLLLMMPPRRRRRSSSSTVWXZ03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecir/MacFarlaneRM03,
  author    = {Andy MacFarlane and
               Stephen E. Robertson and
               Julie A. McCann},
  editor    = {Fabrizio Sebastiani},
  title     = {Parallel Computing for Term Selection in Routing/Filtering},
  booktitle = {Advances in Information Retrieval, 25th European Conference on {IR}
               Research, {ECIR} 2003, Pisa, Italy, April 14-16, 2003, Proceedings},
  series    = {Lecture Notes in Computer Science},
  volume    = {2633},
  pages     = {537--545},
  publisher = {Springer},
  year      = {2003},
  url       = {https://doi.org/10.1007/3-540-36618-0\_40},
  doi       = {10.1007/3-540-36618-0\_40},
  timestamp = {Tue, 14 May 2019 10:00:37 +0200},
  biburl    = {https://dblp.org/rec/conf/ecir/MacFarlaneRM03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/SoboroffR03,
  author    = {Ian Soboroff and
               Stephen E. Robertson},
  editor    = {Charles L. A. Clarke and
               Gordon V. Cormack and
               Jamie Callan and
               David Hawking and
               Alan F. Smeaton},
  title     = {Building a filtering test collection for {TREC} 2002},
  booktitle = {{SIGIR} 2003: Proceedings of the 26th Annual International {ACM} {SIGIR}
               Conference on Research and Development in Information Retrieval, July
               28 - August 1, 2003, Toronto, Canada},
  pages     = {243--250},
  publisher = {{ACM}},
  year      = {2003},
  url       = {https://doi.org/10.1145/860435.860481},
  doi       = {10.1145/860435.860481},
  timestamp = {Tue, 06 Nov 2018 11:07:23 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/SoboroffR03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/RobertsonZT03,
  author    = {Stephen E. Robertson and
               Hugo Zaragoza and
               Michael J. Taylor},
  editor    = {Ellen M. Voorhees and
               Lori P. Buckland},
  title     = {Microsoft Cambridge at {TREC-12:} {HARD} track},
  booktitle = {Proceedings of The Twelfth Text REtrieval Conference, {TREC} 2003,
               Gaithersburg, Maryland, USA, November 18-21, 2003},
  volume    = {Special Publication 500-255},
  pages     = {418--425},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {2003},
  url       = {http://trec.nist.gov/pubs/trec12/papers/microsoft-cambridge.hard.pdf},
  timestamp = {Tue, 07 Apr 2015 13:04:03 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/RobertsonZT03.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ir/Robertson02,
  author    = {Stephen E. Robertson},
  title     = {Introduction to the Special Issue: Overview of the {TREC} Routing
               and Filtering Tasks},
  journal   = {Inf. Retr.},
  volume    = {5},
  number    = {2-3},
  pages     = {127--137},
  year      = {2002},
  url       = {https://doi.org/10.1023/A:1015721010859},
  doi       = {10.1023/A:1015721010859},
  timestamp = {Sat, 27 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ir/Robertson02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ir/Robertson02a,
  author    = {Stephen E. Robertson},
  title     = {Threshold Setting and Performance Optimization in Adaptive Filtering},
  journal   = {Inf. Retr.},
  volume    = {5},
  number    = {2-3},
  pages     = {239--256},
  year      = {2002},
  url       = {https://doi.org/10.1023/A:1015702129514},
  doi       = {10.1023/A:1015702129514},
  timestamp = {Sat, 27 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ir/Robertson02a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ir/Robertson02b,
  author    = {Stephen E. Robertson},
  title     = {Comparing the Performance of Adaptive Filtering and Ranked Output
               Systems},
  journal   = {Inf. Retr.},
  volume    = {5},
  number    = {2-3},
  pages     = {257--268},
  year      = {2002},
  url       = {https://doi.org/10.1023/A:1015754113585},
  doi       = {10.1023/A:1015754113585},
  timestamp = {Sat, 27 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ir/Robertson02b.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jis/KaramuftuogluJRVW02,
  author    = {Murat Karamuftuoglu and
               Susan Jones and
               Stephen Robertson and
               Fabio Venuti and
               Xinkun Wang},
  title     = {Challenges posed by web-based retrieval of scientific papers: Okapi
               participation in {TIPS}},
  journal   = {J. Inf. Sci.},
  volume    = {28},
  number    = {1},
  pages     = {3--17},
  year      = {2002},
  url       = {https://doi.org/10.1177/016555150202800102},
  doi       = {10.1177/016555150202800102},
  timestamp = {Thu, 06 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/jis/KaramuftuogluJRVW02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jis/JonesVR02,
  author    = {Susan Jones and
               Olga Vechtomova and
               Stephen Robertson},
  title     = {A tool for comparative evaluation in an interactive environment},
  journal   = {J. Inf. Sci.},
  volume    = {28},
  number    = {6},
  pages     = {493--503},
  year      = {2002},
  url       = {https://doi.org/10.1177/016555150202800605},
  doi       = {10.1177/016555150202800605},
  timestamp = {Thu, 06 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/jis/JonesVR02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/PengHSCR02,
  author    = {Fuchun Peng and
               Xiangji Huang and
               Dale Schuurmans and
               Nick Cercone and
               Stephen E. Robertson},
  editor    = {Kalervo J{\"{a}}rvelin and
               Micheline Beaulieu and
               Ricardo A. Baeza{-}Yates and
               Sung{-}Hyon Myaeng},
  title     = {Using self-supervised word segmentation in Chinese information retrieval},
  booktitle = {{SIGIR} 2002: Proceedings of the 25th Annual International {ACM} {SIGIR}
               Conference on Research and Development in Information Retrieval, August
               11-15, 2002, Tampere, Finland},
  pages     = {349--350},
  publisher = {{ACM}},
  year      = {2002},
  url       = {https://doi.org/10.1145/564376.564438},
  doi       = {10.1145/564376.564438},
  timestamp = {Wed, 07 Nov 2018 14:52:44 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/PengHSCR02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/SakaiR02,
  author    = {Tetsuya Sakai and
               Stephen E. Robertson},
  editor    = {Kalervo J{\"{a}}rvelin and
               Micheline Beaulieu and
               Ricardo A. Baeza{-}Yates and
               Sung{-}Hyon Myaeng},
  title     = {Relative and absolute term selection criteria: a comparative study
               for English and Japanese {IR}},
  booktitle = {{SIGIR} 2002: Proceedings of the 25th Annual International {ACM} {SIGIR}
               Conference on Research and Development in Information Retrieval, August
               11-15, 2002, Tampere, Finland},
  pages     = {411--412},
  publisher = {{ACM}},
  year      = {2002},
  url       = {https://doi.org/10.1145/564376.564469},
  doi       = {10.1145/564376.564469},
  timestamp = {Wed, 07 Nov 2018 14:52:44 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/SakaiR02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/RobertsonS02,
  author    = {Stephen E. Robertson and
               Ian Soboroff},
  editor    = {Ellen M. Voorhees and
               Lori P. Buckland},
  title     = {The {TREC} 2002 Filtering Track Report},
  booktitle = {Proceedings of The Eleventh Text REtrieval Conference, {TREC} 2002,
               Gaithersburg, Maryland, USA, November 19-22, 2002},
  volume    = {Special Publication 500-251},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {2002},
  url       = {http://trec.nist.gov/pubs/trec11/papers/OVER.FILTERING.pdf},
  timestamp = {Tue, 07 Apr 2015 13:04:03 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/RobertsonS02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/RobertsonWZH02,
  author    = {Stephen E. Robertson and
               Steve Walker and
               Hugo Zaragoza and
               Ralf Herbrich},
  editor    = {Ellen M. Voorhees and
               Lori P. Buckland},
  title     = {Microsoft Cambridge at {TREC} 2002: Filtering Track},
  booktitle = {Proceedings of The Eleventh Text REtrieval Conference, {TREC} 2002,
               Gaithersburg, Maryland, USA, November 19-22, 2002},
  volume    = {Special Publication 500-251},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {2002},
  url       = {http://trec.nist.gov/pubs/trec11/papers/cambridge.corrected.pdf},
  timestamp = {Tue, 07 Apr 2015 13:04:03 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/RobertsonWZH02.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/KuralRJ01,
  author    = {Yasemin Kural and
               Stephen E. Robertson and
               Susan Jones},
  title     = {Deciphering cluster representations},
  journal   = {Inf. Process. Manage.},
  volume    = {37},
  number    = {4},
  pages     = {593--601},
  year      = {2001},
  url       = {https://doi.org/10.1016/S0306-4573(00)00037-6},
  doi       = {10.1016/S0306-4573(00)00037-6},
  timestamp = {Thu, 18 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ipm/KuralRJ01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/delos/HiemstraR01,
  author    = {Djoerd Hiemstra and
               Stephen E. Robertson},
  editor    = {Alan F. Smeaton and
               Jamie Callan},
  title     = {Relevance Feedback for Best Match Term Weighting Algorithms in Information
               Retrieval},
  booktitle = {Proceedings of the Second {DELOS} Network of Excellence Workshop on
               Personalisation and Recommender Systems in Digital Libraries, {DELOS}
               2001, Dublin, Ireland, June 18-20, 2001},
  series    = {{ERCIM} Workshop Proceedings},
  volume    = {01/W03},
  publisher = {{ERCIM}},
  year      = {2001},
  url       = {http://www.ercim.org/publication/ws-proceedings/DelNoe02/hiemstra.pdf},
  timestamp = {Sat, 07 Sep 2019 11:59:23 +0200},
  biburl    = {https://dblp.org/rec/conf/delos/HiemstraR01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ntcir/SakaiRW01,
  author    = {Tetsuya Sakai and
               Stephen E. Robertson and
               Stephen Walker},
  title     = {Flexible Pseudo-Relevance Feedback for {NTCIR-2}},
  booktitle = {Proceedings of the Third Second Workshop Meeting on Evaluation of
               Chinese {\&} Japanese Text Retrieval and Text Summarization, NTCIR-2,
               Tokyo, Japan, March 7-9, 2001},
  publisher = {National Institute of Informatics {(NII)}},
  year      = {2001},
  url       = {http://research.nii.ac.jp/ntcir/workshop/OnlineProceedings2/sakai.pdf},
  timestamp = {Thu, 28 May 2015 17:27:06 +0200},
  biburl    = {https://dblp.org/rec/conf/ntcir/SakaiRW01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/CraswellHR01,
  author    = {Nick Craswell and
               David Hawking and
               Stephen E. Robertson},
  editor    = {W. Bruce Croft and
               David J. Harper and
               Donald H. Kraft and
               Justin Zobel},
  title     = {Effective Site Finding Using Link Anchor Information},
  booktitle = {{SIGIR} 2001: Proceedings of the 24th Annual International {ACM} {SIGIR}
               Conference on Research and Development in Information Retrieval, September
               9-13, 2001, New Orleans, Louisiana, {USA}},
  pages     = {250--257},
  publisher = {{ACM}},
  year      = {2001},
  url       = {https://doi.org/10.1145/383952.383999},
  doi       = {10.1145/383952.383999},
  timestamp = {Tue, 06 Nov 2018 11:07:24 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/CraswellHR01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/SakaiR01,
  author    = {Tetsuya Sakai and
               Stephen E. Robertson},
  editor    = {W. Bruce Croft and
               David J. Harper and
               Donald H. Kraft and
               Justin Zobel},
  title     = {Flexible Pseudo-Relevance Feedback Using Optimization Tables},
  booktitle = {{SIGIR} 2001: Proceedings of the 24th Annual International {ACM} {SIGIR}
               Conference on Research and Development in Information Retrieval, September
               9-13, 2001, New Orleans, Louisiana, {USA}},
  pages     = {396--397},
  publisher = {{ACM}},
  year      = {2001},
  url       = {https://doi.org/10.1145/383952.384035},
  doi       = {10.1145/383952.384035},
  timestamp = {Tue, 06 Nov 2018 11:07:24 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/SakaiR01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/GaoCHZNWR01,
  author    = {Jianfeng Gao and
               Guihong Cao and
               Hongzhao He and
               Min Zhang and
               Jian{-}Yun Nie and
               Steve Walker and
               Stephen E. Robertson},
  editor    = {Ellen M. Voorhees and
               Donna K. Harman},
  title     = {{TREC-10} Web Track Experiments at {MSRA}},
  booktitle = {Proceedings of The Tenth Text REtrieval Conference, {TREC} 2001, Gaithersburg,
               Maryland, USA, November 13-16, 2001},
  volume    = {Special Publication 500-250},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {2001},
  url       = {http://trec.nist.gov/pubs/trec10/papers/msra.trec10.pdf},
  timestamp = {Tue, 07 Apr 2015 13:04:04 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/GaoCHZNWR01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/RobertsonS01,
  author    = {Stephen E. Robertson and
               Ian Soboroff},
  editor    = {Ellen M. Voorhees and
               Donna K. Harman},
  title     = {The {TREC} 2001 Filtering Track Report},
  booktitle = {Proceedings of The Tenth Text REtrieval Conference, {TREC} 2001, Gaithersburg,
               Maryland, USA, November 13-16, 2001},
  volume    = {Special Publication 500-250},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {2001},
  url       = {http://trec.nist.gov/pubs/trec10/papers/filtering\_track.pdf},
  timestamp = {Tue, 07 Apr 2015 13:04:04 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/RobertsonS01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/RobertsonWZ01,
  author    = {Stephen E. Robertson and
               Steve Walker and
               Hugo Zaragoza},
  editor    = {Ellen M. Voorhees and
               Donna K. Harman},
  title     = {Microsoft Cambridge at {TREC-10:} Filtering and Web Tracks},
  booktitle = {Proceedings of The Tenth Text REtrieval Conference, {TREC} 2001, Gaithersburg,
               Maryland, USA, November 13-16, 2001},
  volume    = {Special Publication 500-250},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {2001},
  url       = {http://trec.nist.gov/pubs/trec10/papers/msr\_cambridge.pdf},
  timestamp = {Tue, 07 Apr 2015 13:04:04 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/RobertsonWZ01.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ci/HuangRCA00,
  author    = {Xiangji Huang and
               Stephen E. Robertson and
               Nick Cercone and
               Aijun An},
  title     = {Probability-Based Chinese Text Processing and Retrieval},
  journal   = {Computational Intelligence},
  volume    = {16},
  number    = {4},
  pages     = {552--569},
  year      = {2000},
  url       = {https://doi.org/10.1111/0824-7935.00126},
  doi       = {10.1111/0824-7935.00126},
  timestamp = {Sat, 27 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ci/HuangRCA00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/RobertsonWB00,
  author    = {Stephen E. Robertson and
               Steve Walker and
               Micheline Hancock{-}Beaulieu},
  title     = {Experimentation as a way of life: Okapi at {TREC}},
  journal   = {Inf. Process. Manage.},
  volume    = {36},
  number    = {1},
  pages     = {95--108},
  year      = {2000},
  url       = {https://doi.org/10.1016/S0306-4573(99)00046-1},
  doi       = {10.1016/S0306-4573(99)00046-1},
  timestamp = {Thu, 18 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ipm/RobertsonWB00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/JonesWR00,
  author    = {Karen Sparck Jones and
               Steve Walker and
               Stephen E. Robertson},
  title     = {A probabilistic model of information retrieval: development and comparative
               experiments - Part 1},
  journal   = {Inf. Process. Manage.},
  volume    = {36},
  number    = {6},
  pages     = {779--808},
  year      = {2000},
  url       = {https://doi.org/10.1016/S0306-4573(00)00015-7},
  doi       = {10.1016/S0306-4573(00)00015-7},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/ipm/JonesWR00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/JonesWR00a,
  author    = {Karen Sparck Jones and
               Steve Walker and
               Stephen E. Robertson},
  title     = {A probabilistic model of information retrieval: development and comparative
               experiments - Part 2},
  journal   = {Inf. Process. Manage.},
  volume    = {36},
  number    = {6},
  pages     = {809--840},
  year      = {2000},
  url       = {https://doi.org/10.1016/S0306-4573(00)00016-9},
  doi       = {10.1016/S0306-4573(00)00016-9},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/ipm/JonesWR00a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jd/RobertsonW00,
  author    = {Stephen E. Robertson and
               Stephen Walker},
  title     = {Threshold setting in adaptive filtering},
  journal   = {Journal of Documentation},
  volume    = {56},
  number    = {3},
  pages     = {312--331},
  year      = {2000},
  url       = {https://doi.org/10.1108/EUM0000000007118},
  doi       = {10.1108/EUM0000000007118},
  timestamp = {Sat, 24 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/jd/RobertsonW00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/Robertson00,
  author    = {Stephen E. Robertson},
  title     = {Salton Award Lecture: On theoretical argument in information retrieval},
  journal   = {{SIGIR} Forum},
  volume    = {34},
  number    = {1},
  pages     = {1--10},
  year      = {2000},
  url       = {https://doi.org/10.1145/373593.373597},
  doi       = {10.1145/373593.373597},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/Robertson00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/essir/Robertson00,
  author    = {Stephen E. Robertson},
  editor    = {Maristella Agosti and
               Fabio Crestani and
               Gabriella Pasi},
  title     = {Evaluation in Information Retrieval},
  booktitle = {Lectures on Information Retrieval, Third European Summer-School, {ESSIR}
               2000, Varenna, Italy, September 11-15, 2000, Revised Lectures},
  series    = {Lecture Notes in Computer Science},
  volume    = {1980},
  pages     = {81--92},
  publisher = {Springer},
  year      = {2000},
  url       = {https://doi.org/10.1007/3-540-45368-7\_4},
  doi       = {10.1007/3-540-45368-7\_4},
  timestamp = {Sun, 02 Jun 2019 21:18:47 +0200},
  biburl    = {https://dblp.org/rec/conf/essir/Robertson00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/Robertson00,
  author    = {Stephen E. Robertson},
  editor    = {Emmanuel J. Yannakoudakis and
               Nicholas J. Belkin and
               Peter Ingwersen and
               Mun{-}Kew Leong},
  title     = {Salton Award Lecture: On theoretical argument in information retrieval},
  booktitle = {{SIGIR} 2000: Proceedings of the 23rd Annual International {ACM} {SIGIR}
               Conference on Research and Development in Information Retrieval, July
               24-28, 2000, Athens, Greece},
  pages     = {1},
  publisher = {{ACM}},
  year      = {2000},
  timestamp = {Tue, 06 Nov 2018 11:07:24 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/Robertson00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/spire/MacFarlaneMR00,
  author    = {Andrew MacFarlane and
               Julie A. McCann and
               Stephen E. Robertson},
  editor    = {Pablo de la Fuente},
  title     = {Parallel Search Using Partitioned Inverted Files},
  booktitle = {Seventh International Symposium on String Processing and Information
               Retrieval, {SPIRE} 2000, {A} Coru{\~{n}}a, Spain, September 27-29,
               2000},
  pages     = {209--220},
  publisher = {{IEEE} Computer Society},
  year      = {2000},
  url       = {https://doi.org/10.1109/SPIRE.2000.878197},
  doi       = {10.1109/SPIRE.2000.878197},
  timestamp = {Wed, 16 Oct 2019 14:14:57 +0200},
  biburl    = {https://dblp.org/rec/conf/spire/MacFarlaneMR00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/RobertsonH00,
  author    = {Stephen E. Robertson and
               David A. Hull},
  editor    = {Ellen M. Voorhees and
               Donna K. Harman},
  title     = {The {TREC-9} Filtering Track Final Report},
  booktitle = {Proceedings of The Ninth Text REtrieval Conference, {TREC} 2000, Gaithersburg,
               Maryland, USA, November 13-16, 2000},
  volume    = {Special Publication 500-249},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {2000},
  url       = {http://trec.nist.gov/pubs/trec9/papers/filtering\_new.pdf},
  timestamp = {Tue, 07 Apr 2015 13:04:03 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/RobertsonH00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/RobertsonW00,
  author    = {Stephen E. Robertson and
               Steve Walker},
  editor    = {Ellen M. Voorhees and
               Donna K. Harman},
  title     = {Microsoft Cambridge at {TREC-9:} Filtering Track},
  booktitle = {Proceedings of The Ninth Text REtrieval Conference, {TREC} 2000, Gaithersburg,
               Maryland, USA, November 13-16, 2000},
  volume    = {Special Publication 500-249},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {2000},
  url       = {http://trec.nist.gov/pubs/trec9/papers/msrc-fq.pdf},
  timestamp = {Tue, 07 Apr 2015 13:04:03 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/RobertsonW00.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ir/KantorR99,
  author    = {Paul B. Kantor and
               Stephen E. Robertson},
  title     = {Editorial},
  journal   = {Inf. Retr.},
  volume    = {1},
  number    = {1-2},
  pages     = {5},
  year      = {1999},
  url       = {https://doi.org/10.1023/A:1009990414324},
  doi       = {10.1023/A:1009990414324},
  timestamp = {Sat, 27 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ir/KantorR99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/sigir/HullR99,
  author    = {David A. Hull and
               Stephen E. Robertson},
  title     = {The {TREC-9} Filtering Track},
  journal   = {{SIGIR} Forum},
  volume    = {33},
  number    = {2},
  pages     = {16},
  year      = {1999},
  url       = {https://doi.org/10.1145/344250.344253},
  doi       = {10.1145/344250.344253},
  timestamp = {Tue, 06 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/sigir/HullR99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecir/KuralRJ99,
  author    = {Yasemin Kural and
               Stephen E. Robertson and
               Susan Jones},
  title     = {Clustering Information Retrieval Search Outputs},
  booktitle = {Challenge of Image Retrieval, Newcastle upon Tyne, {UK.} 25-26 February
               1999},
  series    = {Workshops in Computing},
  publisher = {{BCS}},
  year      = {1999},
  url       = {http://ewic.bcs.org/content/ConWebDoc/4252},
  timestamp = {Wed, 11 Jun 2014 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/conf/ecir/KuralRJ99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mira/Robertson99,
  author    = {Stephen E. Robertson},
  editor    = {Stephen W. Draper and
               Mark D. Dunlop and
               Ian Ruthven and
               C. J. van Rijsbergen},
  title     = {Process and Outcome: On the Evaluation of {IR} Systems in the Age
               of Interaction, GUIs and Multimedia},
  booktitle = {Proceedings of Mira 99: Evaluating Interactive Information Retrieval,
               Glasgow, Scotland, UK, April 14-16, 1999},
  series    = {Workshops in Computing},
  publisher = {{BCS}},
  year      = {1999},
  url       = {http://ewic.bcs.org/content/ConWebDoc/4270},
  timestamp = {Wed, 11 Jun 2014 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/conf/mira/Robertson99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pvm/MacFarlaneMR99,
  author    = {Andrew MacFarlane and
               Julie A. McCann and
               Stephen E. Robertson},
  editor    = {Jack J. Dongarra and
               Emilio Luque and
               Tom{\`{a}}s Margalef},
  title     = {{PLIERS:} {A} Parallel Information Retrieval System Using {MPI}},
  booktitle = {Recent Advances in Parallel Virtual Machine and Message Passing Interface,
               6th European {PVM/MPI} Users' Group Meeting, Barcelona, Spain, September
               26-29, 1999, Proceedings},
  series    = {Lecture Notes in Computer Science},
  volume    = {1697},
  pages     = {317--324},
  publisher = {Springer},
  year      = {1999},
  url       = {https://doi.org/10.1007/3-540-48158-3\_39},
  doi       = {10.1007/3-540-48158-3\_39},
  timestamp = {Tue, 14 May 2019 10:00:52 +0200},
  biburl    = {https://dblp.org/rec/conf/pvm/MacFarlaneMR99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/HullR99,
  author    = {David A. Hull and
               Stephen E. Robertson},
  editor    = {Ellen M. Voorhees and
               Donna K. Harman},
  title     = {The {TREC-8} Filtering Track Final Report},
  booktitle = {Proceedings of The Eighth Text REtrieval Conference, {TREC} 1999,
               Gaithersburg, Maryland, USA, November 17-19, 1999},
  volume    = {Special Publication 500-246},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {1999},
  url       = {http://trec.nist.gov/pubs/trec8/papers/filtering.pdf},
  timestamp = {Tue, 07 Apr 2015 13:04:04 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/HullR99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/HullR99a,
  author    = {David A. Hull and
               Stephen E. Robertson},
  editor    = {Ellen M. Voorhees and
               Donna K. Harman},
  title     = {The {TREC-8} Filtering Track Final Report - Figures},
  booktitle = {Proceedings of The Eighth Text REtrieval Conference, {TREC} 1999,
               Gaithersburg, Maryland, USA, November 17-19, 1999},
  volume    = {Special Publication 500-246},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {1999},
  url       = {http://trec.nist.gov/pubs/trec8/papers/filtering\_figs.pdf},
  timestamp = {Tue, 07 Apr 2015 13:04:04 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/HullR99a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/MacFarlaneRM99,
  author    = {Andrew MacFarlane and
               Stephen E. Robertson and
               Julie A. McCann},
  editor    = {Ellen M. Voorhees and
               Donna K. Harman},
  title     = {{PLIERS} at {TREC8}},
  booktitle = {Proceedings of The Eighth Text REtrieval Conference, {TREC} 1999,
               Gaithersburg, Maryland, USA, November 17-19, 1999},
  volume    = {Special Publication 500-246},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {1999},
  url       = {http://trec.nist.gov/pubs/trec8/papers/pliers8.pdf},
  timestamp = {Wed, 04 Nov 2015 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/trec/MacFarlaneRM99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/MacFarlaneRM99a,
  author    = {Andrew MacFarlane and
               Stephen E. Robertson and
               Julie A. McCann},
  editor    = {Ellen M. Voorhees and
               Donna K. Harman},
  title     = {{PLIERS} at {TREC8} - Appendix},
  booktitle = {Proceedings of The Eighth Text REtrieval Conference, {TREC} 1999,
               Gaithersburg, Maryland, USA, November 17-19, 1999},
  volume    = {Special Publication 500-246},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {1999},
  url       = {http://trec.nist.gov/pubs/trec8/papers/pl8-appen.pdf},
  timestamp = {Wed, 04 Nov 2015 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/trec/MacFarlaneRM99a.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/RobertsonW99,
  author    = {Stephen E. Robertson and
               Steve Walker},
  editor    = {Ellen M. Voorhees and
               Donna K. Harman},
  title     = {Okapi/Keenbow at {TREC-8}},
  booktitle = {Proceedings of The Eighth Text REtrieval Conference, {TREC} 1999,
               Gaithersburg, Maryland, USA, November 17-19, 1999},
  volume    = {Special Publication 500-246},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {1999},
  url       = {http://trec.nist.gov/pubs/trec8/papers/okapi.pdf},
  timestamp = {Tue, 07 Apr 2015 13:04:04 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/RobertsonW99.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/Robertson98,
  author    = {Stephen E. Robertson},
  title     = {Cyril W. Cleverdon (In Memoriam)},
  journal   = {{JASIS}},
  volume    = {49},
  number    = {10},
  pages     = {866},
  year      = {1998},
  url       = {https://doi.org/10.1002/(SICI)1097-4571(199808)49:10\&\#60;866::AID-ASI2\&\#62;3.0.CO;2-F},
  doi       = {10.1002/(SICI)1097-4571(199808)49:10\&\#60;866::AID-ASI2\&\#62;3.0.CO;2-F},
  timestamp = {Sun, 28 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/jasis/Robertson98.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ecir/ManglanoBR98,
  author    = {Victoria Manglano and
               Micheline Beaulieu and
               Stephen E. Robertson},
  title     = {Evaluation of Interfaces for {IRS:} Modelling End-User Searching Behaviour},
  booktitle = {20th Annual {BCS-IRSG} Colloquium on IR, Autrans, France. 25th-27th
               March 1998},
  series    = {Workshops in Computing},
  publisher = {{BCS}},
  year      = {1998},
  url       = {http://ewic.bcs.org/content/ConWebDoc/4411},
  timestamp = {Wed, 11 Jun 2014 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/conf/ecir/ManglanoBR98.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/RobertsonWB98,
  author    = {Stephen E. Robertson and
               Steve Walker and
               Micheline Hancock{-}Beaulieu},
  editor    = {Ellen M. Voorhees and
               Donna K. Harman},
  title     = {Okapi at {TREC-7:} Automatic Ad Hoc, Filtering, {VLC} and Interactive},
  booktitle = {Proceedings of The Seventh Text REtrieval Conference, {TREC} 1998,
               Gaithersburg, Maryland, USA, November 9-11, 1998},
  volume    = {Special Publication 500-242},
  pages     = {199--210},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {1998},
  timestamp = {Tue, 07 Apr 2015 13:04:04 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/RobertsonWB98.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/MacFarlaneRM98,
  author    = {Andrew MacFarlane and
               Stephen E. Robertson and
               Julie A. McCann},
  editor    = {Ellen M. Voorhees and
               Donna K. Harman},
  title     = {{PLIERS} {AT} {VLC2}},
  booktitle = {Proceedings of The Seventh Text REtrieval Conference, {TREC} 1998,
               Gaithersburg, Maryland, USA, November 9-11, 1998},
  volume    = {Special Publication 500-242},
  pages     = {271--280},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {1998},
  timestamp = {Wed, 04 Nov 2015 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/trec/MacFarlaneRM98.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jd/Robertson97,
  author    = {Stephen E. Robertson},
  title     = {Overview of the Okapi projects},
  journal   = {Journal of Documentation},
  volume    = {53},
  number    = {1},
  pages     = {3--7},
  year      = {1997},
  url       = {https://doi.org/10.1108/EUM0000000007186},
  doi       = {10.1108/EUM0000000007186},
  timestamp = {Sat, 24 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/jd/Robertson97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jd/RobertsonWB97,
  author    = {Stephen E. Robertson and
               Steve Walker and
               Micheline Beaulieu},
  title     = {Laboratory experiments with Okapi: participation in the {TREC} programme},
  journal   = {Journal of Documentation},
  volume    = {53},
  number    = {1},
  pages     = {20--34},
  year      = {1997},
  url       = {https://doi.org/10.1108/EUM0000000007188},
  doi       = {10.1108/EUM0000000007188},
  timestamp = {Sat, 24 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/jd/RobertsonWB97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jd/RobertsonB97,
  author    = {Stephen E. Robertson and
               Micheline Beaulieu},
  title     = {Research and evaluation in information retrieval},
  journal   = {Journal of Documentation},
  volume    = {53},
  number    = {1},
  pages     = {51--57},
  year      = {1997},
  url       = {https://doi.org/10.1108/EUM0000000007190},
  doi       = {10.1108/EUM0000000007190},
  timestamp = {Sat, 24 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/jd/RobertsonB97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jd/HuangR97,
  author    = {Xiangji Huang and
               Stephen E. Robertson},
  title     = {Application of probabilistic methods to Chinese},
  journal   = {Journal of Documentation},
  volume    = {53},
  number    = {1},
  pages     = {74--79},
  year      = {1997},
  url       = {https://doi.org/10.1108/EUM0000000007193},
  doi       = {10.1108/EUM0000000007193},
  timestamp = {Sat, 24 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/jd/HuangR97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jd/MacFarlaneRM97,
  author    = {Andy MacFarlane and
               Stephen E. Robertson and
               Julie A. McCann},
  title     = {Parallel computing in information retrieval - an updated review},
  journal   = {Journal of Documentation},
  volume    = {53},
  number    = {3},
  pages     = {274--315},
  year      = {1997},
  url       = {https://doi.org/10.1108/EUM0000000007201},
  doi       = {10.1108/EUM0000000007201},
  timestamp = {Sat, 24 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/jd/MacFarlaneRM97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/RobertsonW97,
  author    = {Stephen E. Robertson and
               Steve Walker},
  editor    = {Nicholas J. Belkin and
               A. Desai Narasimhalu and
               Peter Willett and
               William R. Hersh and
               Fazli Can and
               Ellen M. Voorhees},
  title     = {On Relevance Weights with Little Relevance Information},
  booktitle = {{SIGIR} '97: Proceedings of the 20th Annual International {ACM} {SIGIR}
               Conference on Research and Development in Information Retrieval, July
               27-31, 1997, Philadelphia, PA, {USA}},
  pages     = {16--24},
  publisher = {{ACM}},
  year      = {1997},
  url       = {https://doi.org/10.1145/258525.258529},
  doi       = {10.1145/258525.258529},
  timestamp = {Tue, 06 Nov 2018 11:07:25 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/RobertsonW97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/WalkerRBJJ97,
  author    = {Steve Walker and
               Stephen E. Robertson and
               Mohand Boughanem and
               Gareth J. F. Jones and
               Karen Sparck Jones},
  editor    = {Ellen M. Voorhees and
               Donna K. Harman},
  title     = {Okapi at {TREC-6} Automatic ad hoc, VLC, routing, filtering and {QSDR}},
  booktitle = {Proceedings of The Sixth Text REtrieval Conference, {TREC} 1997, Gaithersburg,
               Maryland, USA, November 19-21, 1997},
  volume    = {Special Publication 500-240},
  pages     = {125--136},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {1997},
  url       = {http://trec.nist.gov/pubs/trec6/papers/city\_proc\_auto.ps},
  timestamp = {Tue, 07 Apr 2015 13:04:04 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/WalkerRBJJ97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/HuangR97,
  author    = {Xiangji Huang and
               Stephen E. Robertson},
  editor    = {Ellen M. Voorhees and
               Donna K. Harman},
  title     = {Okapi Chinese Text Retrieval Experiments at {TREC-6}},
  booktitle = {Proceedings of The Sixth Text REtrieval Conference, {TREC} 1997, Gaithersburg,
               Maryland, USA, November 19-21, 1997},
  volume    = {Special Publication 500-240},
  pages     = {137--142},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {1997},
  url       = {http://trec.nist.gov/pubs/trec6/papers/city\_proc\_chinese.ps},
  timestamp = {Tue, 07 Apr 2015 13:04:04 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/HuangR97.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/BeaulieuRR96,
  author    = {Micheline Hancock{-}Beaulieu and
               Stephen E. Robertson and
               Edie M. Rasmussen},
  title     = {Evaluating Interactive Systems in {TREC}},
  journal   = {{JASIS}},
  volume    = {47},
  number    = {1},
  pages     = {85--94},
  year      = {1996},
  url       = {https://doi.org/10.1002/(SICI)1097-4571(199601)47:1\&\#60;85::AID-ASI8\&\#62;3.0.CO;2-Z},
  doi       = {10.1002/(SICI)1097-4571(199601)47:1\&\#60;85::AID-ASI8\&\#62;3.0.CO;2-Z},
  timestamp = {Sun, 28 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/jasis/BeaulieuRR96.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jd/AgostiBCFFHIKKR96,
  author    = {Maristella Agosti and
               Micheline Beaulieu and
               Cyril W. Cleverdon and
               Hans{-}Peter Frei and
               Norbert Fuhr and
               David J. Harper and
               Peter Ingwersen and
               E. Michael Keen and
               Rainer Kuhlen and
               Stephen E. Robertson and
               Alan F. Smeaton and
               Karen Sparck Jones and
               Keith van Rijsbergen and
               Peter Willett},
  title     = {Gerard (Gerry) Salton},
  journal   = {Journal of Documentation},
  volume    = {52},
  number    = {1},
  pages     = {1--2},
  year      = {1996},
  url       = {https://doi.org/10.1108/eb026959},
  doi       = {10.1108/eb026959},
  timestamp = {Sat, 24 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/jd/AgostiBCFFHIKKR96.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/Hancock-BeaulieuGHRWW96,
  author    = {Micheline Hancock{-}Beaulieu and
               Mike Gatford and
               Xiangji Huang and
               Stephen E. Robertson and
               Steve Walker and
               P. W. Williams},
  editor    = {Ellen M. Voorhees and
               Donna K. Harman},
  title     = {Okapi at {TREC-5}},
  booktitle = {Proceedings of The Fifth Text REtrieval Conference, {TREC} 1996, Gaithersburg,
               Maryland, USA, November 20-22, 1996},
  volume    = {Special Publication 500-238},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {1996},
  url       = {http://trec.nist.gov/pubs/trec5/papers/city.procpaper.ps.gz},
  timestamp = {Tue, 07 Apr 2015 13:04:03 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/Hancock-BeaulieuGHRWW96.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/RobertsonWH95,
  author    = {Stephen E. Robertson and
               Steve Walker and
               Micheline Hancock{-}Beaulieu},
  title     = {Large Test Collection Experiments on an Operational, Interactive System:
               Okapi at {TREC}},
  journal   = {Inf. Process. Manage.},
  volume    = {31},
  number    = {3},
  pages     = {345--360},
  year      = {1995},
  url       = {https://doi.org/10.1016/0306-4573(94)00051-4},
  doi       = {10.1016/0306-4573(94)00051-4},
  timestamp = {Thu, 18 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ipm/RobertsonWH95.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/JonesGRHSW95,
  author    = {Susan Jones and
               Mike Gatford and
               Stephen E. Robertson and
               Micheline Hancock{-}Beaulieu and
               Judith Secker and
               Steve Walker},
  title     = {Interactive Thesaurus Navigation: Intelligence Rules OK?},
  journal   = {{JASIS}},
  volume    = {46},
  number    = {1},
  pages     = {52--59},
  year      = {1995},
  url       = {https://doi.org/10.1002/(SICI)1097-4571(199501)46:1\&\#60;52::AID-ASI6\&\#62;3.0.CO;2-1},
  doi       = {10.1002/(SICI)1097-4571(199501)46:1\&\#60;52::AID-ASI6\&\#62;3.0.CO;2-1},
  timestamp = {Sun, 28 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/jasis/JonesGRHSW95.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/RobertsonWHGP95,
  author    = {Stephen E. Robertson and
               Steve Walker and
               Micheline Hancock{-}Beaulieu and
               Mike Gatford and
               A. Payne},
  editor    = {Donna K. Harman},
  title     = {Okapi at {TREC-4}},
  booktitle = {Proceedings of The Fourth Text REtrieval Conference, {TREC} 1995,
               Gaithersburg, Maryland, USA, November 1-3, 1995},
  volume    = {Special Publication 500-236},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {1995},
  url       = {http://trec.nist.gov/pubs/trec4/papers/city.ps.gz},
  timestamp = {Tue, 07 Apr 2015 13:04:04 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/RobertsonWHGP95.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jd/Robertson94,
  author    = {Stephen E. Robertson},
  title     = {Documentation note Query-Document Symmetry and Dual Models},
  journal   = {Journal of Documentation},
  volume    = {50},
  number    = {3},
  pages     = {233--238},
  year      = {1994},
  url       = {https://doi.org/10.1108/eb026932},
  doi       = {10.1108/eb026932},
  timestamp = {Sat, 24 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/jd/Robertson94.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/RobertsonW94,
  author    = {Stephen E. Robertson and
               Steve Walker},
  editor    = {W. Bruce Croft and
               C. J. van Rijsbergen},
  title     = {Some Simple Effective Approximations to the 2-Poisson Model for Probabilistic
               Weighted Retrieval},
  booktitle = {Proceedings of the 17th Annual International {ACM-SIGIR} Conference
               on Research and Development in Information Retrieval. Dublin, Ireland,
               3-6 July 1994 (Special Issue of the {SIGIR} Forum)},
  pages     = {232--241},
  publisher = {ACM/Springer},
  year      = {1994},
  url       = {https://doi.org/10.1007/978-1-4471-2099-5\_24},
  doi       = {10.1007/978-1-4471-2099-5\_24},
  timestamp = {Thu, 25 Jul 2019 17:43:05 +0200},
  biburl    = {https://dblp.org/rec/conf/sigir/RobertsonW94.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/RobertsonWJHG94,
  author    = {Stephen E. Robertson and
               Steve Walker and
               Susan Jones and
               Micheline Hancock{-}Beaulieu and
               Mike Gatford},
  editor    = {Donna K. Harman},
  title     = {Okapi at {TREC-3}},
  booktitle = {Proceedings of The Third Text REtrieval Conference, {TREC} 1994, Gaithersburg,
               Maryland, USA, November 2-4, 1994},
  volume    = {Special Publication 500-225},
  pages     = {109--126},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {1994},
  url       = {http://trec.nist.gov/pubs/trec3/papers/city.ps.gz},
  timestamp = {Tue, 07 Apr 2015 13:04:04 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/RobertsonWJHG94.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/RobertsonWJHG93,
  author    = {Stephen E. Robertson and
               Steve Walker and
               Susan Jones and
               Micheline Hancock{-}Beaulieu and
               Mike Gatford},
  editor    = {Donna K. Harman},
  title     = {Okapi at {TREC-2}},
  booktitle = {Proceedings of The Second Text REtrieval Conference, {TREC} 1993,
               Gaithersburg, Maryland, USA, August 31 - September 2, 1993},
  volume    = {Special Publication 500-215},
  pages     = {21--34},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {1993},
  url       = {http://trec.nist.gov/pubs/trec2/papers/ps/city.ps},
  timestamp = {Tue, 07 Apr 2015 13:04:04 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/RobertsonWJHG93.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/CooperR93,
  author    = {William S. Cooper and
               Stephen E. Robertson},
  editor    = {Donna K. Harman},
  title     = {Workshop Report - Use of Training Materials in Constructing Routing
               Queries},
  booktitle = {Proceedings of The Second Text REtrieval Conference, {TREC} 1993,
               Gaithersburg, Maryland, USA, August 31 - September 2, 1993},
  volume    = {Special Publication 500-215},
  pages     = {305},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {1993},
  url       = {http://trec.nist.gov/pubs/trec2/discuss\_grps/02.txt},
  timestamp = {Tue, 07 Apr 2015 13:04:04 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/CooperR93.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/RobertsonH92,
  author    = {Stephen E. Robertson and
               Micheline Hancock{-}Beaulieu},
  title     = {On the Evaluation of {IR} Systems},
  journal   = {Inf. Process. Manage.},
  volume    = {28},
  number    = {4},
  pages     = {457--466},
  year      = {1992},
  url       = {https://doi.org/10.1016/0306-4573(92)90004-J},
  doi       = {10.1016/0306-4573(92)90004-J},
  timestamp = {Thu, 18 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ipm/RobertsonH92.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/RobertsonWHGL92,
  author    = {Stephen E. Robertson and
               Steve Walker and
               Micheline Hancock{-}Beaulieu and
               Aarron Gull and
               Marianna Lau},
  editor    = {Donna K. Harman},
  title     = {Okapi at {TREC}},
  booktitle = {Proceedings of The First Text REtrieval Conference, {TREC} 1992, Gaithersburg,
               Maryland, USA, November 4-6, 1992},
  volume    = {Special Publication 500-207},
  pages     = {21--30},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {1992},
  url       = {http://trec.nist.gov/pubs/trec1/papers/02.txt},
  timestamp = {Tue, 07 Apr 2015 13:04:04 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/RobertsonWHGL92.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/trec/FuhrR92,
  author    = {Norbert Fuhr and
               Stephen E. Robertson},
  editor    = {Donna K. Harman},
  title     = {Machine Learning and Relevance Feedback},
  booktitle = {Proceedings of The First Text REtrieval Conference, {TREC} 1992, Gaithersburg,
               Maryland, USA, November 4-6, 1992},
  volume    = {Special Publication 500-207},
  pages     = {369--370},
  publisher = {National Institute of Standards and Technology {(NIST)}},
  year      = {1992},
  url       = {http://trec.nist.gov/pubs/trec1/discuss\_grps/03.txt},
  timestamp = {Tue, 07 Apr 2015 13:04:04 +0200},
  biburl    = {https://dblp.org/rec/conf/trec/FuhrR92.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/Hancock-BeaulieuRN91,
  author    = {Micheline Hancock{-}Beaulieu and
               Stephen E. Robertson and
               Colin Neilson},
  title     = {Evaluation of online catalogues: Eliciting information from the user},
  journal   = {Inf. Process. Manage.},
  volume    = {27},
  number    = {5},
  pages     = {523--532},
  year      = {1991},
  url       = {https://doi.org/10.1016/0306-4573(91)90067-V},
  doi       = {10.1016/0306-4573(91)90067-V},
  timestamp = {Thu, 18 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ipm/Hancock-BeaulieuRN91.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/Robertson90,
  author    = {Stephen E. Robertson},
  title     = {On sample sizes for non-matched-pair {IR} experiments},
  journal   = {Inf. Process. Manage.},
  volume    = {26},
  number    = {6},
  pages     = {739--753},
  year      = {1990},
  url       = {https://doi.org/10.1016/0306-4573(90)90049-8},
  doi       = {10.1016/0306-4573(90)90049-8},
  timestamp = {Thu, 18 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ipm/Robertson90.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jd/Robertson90,
  author    = {Stephen E. Robertson},
  title     = {On Term Selection for Query Expansion},
  journal   = {Journal of Documentation},
  volume    = {46},
  number    = {4},
  pages     = {359--364},
  year      = {1990},
  url       = {https://doi.org/10.1108/eb026866},
  doi       = {10.1108/eb026866},
  timestamp = {Sat, 24 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/jd/Robertson90.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jis/Robertson90,
  author    = {Stephen E. Robertson},
  title     = {{B.C.} Brookes and information science education: a personal note},
  journal   = {J. Inf. Sci.},
  volume    = {16},
  number    = {1},
  pages     = {9--10},
  year      = {1990},
  url       = {https://doi.org/10.1177/016555159001600103},
  doi       = {10.1177/016555159001600103},
  timestamp = {Thu, 06 Jun 2019 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/jis/Robertson90.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/RobertsonMC82,
  author    = {Stephen E. Robertson and
               M. E. Maron and
               William S. Cooper},
  editor    = {Gerard Salton and
               Hans{-}Jochen Schneider},
  title     = {The Unified Probabilistic Model for {IR}},
  booktitle = {Research and Development in Information Retrieval, Proceedings, Berlin,
               May 18-20, 1982},
  series    = {Lecture Notes in Computer Science},
  volume    = {146},
  pages     = {108--117},
  publisher = {Springer},
  year      = {1982},
  url       = {https://doi.org/10.1007/BFb0036342},
  doi       = {10.1007/BFb0036342},
  timestamp = {Tue, 14 May 2019 10:00:40 +0200},
  biburl    = {https://dblp.org/rec/conf/sigir/RobertsonMC82.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/Robertson81,
  author    = {Stephen E. Robertson},
  editor    = {Carolyn J. Crouch},
  title     = {Term Frequency and Term Value},
  booktitle = {Theoretical Issues in Information Retrieval, Proceedings of the Fourth
               International Conference on Information Storage and Retrieval, Oakland,
               California, USA, May 31 - June 2, 1981},
  pages     = {22--29},
  publisher = {{ACM}},
  year      = {1981},
  url       = {https://doi.org/10.1145/511754.511758},
  doi       = {10.1145/511754.511758},
  timestamp = {Tue, 06 Nov 2018 11:07:22 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/Robertson81.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/sigir/80,
  editor    = {Robert N. Oddy and
               Stephen E. Robertson and
               C. J. van Rijsbergen and
               P. W. Williams},
  title     = {Information Retrieval Research, Proc. Joint {ACM/BCS} Symposium in
               Information Storage and Retrieval, Cambridge, UK, June 1980},
  publisher = {Butterworths},
  year      = {1981},
  url       = {https://dl.acm.org/citation.cfm?id=636669},
  isbn      = {0-408-10775-8},
  timestamp = {Mon, 26 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/80.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sigir/RobertsonRP80,
  author    = {Stephen E. Robertson and
               C. J. van Rijsbergen and
               Martin F. Porter},
  editor    = {Robert N. Oddy and
               Stephen E. Robertson and
               C. J. van Rijsbergen and
               P. W. Williams},
  title     = {Probabilistic Models of Indexing and Searching},
  booktitle = {Information Retrieval Research, Proc. Joint {ACM/BCS} Symposium in
               Information Storage and Retrieval, Cambridge, UK, June 1980},
  pages     = {35--56},
  publisher = {Butterworths},
  year      = {1980},
  url       = {http://dl.acm.org/citation.cfm?id=636673},
  timestamp = {Mon, 26 Nov 2018 17:05:48 +0100},
  biburl    = {https://dblp.org/rec/conf/sigir/RobertsonRP80.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/Robertson79,
  author    = {Stephen E. Robertson},
  title     = {On Fuzzy sets: Reply to Cerny},
  journal   = {{JASIS}},
  volume    = {30},
  number    = {6},
  pages     = {357--358},
  year      = {1979},
  url       = {https://doi.org/10.1002/asi.4630300611},
  doi       = {10.1002/asi.4630300611},
  timestamp = {Sun, 28 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/jasis/Robertson79.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/Robertson78,
  author    = {Stephen E. Robertson},
  title     = {On the nature of fuzz: {A} diatribe},
  journal   = {{JASIS}},
  volume    = {29},
  number    = {6},
  pages     = {304--307},
  year      = {1978},
  url       = {https://doi.org/10.1002/asi.4630290607},
  doi       = {10.1002/asi.4630290607},
  timestamp = {Sun, 28 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/jasis/Robertson78.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jd/RobertsonB78,
  author    = {Stephen E. Robertson and
               Nicholas J. Belkin},
  title     = {Ranking in Principle},
  journal   = {Journal of Documentation},
  volume    = {34},
  number    = {2},
  pages     = {93--100},
  year      = {1978},
  url       = {https://doi.org/10.1108/eb026654},
  doi       = {10.1108/eb026654},
  timestamp = {Sat, 24 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/jd/RobertsonB78.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/Robertson77,
  author    = {Stephen E. Robertson},
  title     = {The probabilistic character of relevance},
  journal   = {Inf. Process. Manage.},
  volume    = {13},
  number    = {4},
  pages     = {247--251},
  year      = {1977},
  url       = {https://doi.org/10.1016/0306-4573(77)90005-X},
  doi       = {10.1016/0306-4573(77)90005-X},
  timestamp = {Thu, 18 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/ipm/Robertson77.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/RobertsonJ76,
  author    = {Stephen E. Robertson and
               Karen Sp{\"{a}}rck Jones},
  title     = {Relevance weighting of search terms},
  journal   = {{JASIS}},
  volume    = {27},
  number    = {3},
  pages     = {129--146},
  year      = {1976},
  url       = {https://doi.org/10.1002/asi.4630270302},
  doi       = {10.1002/asi.4630270302},
  timestamp = {Wed, 14 Nov 2018 00:00:00 +0100},
  biburl    = {https://dblp.org/rec/journals/jasis/RobertsonJ76.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/BelkinR76,
  author    = {Nicholas J. Belkin and
               Stephen E. Robertson},
  title     = {Information science and the phenomenon of information},
  journal   = {{JASIS}},
  volume    = {27},
  number    = {4},
  pages     = {197--204},
  year      = {1976},
  url       = {https://doi.org/10.1002/asi.4630270402},
  doi       = {10.1002/asi.4630270402},
  timestamp = {Sun, 28 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/jasis/BelkinR76.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/Robertson75,
  author    = {Stephen E. Robertson},
  title     = {Explicit and implicit variables in information retrieval {(IR)} systems},
  journal   = {{JASIS}},
  volume    = {26},
  number    = {4},
  pages     = {214--222},
  year      = {1975},
  url       = {https://doi.org/10.1002/asi.4630260404},
  doi       = {10.1002/asi.4630260404},
  timestamp = {Sun, 28 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/jasis/Robertson75.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jasis/RobertsonC74,
  author    = {Stephen E. Robertson and
               William S. Cooper},
  title     = {In Defence of Relevance},
  journal   = {{JASIS}},
  volume    = {25},
  number    = {3},
  pages     = {208--209},
  year      = {1974},
  url       = {https://doi.org/10.1002/asi.4630250313},
  doi       = {10.1002/asi.4630250313},
  timestamp = {Sun, 28 May 2017 01:00:00 +0200},
  biburl    = {https://dblp.org/rec/journals/jasis/RobertsonC74.bib},
  bibsource = {dblp computer science bibliography, https://dblp.org}
}
a service of Schloss Dagstuhl - Leibniz Center for Informatics