BibTeX records: Alejandro Rodríguez González

download as .bib file

@article{DBLP:journals/corr/abs-2402-10967,
  author       = {Jos{\'{e}} Alberto Ben{\'{\i}}tez{-}Andrades and
                  Isa{\'{\i}}as Garc{\'{\i}}a{-}Rodr{\'{\i}}guez and
                  Carmen Benavides and
                  H{\'{e}}ctor Alaiz{-}Moret{\'{o}}n and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {Social network analysis for personalized characterization and risk
                  assessment of alcohol use disorders in adolescents using semantic
                  technologies},
  journal      = {CoRR},
  volume       = {abs/2402.10967},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2402.10967},
  doi          = {10.48550/ARXIV.2402.10967},
  eprinttype    = {arXiv},
  eprint       = {2402.10967},
  timestamp    = {Mon, 26 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2402-10967.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2402-12390,
  author       = {Jos{\'{e}} Alberto Ben{\'{\i}}tez{-}Andrades and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Carmen Benavides and
                  Leticia S{\'{a}}nchez{-}Valde{\'{o}}n and
                  Isa{\'{\i}}as Garc{\'{\i}}a},
  title        = {A Semantic Social Network Analysis Tool for Sensitivity Analysis and
                  What-If Scenario Testing in Alcohol Consumption Studies},
  journal      = {CoRR},
  volume       = {abs/2402.12390},
  year         = {2024},
  url          = {https://doi.org/10.48550/arXiv.2402.12390},
  doi          = {10.48550/ARXIV.2402.12390},
  eprinttype    = {arXiv},
  eprint       = {2402.12390},
  timestamp    = {Thu, 21 Mar 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2402-12390.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/artmed/MunozSCSG23,
  author       = {Adri{\'{a}}n Ayuso Mu{\~{n}}oz and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Esther Ugarte Carro and
                  Emilio Serrano and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {Uncovering hidden therapeutic indications through drug repurposing
                  with graph neural networks and heterogeneous data},
  journal      = {Artif. Intell. Medicine},
  volume       = {145},
  pages        = {102687},
  year         = {2023},
  url          = {https://doi.org/10.1016/j.artmed.2023.102687},
  doi          = {10.1016/J.ARTMED.2023.102687},
  timestamp    = {Sun, 17 Dec 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/artmed/MunozSCSG23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/semweb/AisoposJNPRSIVM23,
  author       = {Fotis Aisopos and
                  Samaneh Jozashoori and
                  Emetis Niazmand and
                  Disha Purohit and
                  Ariam Rivas and
                  Ahmad Sakor and
                  Enrique Iglesias and
                  Dimitrios Vogiatzis and
                  Ernestina Menasalvas and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Guillermo Vigueras and
                  Daniel G{\'{o}}mez{-}Bravo and
                  Maria Torrente and
                  Roberto Hern{\'{a}}ndez L{\'{o}}pez and
                  Mariano Provencio Pulla and
                  Athanasios Dalianis and
                  Anna Triantafillou and
                  Georgios Paliouras and
                  Maria{-}Esther Vidal},
  title        = {Knowledge graphs for enhancing transparency in health data ecosystems},
  journal      = {Semantic Web},
  volume       = {14},
  number       = {5},
  pages        = {943--976},
  year         = {2023},
  url          = {https://doi.org/10.3233/SW-223294},
  doi          = {10.3233/SW-223294},
  timestamp    = {Sat, 03 Jun 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/semweb/AisoposJNPRSIVM23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/PerezSCOMG23,
  author       = {Andrea {\'{A}}lvarez P{\'{e}}rez and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Esther Ugarte Carro and
                  Bel{\'{e}}n Otero{-}Carrasco and
                  Adri{\'{a}}n Ayuso Mu{\~{n}}oz and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {Jo{\~{a}}o Rafael Almeida and
                  Myra Spiliopoulou and
                  Jos{\'{e}} Alberto Ben{\'{\i}}tez{-}Andrades and
                  Giuseppe Placidi and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Rosa Sicilia and
                  Bridget Kane},
  title        = {Exploring disease-drug pairs in Clinical Trials information for personalized
                  drug repurposing},
  booktitle    = {36th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2023, L'Aquila, Italy, June 22-24, 2023},
  pages        = {179--184},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/CBMS58004.2023.00213},
  doi          = {10.1109/CBMS58004.2023.00213},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/PerezSCOMG23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/OteroCarrascoRPMSHG23,
  author       = {Bel{\'{e}}n Otero{-}Carrasco and
                  Santiago Romero{-}Brufau and
                  Andrea {\'{A}}lvarez P{\'{e}}rez and
                  Adri{\'{a}}n Ayuso Mu{\~{n}}oz and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Juan Pedro Cara{\c{c}}a{-}Valente Hern{\'{a}}ndez and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {Jo{\~{a}}o Rafael Almeida and
                  Myra Spiliopoulou and
                  Jos{\'{e}} Alberto Ben{\'{\i}}tez{-}Andrades and
                  Giuseppe Placidi and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Rosa Sicilia and
                  Bridget Kane},
  title        = {Orphan Drugs and Rare Diseases: Unveiling Biological Patterns through
                  Drug Repurposing},
  booktitle    = {36th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2023, L'Aquila, Italy, June 22-24, 2023},
  pages        = {185--191},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/CBMS58004.2023.00214},
  doi          = {10.1109/CBMS58004.2023.00214},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/OteroCarrascoRPMSHG23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/MunozSAOSG23,
  author       = {Adri{\'{a}}n Ayuso Mu{\~{n}}oz and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Andrea {\'{A}}lverez{-}P{\'{e}}rez and
                  Bel{\'{e}}n Otero{-}Carrasco and
                  Emilio Serrano and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {Jo{\~{a}}o Rafael Almeida and
                  Myra Spiliopoulou and
                  Jos{\'{e}} Alberto Ben{\'{\i}}tez{-}Andrades and
                  Giuseppe Placidi and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Rosa Sicilia and
                  Bridget Kane},
  title        = {Enhancing Drug Repurposing on Graphs by Integrating Drug Molecular
                  Structure as Feature},
  booktitle    = {36th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2023, L'Aquila, Italy, June 22-24, 2023},
  pages        = {192--197},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/CBMS58004.2023.00215},
  doi          = {10.1109/CBMS58004.2023.00215},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/MunozSAOSG23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/GomezBravoGVRPOTMPG23,
  author       = {Daniel G{\'{o}}mez{-}Bravo and
                  Aaron Garc{\'{\i}}a and
                  Guillermo Vigueras and
                  Bel{\'{e}}n R{\'{\i}}os{-}S{\'{a}}nchez and
                  Alejandra P{\'{e}}rez{-}Garc{\'{\i}}a and
                  Vanessa Ospina and
                  Mar{\'{\i}}a Torrente and
                  Ernestina Menasalvas and
                  Mariano Provencio and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {Jo{\~{a}}o Rafael Almeida and
                  Myra Spiliopoulou and
                  Jos{\'{e}} Alberto Ben{\'{\i}}tez{-}Andrades and
                  Giuseppe Placidi and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Rosa Sicilia and
                  Bridget Kane},
  title        = {Clustering-based Pattern Discovery in Lung Cancer Treatments},
  booktitle    = {36th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2023, L'Aquila, Italy, June 22-24, 2023},
  pages        = {694--699},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/CBMS58004.2023.00302},
  doi          = {10.1109/CBMS58004.2023.00302},
  timestamp    = {Mon, 24 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/GomezBravoGVRPOTMPG23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pacbb/Tejera-NevadoSG23,
  author       = {Paloma Tejera{-}Nevado and
                  Emilio Serrano and
                  Ana Gonz{\'{a}}lez{-}Herrero and
                  Rodrigo Bermejo{-}Moreno and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {Miguel Rocha and
                  Florentino Fdez{-}Riverola and
                  Mohd Saberi Mohamad and
                  Ana Bel{\'{e}}n Gil Gonz{\'{a}}lez},
  title        = {Analysis of the Confidence in the Prediction of the Protein Folding
                  by Artificial Intelligence},
  booktitle    = {Practical Applications of Computational Biology and Bioinformatics,
                  17th International Conference {(PACBB} 2023), 12th-14th July, 2023,
                  Guimar{\~{a}}es, Portugal},
  series       = {Lecture Notes in Networks and Systems},
  volume       = {743},
  pages        = {84--93},
  publisher    = {Springer},
  year         = {2023},
  url          = {https://doi.org/10.1007/978-3-031-38079-2\_9},
  doi          = {10.1007/978-3-031-38079-2\_9},
  timestamp    = {Mon, 17 Jul 2023 15:40:46 +0200},
  biburl       = {https://dblp.org/rec/conf/pacbb/Tejera-NevadoSG23.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cbms/2023,
  editor       = {Jo{\~{a}}o Rafael Almeida and
                  Myra Spiliopoulou and
                  Jos{\'{e}} Alberto Ben{\'{\i}}tez{-}Andrades and
                  Giuseppe Placidi and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Rosa Sicilia and
                  Bridget Kane},
  title        = {36th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2023, L'Aquila, Italy, June 22-24, 2023},
  publisher    = {{IEEE}},
  year         = {2023},
  url          = {https://doi.org/10.1109/CBMS58004.2023},
  doi          = {10.1109/CBMS58004.2023},
  isbn         = {979-8-3503-1224-9},
  timestamp    = {Mon, 24 Jul 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/2023.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2307-15089,
  author       = {Daniel G{\'{o}}mez{-}Bravo and
                  Aaron Garc{\'{\i}}a and
                  Guillermo Vigueras and
                  Bel{\'{e}}n R{\'{\i}}os{-}S{\'{a}}nchez and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {A new algorithm for Subgroup Set Discovery based on Information Gain},
  journal      = {CoRR},
  volume       = {abs/2307.15089},
  year         = {2023},
  url          = {https://doi.org/10.48550/arXiv.2307.15089},
  doi          = {10.48550/ARXIV.2307.15089},
  eprinttype    = {arXiv},
  eprint       = {2307.15089},
  timestamp    = {Wed, 02 Aug 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2307-15089.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/istr/Diaz-HonrubiaBS22,
  author       = {Antonio Jes{\'{u}}s D{\'{\i}}az{-}Honrubia and
                  Alberto Bl{\'{a}}zquez{-}Herranz and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Ernestina Menasalvas Ruiz and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Gustavo {Gonzalez Granadillo} and
                  Rodrigo Diaz and
                  Emmanouil Panaousis and
                  Christos Xenakis},
  title        = {A Trusted Platform Module-based, Pre-emptive and Dynamic Asset Discovery
                  Tool},
  journal      = {J. Inf. Secur. Appl.},
  volume       = {71},
  pages        = {103350},
  year         = {2022},
  url          = {https://doi.org/10.1016/j.jisa.2022.103350},
  doi          = {10.1016/J.JISA.2022.103350},
  timestamp    = {Tue, 28 Feb 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/istr/Diaz-HonrubiaBS22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/peerj-cs/PabonMTGPM22,
  author       = {Oswaldo Solarte Pab{\'{o}}n and
                  Orlando Montenegro and
                  Maria Torrente and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Mariano Provencio and
                  Ernestina Menasalvas},
  title        = {Negation and uncertainty detection in clinical texts written in Spanish:
                  a deep learning-based approach},
  journal      = {PeerJ Comput. Sci.},
  volume       = {8},
  pages        = {e913},
  year         = {2022},
  url          = {https://doi.org/10.7717/peerj-cs.913},
  doi          = {10.7717/PEERJ-CS.913},
  timestamp    = {Tue, 16 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/peerj-cs/PabonMTGPM22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/Gomez-BravoGVRO22,
  author       = {Daniel G{\'{o}}mez{-}Bravo and
                  Aaron Garc{\'{\i}}a and
                  Guillermo Vigueras and
                  Bel{\'{e}}n R{\'{\i}}os{-}S{\'{a}}nchez and
                  Bel{\'{e}}n Otero and
                  Roberto Hern{\'{a}}ndez L{\'{o}}pez and
                  Mar{\'{\i}}a Torrente and
                  Ernestina Menasalvas and
                  Mariano Provencio and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {Linlin Shen and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  KC Santosh and
                  Zhihui Lai and
                  Rosa Sicilia and
                  Jo{\~{a}}o Rafael Almeida and
                  Bridget Kane},
  title        = {Subgroup Discovery Analysis of Treatment Patterns in Lung Cancer Patients},
  booktitle    = {35th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2022, Shenzen, China, July 21-23, 2022},
  pages        = {1--7},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/CBMS55023.2022.00082},
  doi          = {10.1109/CBMS55023.2022.00082},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/Gomez-BravoGVRO22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/MunozCSORPG22,
  author       = {Adri{\'{a}}n Ayuso Mu{\~{n}}oz and
                  Esther Ugarte Carro and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Bel{\'{e}}n Otero{-}Carrasco and
                  Ernestina Menasalvas Ruiz and
                  Yuliana P{\'{e}}rez{-}Gallardo and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {Linlin Shen and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  KC Santosh and
                  Zhihui Lai and
                  Rosa Sicilia and
                  Jo{\~{a}}o Rafael Almeida and
                  Bridget Kane},
  title        = {{REDIRECTION:} Generating drug repurposing hypotheses using link prediction
                  with {DISNET} data},
  booktitle    = {35th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2022, Shenzen, China, July 21-23, 2022},
  pages        = {7--12},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/CBMS55023.2022.00009},
  doi          = {10.1109/CBMS55023.2022.00009},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/MunozCSORPG22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/Otero-CarrascoP22,
  author       = {Bel{\'{e}}n Otero{-}Carrasco and
                  Aurora P{\'{e}}rez{-}P{\'{e}}rez and
                  Ernestina Menasalvas Ruiz and
                  Juan Pedro Cara{\c{c}}a{-}Valente Hern{\'{a}}ndez and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {Linlin Shen and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  KC Santosh and
                  Zhihui Lai and
                  Rosa Sicilia and
                  Jo{\~{a}}o Rafael Almeida and
                  Bridget Kane},
  title        = {Drug repositioning with gender perspective focused on Adverse Drug
                  Reactions},
  booktitle    = {35th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2022, Shenzen, China, July 21-23, 2022},
  pages        = {435--440},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/CBMS55023.2022.00084},
  doi          = {10.1109/CBMS55023.2022.00084},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/Otero-CarrascoP22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ekaw/PerezISPBG22,
  author       = {Andrea {\'{A}}lvarez P{\'{e}}rez and
                  Ana Iglesias{-}Molina and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Mar{\'{\i}}a Poveda{-}Villal{\'{o}}n and
                  Carlos Badenes{-}Olmedo and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {{\'{O}}scar Corcho and
                  Laura Hollink and
                  Oliver Kutz and
                  Nicolas Troquard and
                  Fajar J. Ekaputra},
  title        = {{EBOCA:} Evidences for BiOmedical Concepts Association Ontology},
  booktitle    = {Knowledge Engineering and Knowledge Management - 23rd International
                  Conference, {EKAW} 2022, Bolzano, Italy, September 26-29, 2022, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {13514},
  pages        = {152--166},
  publisher    = {Springer},
  year         = {2022},
  url          = {https://doi.org/10.1007/978-3-031-17105-5\_11},
  doi          = {10.1007/978-3-031-17105-5\_11},
  timestamp    = {Mon, 24 Oct 2022 20:50:57 +0200},
  biburl       = {https://dblp.org/rec/conf/ekaw/PerezISPBG22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwinac/Otero-CarrascoS22,
  author       = {Bel{\'{e}}n Otero{-}Carrasco and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Esther Ugarte Carro and
                  Juan Pedro Cara{\c{c}}a{-}Valente Hern{\'{a}}ndez and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {Jos{\'{e}} Manuel Ferr{\'{a}}ndez de Vicente and
                  Jos{\'{e}} Ram{\'{o}}n {\'{A}}lvarez S{\'{a}}nchez and
                  F{\'{e}}lix de la Paz L{\'{o}}pez and
                  Hojjat Adeli},
  title        = {A Computational Drug Repositioning Method for Rare Diseases},
  booktitle    = {Bio-inspired Systems and Applications: from Robotics to Ambient Intelligence
                  - 9th International Work-Conference on the Interplay Between Natural
                  and Artificial Computation, {IWINAC} 2022, Puerto de la Cruz, Tenerife,
                  Spain, May 31 - June 3, 2022, Proceedings, Part {II}},
  series       = {Lecture Notes in Computer Science},
  volume       = {13259},
  pages        = {551--561},
  publisher    = {Springer},
  year         = {2022},
  url          = {https://doi.org/10.1007/978-3-031-06527-9\_55},
  doi          = {10.1007/978-3-031-06527-9\_55},
  timestamp    = {Mon, 13 Jun 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iwinac/Otero-CarrascoS22.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cbms/2022,
  editor       = {Linlin Shen and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  KC Santosh and
                  Zhihui Lai and
                  Rosa Sicilia and
                  Jo{\~{a}}o Rafael Almeida and
                  Bridget Kane},
  title        = {35th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2022, Shenzen, China, July 21-23, 2022},
  publisher    = {{IEEE}},
  year         = {2022},
  url          = {https://doi.org/10.1109/CMBS55023.2022},
  doi          = {10.1109/CMBS55023.2022},
  isbn         = {978-1-6654-6770-4},
  timestamp    = {Fri, 02 Sep 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/2022.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-2208-01093,
  author       = {Andrea {\'{A}}lvarez P{\'{e}}rez and
                  Ana Iglesias{-}Molina and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Mar{\'{\i}}a Poveda{-}Villal{\'{o}}n and
                  Carlos Badenes{-}Olmedo and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {{EBOCA:} Evidences for BiOmedical Concepts Association Ontology},
  journal      = {CoRR},
  volume       = {abs/2208.01093},
  year         = {2022},
  url          = {https://doi.org/10.48550/arXiv.2208.01093},
  doi          = {10.48550/ARXIV.2208.01093},
  eprinttype    = {arXiv},
  eprint       = {2208.01093},
  timestamp    = {Tue, 09 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-2208-01093.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ci/VenturaSG21,
  author       = {Sebasti{\'{a}}n Ventura and
                  Paolo Soda and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {{EDITORIAL}},
  journal      = {Comput. Intell.},
  volume       = {37},
  number       = {4},
  pages        = {1458--1459},
  year         = {2021},
  url          = {https://doi.org/10.1111/coin.12493},
  doi          = {10.1111/COIN.12493},
  timestamp    = {Tue, 01 Feb 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ci/VenturaSG21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/ValleGSZRG21,
  author       = {Eduardo P. Garc{\'{\i}}a del Valle and
                  Gerardo Lagunes Garc{\'{\i}}a and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Massimiliano Zanin and
                  Ernestina Menasalvas Ruiz and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {DisMaNET: {A} network-based tool to cross map disease vocabularies},
  journal      = {Comput. Methods Programs Biomed.},
  volume       = {207},
  pages        = {106233},
  year         = {2021},
  url          = {https://doi.org/10.1016/j.cmpb.2021.106233},
  doi          = {10.1016/J.CMPB.2021.106233},
  timestamp    = {Tue, 16 Aug 2022 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cmpb/ValleGSZRG21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/GonzalezSSF21,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Sebasti{\'{a}}n Ventura Soto and
                  Paolo Soda and
                  Jesualdo Tom{\'{a}}s Fern{\'{a}}ndez{-}Breis},
  title        = {Introduction to the special issue on Methods and applications in the
                  analysis of social data in healthcare},
  journal      = {Inf. Process. Manag.},
  volume       = {58},
  number       = {1},
  pages        = {102427},
  year         = {2021},
  url          = {https://doi.org/10.1016/j.ipm.2020.102427},
  doi          = {10.1016/J.IPM.2020.102427},
  timestamp    = {Fri, 08 Jan 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ipm/GonzalezSSF21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/ValleSGZRG21,
  author       = {Eduardo P. Garc{\'{\i}}a del Valle and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Gerardo Lagunes Garc{\'{\i}}a and
                  Massimiliano Zanin and
                  Ernestina Menasalvas Ruiz and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {Jo{\~{a}}o Rafael Almeida and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Linlin Shen and
                  Bridget Kane and
                  Agma J. M. Traina and
                  Paolo Soda and
                  Jos{\'{e}} Lu{\'{\i}}s Oliveira},
  title        = {A Meta-Path-Based Prediction Method for Disease Comorbidities},
  booktitle    = {34th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2021, Aveiro, Portugal, June 7-9, 2021},
  pages        = {219--224},
  publisher    = {{IEEE}},
  year         = {2021},
  url          = {https://doi.org/10.1109/CBMS52027.2021.00022},
  doi          = {10.1109/CBMS52027.2021.00022},
  timestamp    = {Fri, 21 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/ValleSGZRG21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/clef/PabonMBSGM21,
  author       = {Oswaldo Solarte Pab{\'{o}}n and
                  Orlando Montenegro and
                  Alberto Bl{\'{a}}zquez{-}Herranz and
                  Hadi Saputro and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Ernestina Menasalvas},
  editor       = {Guglielmo Faggioli and
                  Nicola Ferro and
                  Alexis Joly and
                  Maria Maistro and
                  Florina Piroi},
  title        = {Information Extraction from Spanish Radiology Reports using multilingual
                  {BERT}},
  booktitle    = {Proceedings of the Working Notes of {CLEF} 2021 - Conference and Labs
                  of the Evaluation Forum, Bucharest, Romania, September 21st - to -
                  24th, 2021},
  series       = {{CEUR} Workshop Proceedings},
  volume       = {2936},
  pages        = {834--845},
  publisher    = {CEUR-WS.org},
  year         = {2021},
  url          = {https://ceur-ws.org/Vol-2936/paper-69.pdf},
  timestamp    = {Fri, 10 Mar 2023 16:23:42 +0100},
  biburl       = {https://dblp.org/rec/conf/clef/PabonMBSGM21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsaa/PabonBTGPM21,
  author       = {Oswaldo Solarte Pab{\'{o}}n and
                  Alberto Bl{\'{a}}zquez{-}Herranz and
                  Maria Torrente and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Mariano Provencio and
                  Ernestina Menasalvas},
  title        = {Extracting Cancer Treatments from Clinical Text written in Spanish:
                  {A} Deep Learning Approach},
  booktitle    = {8th {IEEE} International Conference on Data Science and Advanced Analytics,
                  {DSAA} 2021, Porto, Portugal, October 6-9, 2021},
  pages        = {1--6},
  publisher    = {{IEEE}},
  year         = {2021},
  url          = {https://doi.org/10.1109/DSAA53316.2021.9564137},
  doi          = {10.1109/DSAA53316.2021.9564137},
  timestamp    = {Fri, 22 Oct 2021 15:23:43 +0200},
  biburl       = {https://dblp.org/rec/conf/dsaa/PabonBTGPM21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dsaa/RedondoRVOHTMPG21,
  author       = {Arturo Redondo and
                  Bel{\'{e}}n R{\'{\i}}os{-}S{\'{a}}nchez and
                  Guillermo Vigueras and
                  Bel{\'{e}}n Otero and
                  Roberto Hern{\'{a}}ndez L{\'{o}}pez and
                  Maria Torrente and
                  Ernestina Menasalvas and
                  Mariano Provencio and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {Towards Treatment Patterns Validation in Lung Cancer Patients},
  booktitle    = {8th {IEEE} International Conference on Data Science and Advanced Analytics,
                  {DSAA} 2021, Porto, Portugal, October 6-9, 2021},
  pages        = {1--8},
  publisher    = {{IEEE}},
  year         = {2021},
  url          = {https://doi.org/10.1109/DSAA53316.2021.9564176},
  doi          = {10.1109/DSAA53316.2021.9564176},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/dsaa/RedondoRVOHTMPG21.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cbms/2021,
  editor       = {Jo{\~{a}}o Rafael Almeida and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Linlin Shen and
                  Bridget Kane and
                  Agma J. M. Traina and
                  Paolo Soda and
                  Jos{\'{e}} Lu{\'{\i}}s Oliveira},
  title        = {34th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2021, Aveiro, Portugal, June 7-9, 2021},
  publisher    = {{IEEE}},
  year         = {2021},
  url          = {https://doi.org/10.1109/CBMS52027.2021},
  doi          = {10.1109/CBMS52027.2021},
  isbn         = {978-1-6654-4121-6},
  timestamp    = {Tue, 11 Jan 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/2021.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/artmed/NajafabadipourZ20,
  author       = {Marjan Najafabadipour and
                  Massimiliano Zanin and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Maria Torrente and
                  Beatriz Nu{\~{n}}ez Garc{\'{\i}}a and
                  Juan Luis Cruz{-}Berm{\'{u}}dez and
                  Mariano Provencio and
                  Ernestina Menasalvas},
  title        = {Reconstructing the patient's natural history from electronic health
                  records},
  journal      = {Artif. Intell. Medicine},
  volume       = {105},
  pages        = {101860},
  year         = {2020},
  url          = {https://doi.org/10.1016/j.artmed.2020.101860},
  doi          = {10.1016/J.ARTMED.2020.101860},
  timestamp    = {Thu, 26 Jan 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/artmed/NajafabadipourZ20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/Benitez-Andrades20,
  author       = {Jos{\'{e}} Alberto Ben{\'{\i}}tez{-}Andrades and
                  Isa{\'{\i}}as Garc{\'{\i}}a{-}Rodr{\'{\i}}guez and
                  Carmen Benavides and
                  H{\'{e}}ctor Alaiz{-}Moret{\'{o}}n and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {Social network analysis for personalized characterization and risk
                  assessment of alcohol use disorders in adolescents using semantic
                  technologies},
  journal      = {Future Gener. Comput. Syst.},
  volume       = {106},
  pages        = {154--170},
  year         = {2020},
  url          = {https://doi.org/10.1016/j.future.2020.01.002},
  doi          = {10.1016/J.FUTURE.2020.01.002},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/fgcs/Benitez-Andrades20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ipm/GarciaGSVZR20,
  author       = {Gerardo Lagunes Garc{\'{\i}}a and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Eduardo P. Garc{\'{\i}}a del Valle and
                  Massimiliano Zanin and
                  Ernestina Menasalvas Ruiz},
  title        = {How Wikipedia disease information evolve over time? An analysis of
                  disease-based articles changes},
  journal      = {Inf. Process. Manag.},
  volume       = {57},
  number       = {3},
  pages        = {102225},
  year         = {2020},
  url          = {https://doi.org/10.1016/j.ipm.2020.102225},
  doi          = {10.1016/J.IPM.2020.102225},
  timestamp    = {Wed, 16 Mar 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/ipm/GarciaGSVZR20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/winet/Sanchez-Cervantes20,
  author       = {Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and
                  Luis Omar Colombo{-}Mendoza and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Jorge Luis Garc{\'{\i}}a{-}Alcaraz and
                  Jos{\'{e}} Mar{\'{\i}}a {\'{A}}lvarez Rodr{\'{\i}}guez and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {LINDASearch: a faceted search system for linked open datasets},
  journal      = {Wirel. Networks},
  volume       = {26},
  number       = {8},
  pages        = {5645--5663},
  year         = {2020},
  url          = {https://doi.org/10.1007/s11276-019-02029-z},
  doi          = {10.1007/S11276-019-02029-Z},
  timestamp    = {Wed, 22 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/winet/Sanchez-Cervantes20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/SantamariaVGZGR20,
  author       = {Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Eduardo P. Garc{\'{\i}}a del Valle and
                  Gerardo Lagunes Garc{\'{\i}}a and
                  Massimiliano Zanin and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Ernestina Menasalvas Ruiz and
                  Yuliana P{\'{e}}rez{-}Gallardo and
                  Gandhi Hern{\'{a}}ndez{-}Chan},
  editor       = {Alba Garc{\'{\i}}a Seco de Herrera and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  KC Santosh and
                  Zelalem Temesgen and
                  Bridget Kane and
                  Paolo Soda},
  title        = {Analysis of New Nosological Models from Disease Similarities using
                  Clustering},
  booktitle    = {33rd {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2020, Rochester, MN, USA, July 28-30, 2020},
  pages        = {183--188},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://doi.org/10.1109/CBMS49503.2020.00042},
  doi          = {10.1109/CBMS49503.2020.00042},
  timestamp    = {Mon, 16 Jan 2023 08:52:16 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/SantamariaVGZGR20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/ScurtiRVTVPPG20,
  author       = {Manuel Scurti and
                  Ernestina Menasalvas Ruiz and
                  Maria{-}Esther Vidal and
                  Maria Torrente and
                  Dimitrios Vogiatzis and
                  George Paliouras and
                  Mariano Provencio and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {Alba Garc{\'{\i}}a Seco de Herrera and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  KC Santosh and
                  Zelalem Temesgen and
                  Bridget Kane and
                  Paolo Soda},
  title        = {A Data-Driven Approach for Analyzing Healthcare Services Extracted
                  from Clinical Records},
  booktitle    = {33rd {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2020, Rochester, MN, USA, July 28-30, 2020},
  pages        = {193--196},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://doi.org/10.1109/CBMS49503.2020.00044},
  doi          = {10.1109/CBMS49503.2020.00044},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/ScurtiRVTVPPG20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/GonzalezTPRJCCA20,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Juan Manuel Tu{\~{n}}as and
                  Diego Fernandez Peces{-}Barba and
                  Ernestina Menasalvas Ruiz and
                  Almudena Jaramillo and
                  Manuel Cotarelo and
                  Antonio Conejo and
                  Amalia Arce and
                  Angel Gil},
  editor       = {Alba Garc{\'{\i}}a Seco de Herrera and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  KC Santosh and
                  Zelalem Temesgen and
                  Bridget Kane and
                  Paolo Soda},
  title        = {Creating a Metamodel Based on Machine Learning to Identify the Sentiment
                  of Vaccine and Disease-Related Messages in Twitter: the {MAVIS} Study},
  booktitle    = {33rd {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2020, Rochester, MN, USA, July 28-30, 2020},
  pages        = {245--250},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://doi.org/10.1109/CBMS49503.2020.00053},
  doi          = {10.1109/CBMS49503.2020.00053},
  timestamp    = {Thu, 10 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/GonzalezTPRJCCA20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/PabonTGPMT20,
  author       = {Oswaldo Solarte Pab{\'{o}}n and
                  Maria Torrente and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Mariano Provencio and
                  Ernestina Menasalvas and
                  Juan Manuel Tu{\~{n}}as},
  editor       = {Alba Garc{\'{\i}}a Seco de Herrera and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  KC Santosh and
                  Zelalem Temesgen and
                  Bridget Kane and
                  Paolo Soda},
  title        = {Lung Cancer Diagnosis Extraction from Clinical Notes Written in Spanish},
  booktitle    = {33rd {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2020, Rochester, MN, USA, July 28-30, 2020},
  pages        = {492--497},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://doi.org/10.1109/CBMS49503.2020.00099},
  doi          = {10.1109/CBMS49503.2020.00099},
  timestamp    = {Thu, 10 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/PabonTGPMT20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwbbio/PabonMG20,
  author       = {Oswaldo Solarte Pab{\'{o}}n and
                  Ernestina Menasalvas and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {Ignacio Rojas and
                  Olga Valenzuela and
                  Fernando Rojas and
                  Luis Javier Herrera and
                  Francisco M. Ortu{\~{n}}o Guzman},
  title        = {Spa-neg: An Approach for Negation Detection in Clinical Text Written
                  in Spanish},
  booktitle    = {Bioinformatics and Biomedical Engineering - 8th International Work-Conference,
                  {IWBBIO} 2020, Granada, Spain, May 6-8, 2020, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {12108},
  pages        = {323--337},
  publisher    = {Springer},
  year         = {2020},
  url          = {https://doi.org/10.1007/978-3-030-45385-5\_29},
  doi          = {10.1007/978-3-030-45385-5\_29},
  timestamp    = {Mon, 05 Feb 2024 20:33:18 +0100},
  biburl       = {https://dblp.org/rec/conf/iwbbio/PabonMG20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/meco/ZaninRGWWHS20,
  author       = {Massimiliano Zanin and
                  Ernestina Menasalvas Ruiz and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Christian Wolff and
                  Juana Wendt and
                  Elisa A. Herrmann and
                  Pavel Smrz},
  title        = {Developing a Data Analytics Toolbox to Support CPS-based Services},
  booktitle    = {9th Mediterranean Conference on Embedded Computing, {MECO} 2020, Budva,
                  Montenegro, June 8-11, 2020},
  pages        = {1--7},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://doi.org/10.1109/MECO49872.2020.9134351},
  doi          = {10.1109/MECO49872.2020.9134351},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/meco/ZaninRGWWHS20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/mipro/ZaninMGS20,
  author       = {Massimiliano Zanin and
                  Ernestina Menasalvas and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Pavel Smrz},
  editor       = {Marko Koricic and
                  Karolj Skala and
                  Zeljka Car and
                  Marina Cicin{-}Sain and
                  Vlado Sruk and
                  Dejan Skvorc and
                  Slobodan Ribaric and
                  Bojan Jerbic and
                  Stjepan Gros and
                  Boris Vrdoljak and
                  Mladen Mauher and
                  Edvard Tijan and
                  Tihomir Katulic and
                  Predrag Pale and
                  Tihana Galinac Grbac and
                  Nikola Filip Fijan and
                  Adrian Boukalov and
                  Dragan Cisic and
                  Vera Gradisnik},
  title        = {An Analytics Toolbox for Cyber-Physical Systems Data Analysis: Requirements
                  and Challenges},
  booktitle    = {43rd International Convention on Information, Communication and Electronic
                  Technology, {MIPRO} 2020, Opatija, Croatia, September 28 - October
                  2, 2020},
  pages        = {271--276},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://doi.org/10.23919/MIPRO48935.2020.9245355},
  doi          = {10.23919/MIPRO48935.2020.9245355},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/mipro/ZaninMGS20.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/cbms/2020,
  editor       = {Alba Garc{\'{\i}}a Seco de Herrera and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  KC Santosh and
                  Zelalem Temesgen and
                  Bridget Kane and
                  Paolo Soda},
  title        = {33rd {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2020, Rochester, MN, USA, July 28-30, 2020},
  publisher    = {{IEEE}},
  year         = {2020},
  url          = {https://ieeexplore.ieee.org/xpl/conhome/9169740/proceeding},
  isbn         = {978-1-7281-9429-5},
  timestamp    = {Mon, 16 Jan 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/2020.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdsa/GonzalezVMORS19,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Athena Vakali and
                  Miguel Angel Mayer and
                  Takashi Okumura and
                  Ernestina Menasalvas Ruiz and
                  Myra Spiliopoulou},
  title        = {Introduction to the special issue on social data analytics in medicine
                  and healthcare},
  journal      = {Int. J. Data Sci. Anal.},
  volume       = {8},
  number       = {4},
  pages        = {325--326},
  year         = {2019},
  url          = {https://doi.org/10.1007/s41060-019-00199-9},
  doi          = {10.1007/S41060-019-00199-9},
  timestamp    = {Sat, 25 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijdsa/GonzalezVMORS19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/ValleGSZRG19,
  author       = {Eduardo P. Garc{\'{\i}}a del Valle and
                  Gerardo Lagunes Garc{\'{\i}}a and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Massimiliano Zanin and
                  Ernestina Menasalvas Ruiz and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {Disease networks and their contribution to disease understanding:
                  {A} review of their evolution, techniques and data sources},
  journal      = {J. Biomed. Informatics},
  volume       = {94},
  year         = {2019},
  url          = {https://doi.org/10.1016/j.jbi.2019.103206},
  doi          = {10.1016/J.JBI.2019.103206},
  timestamp    = {Tue, 16 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jbi/ValleGSZRG19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/NajafabadipourZ19,
  author       = {Marjan Najafabadipour and
                  Massimiliano Zanin and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Consuelo Gonzalo{-}Mart{\'{\i}}n and
                  Beatriz Nu{\~{n}}ez Garc{\'{\i}}a and
                  Virginia Calvo and
                  Juan Luis Cruz{-}Berm{\'{u}}dez and
                  Mariano Provencio and
                  Ernestina Menasalvas},
  title        = {Recognition of Time Expressions in Spanish Electronic Health Records},
  booktitle    = {32nd {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2019, Cordoba, Spain, June 5-7, 2019},
  pages        = {69--74},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://doi.org/10.1109/CBMS.2019.00025},
  doi          = {10.1109/CBMS.2019.00025},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/NajafabadipourZ19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/KritharaARNBVMG19,
  author       = {Anastasia Krithara and
                  Fotis Aisopos and
                  Vassiliki Rentoumi and
                  Anastasios Nentidis and
                  Konstantinos Bougiatiotis and
                  Maria{-}Esther Vidal and
                  Ernestina Menasalvas and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Eleftherios Samaras and
                  Peter Garrard and
                  Maria Torrente and
                  Mariano Provencio Pulla and
                  Nikos Dimakopoulos and
                  Rui Mauricio and
                  Jordi Rambla De Argila and
                  Gian Gaetano Tartaglia and
                  George Paliouras},
  title        = {iASiS: Towards Heterogeneous Big Data Analysis for Personalized Medicine},
  booktitle    = {32nd {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2019, Cordoba, Spain, June 5-7, 2019},
  pages        = {106--111},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://doi.org/10.1109/CBMS.2019.00032},
  doi          = {10.1109/CBMS.2019.00032},
  timestamp    = {Wed, 07 Dec 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/KritharaARNBVMG19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/Diaz-HonrubiaGZ19,
  author       = {Antonio Jes{\'{u}}s D{\'{\i}}az{-}Honrubia and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Juan Mora Zamorano and
                  Jes{\'{u}}s Rey Jim{\'{e}}nez and
                  Gustavo {Gonzalez Granadillo} and
                  Rodrigo Diaz and
                  Mariza Konidi and
                  Panos Papachristou and
                  Sokratis Nifakos and
                  Georgia Kougka and
                  Anastasios Gounaris},
  title        = {An Overview of the {CUREX} Platform},
  booktitle    = {32nd {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2019, Cordoba, Spain, June 5-7, 2019},
  pages        = {162--167},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://doi.org/10.1109/CBMS.2019.00042},
  doi          = {10.1109/CBMS.2019.00042},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/Diaz-HonrubiaGZ19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/ValleGRSZG19,
  author       = {Eduardo P. Garc{\'{\i}}a del Valle and
                  Gerardo Lagunes Garc{\'{\i}}a and
                  Ernestina Menasalvas Ruiz and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Massimiliano Zanin and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {Completing Missing MeSH Code Mappings in {UMLS} Through Alternative
                  Expert-Curated Sources},
  booktitle    = {32nd {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2019, Cordoba, Spain, June 5-7, 2019},
  pages        = {174--179},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://doi.org/10.1109/CBMS.2019.00044},
  doi          = {10.1109/CBMS.2019.00044},
  timestamp    = {Mon, 15 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/ValleGRSZG19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/ToroSGGGR19,
  author       = {C{\'{e}}sar Antonio Ortiz Toro and
                  Nuria Guti{\'{e}}rrez S{\'{a}}nchez and
                  Consuelo Gonzalo{-}Mart{\'{\i}}n and
                  Roberto Garrido Garc{\'{\i}}a and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Ernestina Menasalvas Ruiz},
  title        = {Radiomics Textural Features Extracted from Subcortical Structures
                  of Grey Matter Probability for Alzheimers Disease Detection},
  booktitle    = {32nd {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2019, Cordoba, Spain, June 5-7, 2019},
  pages        = {391--397},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://doi.org/10.1109/CBMS.2019.00084},
  doi          = {10.1109/CBMS.2019.00084},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/ToroSGGGR19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/GarciaG19,
  author       = {Gerardo Lagunes Garc{\'{\i}}a and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {Characterization of Diseases Based on Phenotypic Information Through
                  Knowledge Extraction using Public Sources},
  booktitle    = {32nd {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2019, Cordoba, Spain, June 5-7, 2019},
  pages        = {596--599},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://doi.org/10.1109/CBMS.2019.00124},
  doi          = {10.1109/CBMS.2019.00124},
  timestamp    = {Wed, 16 Mar 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/GarciaG19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/GarciaSVZRG19,
  author       = {Gerardo Lagunes Garc{\'{\i}}a and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Eduardo P. Garc{\'{\i}}a del Valle and
                  Massimiliano Zanin and
                  Ernestina Menasalvas Ruiz and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {Wikipedia Disease Articles: An Analysis of their Content and Evolution},
  booktitle    = {32nd {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2019, Cordoba, Spain, June 5-7, 2019},
  pages        = {664--671},
  publisher    = {{IEEE}},
  year         = {2019},
  url          = {https://doi.org/10.1109/CBMS.2019.00136},
  doi          = {10.1109/CBMS.2019.00136},
  timestamp    = {Sun, 25 Oct 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/cbms/GarciaSVZRG19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sgai/NajafabadipourT19,
  author       = {Marjan Najafabadipour and
                  Juan Manuel Tu{\~{n}}as and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Ernestina Menasalvas},
  editor       = {Max Bramer and
                  Miltos Petridis},
  title        = {Analysis of Electronic Health Records to Identify the Patient's Treatment
                  Lines: Challenges and Opportunities},
  booktitle    = {Artificial Intelligence {XXXVI} - 39th {SGAI} International Conference
                  on Artificial Intelligence, {AI} 2019, Cambridge, UK, December 17-19,
                  2019, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {11927},
  pages        = {437--442},
  publisher    = {Springer},
  year         = {2019},
  url          = {https://doi.org/10.1007/978-3-030-34885-4\_33},
  doi          = {10.1007/978-3-030-34885-4\_33},
  timestamp    = {Sat, 30 May 2020 20:07:11 +0200},
  biburl       = {https://dblp.org/rec/conf/sgai/NajafabadipourT19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19,
  author       = {Ziawasch Abedjan and
                  Nozha Boujemaa and
                  Stuart Campbell and
                  Patricia Casla and
                  Supriyo Chatterjea and
                  Sergio Consoli and
                  Crist{\'{o}}bal Costa Soria and
                  Paul Czech and
                  Marija Despenic and
                  Chiara Garattini and
                  Dirk Hamelinck and
                  Adrienne Heinrich and
                  Wessel Kraaij and
                  Jacek Kustra and
                  Aizea Lojo and
                  Marga Martin Sanchez and
                  Miguel Angel Mayer and
                  Matteo Melideo and
                  Ernestina Menasalvas and
                  Frank M{\o}ller Aarestrup and
                  Elvira Narro Artigot and
                  Milan Petkovic and
                  Diego Reforgiato Recupero and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Gisele Roesems Kerremans and
                  Roland Roller and
                  M{\'{a}}rio Rom{\~{a}}o and
                  Stefan R{\"{u}}ping and
                  Felix Sasaki and
                  Wouter Spek and
                  Nenad Stojanovic and
                  Jack Thoms and
                  Andrejs Vasiljevs and
                  Wilfried Verachtert and
                  Roel Wuyts},
  editor       = {Sergio Consoli and
                  Diego Reforgiato Recupero and
                  Milan Petkovic},
  title        = {Data Science in Healthcare: Benefits, Challenges and Opportunities},
  booktitle    = {Data Science for Healthcare - Methodologies and Applications},
  pages        = {3--38},
  publisher    = {Springer},
  year         = {2019},
  url          = {https://doi.org/10.1007/978-3-030-05249-2\_1},
  doi          = {10.1007/978-3-030-05249-2\_1},
  timestamp    = {Fri, 22 Mar 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/books/sp/19/AbedjanBCCCCSCDGHHKKLSMMMAAPRGKRRRSSSTVVW19.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/entropy/ZaninGRP18,
  author       = {Massimiliano Zanin and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Ernestina Menasalvas Ruiz and
                  David Papo},
  title        = {Assessing Time Series Reversibility through Permutation Patterns},
  journal      = {Entropy},
  volume       = {20},
  number       = {9},
  pages        = {665},
  year         = {2018},
  url          = {https://doi.org/10.3390/e20090665},
  doi          = {10.3390/E20090665},
  timestamp    = {Fri, 25 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/entropy/ZaninGRP18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jis/Colombo-Mendoza18,
  author       = {Luis Omar Colombo{-}Mendoza and
                  Rafael Valencia{-}Garc{\'{\i}}a and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Ricardo Colomo Palacios and
                  Giner Alor{-}Hern{\'{a}}ndez},
  title        = {Towards a knowledge-based probabilistic and context-aware social recommender
                  system},
  journal      = {J. Inf. Sci.},
  volume       = {44},
  number       = {4},
  pages        = {464--490},
  year         = {2018},
  url          = {https://doi.org/10.1177/0165551517698787},
  doi          = {10.1177/0165551517698787},
  timestamp    = {Mon, 15 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jis/Colombo-Mendoza18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/RuizTBGGZPMZRPB18,
  author       = {Ernestina Menasalvas Ruiz and
                  Juan Manuel Tu{\~{n}}as and
                  Guzm{\'{a}}n Bermejo and
                  Consuelo Gonzalo{-}Mart{\'{\i}}n and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Massimiliano Zanin and
                  Cristina Gonzalez de Pedro and
                  Marta Mendez and
                  Olga Zaretskaia and
                  Jes{\'{u}}s Rey and
                  Consuelo Parejo and
                  Juan Luis Cruz{-}Berm{\'{u}}dez and
                  Mariano Provencio},
  title        = {Profiling Lung Cancer Patients Using Electronic Health Records},
  journal      = {J. Medical Syst.},
  volume       = {42},
  number       = {7},
  pages        = {126:1--126:10},
  year         = {2018},
  url          = {https://doi.org/10.1007/s10916-018-0975-9},
  doi          = {10.1007/S10916-018-0975-9},
  timestamp    = {Sat, 30 Sep 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jms/RuizTBGGZPMZRPB18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/ValleGSZRG18,
  author       = {Eduardo P. Garc{\'{\i}}a del Valle and
                  Gerardo Lagunes Garc{\'{\i}}a and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Massimiliano Zanin and
                  Ernestina Menasalvas Ruiz and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {Jaakko Hollm{\'{e}}n and
                  Carolyn McGregor and
                  Paolo Soda and
                  Bridget Kane},
  title        = {Evaluating Wikipedia as a Source of Information for Disease Understanding},
  booktitle    = {31st {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2018, Karlstad, Sweden, June 18-21, 2018},
  pages        = {399--404},
  publisher    = {{IEEE} Computer Society},
  year         = {2018},
  url          = {https://doi.org/10.1109/CBMS.2018.00076},
  doi          = {10.1109/CBMS.2018.00076},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/ValleGSZRG18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/dils/NajafabadipourT18,
  author       = {Marjan Najafabadipour and
                  Juan Manuel Tu{\~{n}}as and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Ernestina Menasalvas},
  editor       = {S{\"{o}}ren Auer and
                  Maria{-}Esther Vidal},
  title        = {Lung Cancer Concept Annotation from Spanish Clinical Narratives},
  booktitle    = {Data Integration in the Life Sciences - 13th International Conference,
                  {DILS} 2018, Hannover, Germany, November 20-21, 2018, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {11371},
  pages        = {153--163},
  publisher    = {Springer},
  year         = {2018},
  url          = {https://doi.org/10.1007/978-3-030-06016-9\_15},
  doi          = {10.1007/978-3-030-06016-9\_15},
  timestamp    = {Fri, 27 Dec 2019 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/dils/NajafabadipourT18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/sitis/GonzalezGM18,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Consuelo Gonzalo and
                  Ernestina Menasalvas},
  editor       = {Gabriella Sanniti di Baja and
                  Luigi Gallo and
                  Kokou Y{\'{e}}tongnon and
                  Albert Dipanda and
                  Modesto Castrill{\'{o}}n Santana and
                  Richard Chbeir},
  title        = {Mining Electronic Health Records: Challenges and Impact},
  booktitle    = {14th International Conference on Signal-Image Technology {\&}
                  Internet-Based Systems, {SITIS} 2018, Las Palmas de Gran Canaria,
                  Spain, November 26-29, 2018},
  pages        = {747--754},
  publisher    = {{IEEE}},
  year         = {2018},
  url          = {https://doi.org/10.1109/SITIS.2018.00119},
  doi          = {10.1109/SITIS.2018.00119},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/sitis/GonzalezGM18.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1808-01459,
  author       = {Eduardo P. Garc{\'{\i}}a del Valle and
                  Gerardo Lagunes Garc{\'{\i}}a and
                  Luc{\'{\i}}a Prieto Santamar{\'{\i}}a and
                  Massimiliano Zanin and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Ernestina Menasalvas Ruiz},
  title        = {Evaluating Wikipedia as a source of information for disease understanding},
  journal      = {CoRR},
  volume       = {abs/1808.01459},
  year         = {2018},
  url          = {http://arxiv.org/abs/1808.01459},
  eprinttype    = {arXiv},
  eprint       = {1808.01459},
  timestamp    = {Sat, 13 Jul 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1808-01459.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1809-06639,
  author       = {Marjan Najafabadipour and
                  Juan Manuel Tu{\~{n}}as and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Ernestina Menasalvas},
  title        = {Lung Cancer Concept Annotation from Spanish Clinical Narratives},
  journal      = {CoRR},
  volume       = {abs/1809.06639},
  year         = {2018},
  url          = {http://arxiv.org/abs/1809.06639},
  eprinttype    = {arXiv},
  eprint       = {1809.06639},
  timestamp    = {Mon, 08 Oct 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1809-06639.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/corr/abs-1809-07784,
  author       = {Ernestina Menasalvas Ruiz and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Consuelo Gonzalo{-}Mart{\'{\i}}n and
                  Massimiliano Zanin and
                  Juan Manuel Tu{\~{n}}as and
                  Mariano Provencio and
                  Maria Torrente and
                  Fabio Franco and
                  Virginia Calvo and
                  Beatriz Nu{\~{n}}ez},
  title        = {{IASIS} and BigMedilytics: Towards personalized medicine in Europe},
  journal      = {CoRR},
  volume       = {abs/1809.07784},
  year         = {2018},
  url          = {http://arxiv.org/abs/1809.07784},
  eprinttype    = {arXiv},
  eprint       = {1809.07784},
  timestamp    = {Fri, 05 Oct 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/corr/abs-1809-07784.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/RuizGTGPPMZCRP17,
  author       = {Ernestina Menasalvas Ruiz and
                  Consuelo Gonzalo and
                  Juan Manuel Tu{\~{n}}as and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Mariano Provencio and
                  Cristina Gonzalez de Pedro and
                  Marta Mendez and
                  Olga Zaretskaia and
                  Juan Luis Cruz and
                  Jes{\'{u}}s Rey and
                  Consuelo Parejo},
  editor       = {Panagiotis D. Bamidis and
                  Stathis Th. Konstantinidis and
                  Pedro Pereira Rodrigues},
  title        = {OncoCall: Analyzing the Outcomes of the Oncology Telephone Patient
                  Assistance},
  booktitle    = {30th {IEEE} International Symposium on Computer-Based Medical Systems,
                  {CBMS} 2017, Thessaloniki, Greece, June 22-24, 2017},
  pages        = {624--629},
  publisher    = {{IEEE} Computer Society},
  year         = {2017},
  url          = {https://doi.org/10.1109/CBMS.2017.103},
  doi          = {10.1109/CBMS.2017.103},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/RuizGTGPPMZCRP17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/citi/Aparicio-Paniagua17,
  author       = {Virginia Aparicio{-}Paniagua and
                  Jorge P{\'{e}}rez{-}Mu{\~{n}}oz and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Angel Garc{\'{\i}}a{-}Pedrero and
                  Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and
                  Consuelo Gonzalo{-}Mart{\'{\i}}n and
                  Ernestina Menasalvas Ruiz and
                  Giner Alor{-}Hern{\'{a}}ndez},
  editor       = {Rafael Valencia{-}Garc{\'{\i}}a and
                  Katty Lagos{-}Ortiz and
                  Gema Alcaraz{-}M{\'{a}}rmol and
                  Javier del Cioppo and
                  N{\'{e}}stor Vera{-}Lucio and
                  Martha Bucaram{-}Leverone},
  title        = {Automatic Recording and Analysis of Somniloquy Through the Use of
                  Mobile Devices to Support the Diagnosis of Psychological Pathologies},
  booktitle    = {Technologies and Innovation - Third International Conference, {CITI}
                  2017, Guayaquil, Ecuador, October 24-27, 2017, Proceedings},
  series       = {Communications in Computer and Information Science},
  volume       = {749},
  pages        = {169--180},
  publisher    = {Springer},
  year         = {2017},
  url          = {https://doi.org/10.1007/978-3-319-67283-0\_13},
  doi          = {10.1007/978-3-319-67283-0\_13},
  timestamp    = {Mon, 26 Jun 2023 20:45:39 +0200},
  biburl       = {https://dblp.org/rec/conf/citi/Aparicio-Paniagua17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pacbb/ToroGGGM17,
  author       = {C{\'{e}}sar Antonio Ortiz Toro and
                  Consuelo Gonzalo{-}Mart{\'{\i}}n and
                  Angel Garc{\'{\i}}a{-}Pedrero and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Ernestina Menasalvas},
  editor       = {Florentino Fdez{-}Riverola and
                  Mohd Saberi Mohamad and
                  Miguel P. Rocha and
                  Juan F. De Paz and
                  Tiago Pinto},
  title        = {Mitosis Detection in Breast Cancer Using Superpixels and Ensemble
                  Classifiers},
  booktitle    = {11th International Conference on Practical Applications of Computational
                  Biology {\&} Bioinformatics, {PACBB} 2017, Porto, Portugal, 21-23
                  June, 2017},
  series       = {Advances in Intelligent Systems and Computing},
  volume       = {616},
  pages        = {137--145},
  publisher    = {Springer},
  year         = {2017},
  url          = {https://doi.org/10.1007/978-3-319-60816-7\_17},
  doi          = {10.1007/978-3-319-60816-7\_17},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/pacbb/ToroGGGM17.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbm/Hernandez-ChanC16,
  author       = {Gandhi Hern{\'{a}}ndez{-}Chan and
                  Edgar Eduardo Ceh{-}Varela and
                  Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and
                  Marisol Villanueva{-}Escalante and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Yuliana P{\'{e}}rez{-}Gallardo},
  title        = {Collective intelligence in medical diagnosis systems: {A} case study},
  journal      = {Comput. Biol. Medicine},
  volume       = {74},
  pages        = {45--53},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.compbiomed.2016.04.016},
  doi          = {10.1016/J.COMPBIOMED.2016.04.016},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cbm/Hernandez-ChanC16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmpb/GonzalezRM16,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Ernestina Menasalvas Ruiz and
                  Miguel Angel Mayer},
  title        = {Automatic extraction and identification of users' responses in Facebook
                  medical quizzes},
  journal      = {Comput. Methods Programs Biomed.},
  volume       = {127},
  pages        = {197--203},
  year         = {2016},
  url          = {https://doi.org/10.1016/j.cmpb.2015.12.025},
  doi          = {10.1016/J.CMPB.2015.12.025},
  timestamp    = {Thu, 20 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cmpb/GonzalezRM16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/js/Sanchez-Cervantes16,
  author       = {Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and
                  Mateusz Radzimski and
                  Cristian Aar{\'{o}}n Rodr{\'{\i}}guez{-}Enr{\'{\i}}quez and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Lisbeth Rodr{\'{\i}}guez{-}Mazahua and
                  Cuauht{\'{e}}moc S{\'{a}}nchez{-}Ram{\'{\i}}rez and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {{SREQP:} {A} Solar Radiation Extraction and Query Platform for the
                  Production and Consumption of Linked Data from Weather Stations Sensors},
  journal      = {J. Sensors},
  volume       = {2016},
  pages        = {2825653:1--2825653:18},
  year         = {2016},
  url          = {https://doi.org/10.1155/2016/2825653},
  doi          = {10.1155/2016/2825653},
  timestamp    = {Wed, 19 May 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/js/Sanchez-Cervantes16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/rskt/MenasalvasGCAG16,
  author       = {Ernestina Menasalvas and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Roberto Costumero and
                  Hector Ambit and
                  Consuelo Gonzalo},
  editor       = {V{\'{\i}}ctor Flores and
                  Fernando A. C. Gomide and
                  Andrzej Janusz and
                  Claudio Meneses and
                  Duoqian Miao and
                  Georg Peters and
                  Dominik Slezak and
                  Guoyin Wang and
                  Richard Weber and
                  Yiyu Yao},
  title        = {Clinical Narrative Analytics Challenges},
  booktitle    = {Rough Sets - International Joint Conference, {IJCRS} 2016, Santiago
                  de Chile, Chile, October 7-11, 2016, Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {9920},
  pages        = {23--32},
  year         = {2016},
  url          = {https://doi.org/10.1007/978-3-319-47160-0\_2},
  doi          = {10.1007/978-3-319-47160-0\_2},
  timestamp    = {Tue, 21 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/rskt/MenasalvasGCAG16.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/Colombo-MendozaVGAZ15,
  author       = {Luis Omar Colombo{-}Mendoza and
                  Rafael Valencia{-}Garc{\'{\i}}a and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Jos{\'{e}} Javier Samper Zapater},
  title        = {RecomMetz: {A} context-aware knowledge-based mobile recommender system
                  for movie showtimes},
  journal      = {Expert Syst. Appl.},
  volume       = {42},
  number       = {3},
  pages        = {1202--1222},
  year         = {2015},
  url          = {https://doi.org/10.1016/j.eswa.2014.09.016},
  doi          = {10.1016/J.ESWA.2014.09.016},
  timestamp    = {Fri, 30 Nov 2018 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/eswa/Colombo-MendozaVGAZ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scp/Salas-ZarateAVR15,
  author       = {Mar{\'{\i}}a del Pilar Salas{-}Z{\'{a}}rate and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Rafael Valencia{-}Garc{\'{\i}}a and
                  Lisbeth Rodr{\'{\i}}guez{-}Mazahua and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Jos{\'{e}} Luis L{\'{o}}pez Cuadrado},
  title        = {Analyzing best practices on Web development frameworks: The lift approach},
  journal      = {Sci. Comput. Program.},
  volume       = {102},
  pages        = {1--19},
  year         = {2015},
  url          = {https://doi.org/10.1016/j.scico.2014.12.004},
  doi          = {10.1016/J.SCICO.2014.12.004},
  timestamp    = {Wed, 17 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/scp/Salas-ZarateAVR15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/spe/Paredes-ValverdeAGVJ15,
  author       = {Mario Andr{\'{e}}s Paredes{-}Valverde and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Rafael Valencia{-}Garc{\'{\i}}a and
                  Enrique Jim{\'{e}}nez{-}Domingo},
  title        = {A systematic review of tools, languages, and methodologies for mashup
                  development},
  journal      = {Softw. Pract. Exp.},
  volume       = {45},
  number       = {3},
  pages        = {365--397},
  year         = {2015},
  url          = {https://doi.org/10.1002/spe.2233},
  doi          = {10.1002/SPE.2233},
  timestamp    = {Thu, 09 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/spe/Paredes-ValverdeAGVJ15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pacbb/GonzalezRCWR15,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Marcos Mart{\'{\i}}nez Romero and
                  Roberto Costumero and
                  Mark D. Wilkinson and
                  Ernestina Menasalvas Ruiz},
  editor       = {Ross A. Overbeek and
                  Miguel P. Rocha and
                  Florentino Fdez{-}Riverola and
                  Juan Francisco de Paz},
  title        = {Diagnostic Knowledge Extraction from MedlinePlus: An Application for
                  Infectious Diseases},
  booktitle    = {9th International Conference on Practical Applications of Computational
                  Biology and Bioinformatics, {PACBB} 2015, 3-5 June, 2015, Salamanca,
                  Spain},
  series       = {Advances in Intelligent Systems and Computing},
  volume       = {375},
  pages        = {79--87},
  publisher    = {Springer},
  year         = {2015},
  url          = {https://doi.org/10.1007/978-3-319-19776-0\_9},
  doi          = {10.1007/978-3-319-19776-0\_9},
  timestamp    = {Wed, 12 Oct 2022 08:58:54 +0200},
  biburl       = {https://dblp.org/rec/conf/pacbb/GonzalezRCWR15.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pacbb/GonzalezRCWR15a,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Marcos Mart{\'{\i}}nez Romero and
                  Roberto Costumero and
                  Mark D. Wilkinson and
                  Ernestina Menasalvas Ruiz},
  editor       = {Ross A. Overbeek and
                  Miguel P. Rocha and
                  Florentino Fdez{-}Riverola and
                  Juan Francisco de Paz},
  title        = {Erratum to: Diagnostic Knowledge Extraction from MedlinePlus: An Application
                  for Infectious Diseases},
  booktitle    = {9th International Conference on Practical Applications of Computational
                  Biology and Bioinformatics, {PACBB} 2015, 3-5 June, 2015, Salamanca,
                  Spain},
  series       = {Advances in Intelligent Systems and Computing},
  volume       = {375},
  pages        = {E1},
  publisher    = {Springer},
  year         = {2015},
  url          = {https://doi.org/10.1007/978-3-319-19776-0\_16},
  doi          = {10.1007/978-3-319-19776-0\_16},
  timestamp    = {Fri, 20 Nov 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/pacbb/GonzalezRCWR15a.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/acj/GonzalezERAJ14,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  David Estrada{-}Contreras and
                  Guillermo Cortes Robles and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Ulises Ju{\'{a}}rez{-}Mart{\'{\i}}nez},
  title        = {A Function-Oriented Ontology Tool for Solving Inventive Problems},
  journal      = {J. Res. Pract. Inf. Technol.},
  volume       = {46},
  number       = {4},
  year         = {2014},
  url          = {http://ws.acs.org.au/jrpit/JRPITVolumes/JRPIT46/JRPIT46.4.287\%20David\%20Estrada-Contreas\%20A\%20Function-Orientated\%20Ontology\%20Tool\%20for\%20Solving\%20Inventive\%20Problems.pdf},
  timestamp    = {Thu, 26 Aug 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/acj/GonzalezERAJ14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ase/Colombo-MendozaAGV14,
  author       = {Luis Omar Colombo{-}Mendoza and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Rafael Valencia{-}Garc{\'{\i}}a},
  title        = {MobiCloUP!: a PaaS for cloud services-based mobile applications},
  journal      = {Autom. Softw. Eng.},
  volume       = {21},
  number       = {3},
  pages        = {391--437},
  year         = {2014},
  url          = {https://doi.org/10.1007/s10515-014-0143-5},
  doi          = {10.1007/S10515-014-0143-5},
  timestamp    = {Sun, 02 Jun 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ase/Colombo-MendozaAGV14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biomedsem/ArangurenGW14,
  author       = {Mikel Ega{\~{n}}a Aranguren and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Mark D. Wilkinson},
  title        = {Executing {SADI} services in Galaxy},
  journal      = {J. Biomed. Semant.},
  volume       = {5},
  pages        = {42},
  year         = {2014},
  url          = {https://doi.org/10.1186/2041-1480-5-42},
  doi          = {10.1186/2041-1480-5-42},
  timestamp    = {Thu, 13 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/biomedsem/ArangurenGW14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biomedsem/GonzalezCCGADW14,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Alison Callahan and
                  Jos{\'{e}} Cruz{-}Toledo and
                  Adrian Garcia and
                  Mikel Ega{\~{n}}a Aranguren and
                  Michel Dumontier and
                  Mark D. Wilkinson},
  title        = {Automatically exposing OpenLifeData via {SADI} semantic Web Services},
  journal      = {J. Biomed. Semant.},
  volume       = {5},
  pages        = {46},
  year         = {2014},
  url          = {https://doi.org/10.1186/2041-1480-5-46},
  doi          = {10.1186/2041-1480-5-46},
  timestamp    = {Thu, 13 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/biomedsem/GonzalezCCGADW14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/caee/Vasquez-Ramirez14,
  author       = {Raquel V{\'{a}}squez{-}Ram{\'{\i}}rez and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {Athena: {A} hybrid management system for multi-device educational
                  content},
  journal      = {Comput. Appl. Eng. Educ.},
  volume       = {22},
  number       = {4},
  pages        = {750--763},
  year         = {2014},
  url          = {https://doi.org/10.1002/cae.21567},
  doi          = {10.1002/CAE.21567},
  timestamp    = {Thu, 06 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/caee/Vasquez-Ramirez14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/chb/RodriguezGGP14,
  author       = {Jos{\'{e}} Mar{\'{\i}}a {\'{A}}lvarez Rodr{\'{\i}}guez and
                  Jos{\'{e}} Emilio Labra Gayo and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Patricia Ord{\'{o}}{\~{n}}ez de Pablos},
  title        = {Empowering the access to public procurement opportunities by means
                  of linking controlled vocabularies. {A} case study of Product Scheme
                  Classifications in the European e-Procurement sector},
  journal      = {Comput. Hum. Behav.},
  volume       = {30},
  pages        = {674--688},
  year         = {2014},
  url          = {https://doi.org/10.1016/j.chb.2013.07.046},
  doi          = {10.1016/J.CHB.2013.07.046},
  timestamp    = {Wed, 22 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/chb/RodriguezGGP14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cii/Alor-HernandezSCRGC14,
  author       = {Giner Alor{-}Hern{\'{a}}ndez and
                  Cuauht{\'{e}}moc S{\'{a}}nchez{-}Ram{\'{\i}}rez and
                  Guillermo Cortes Robles and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Jorge Luis Garc{\'{\i}}a{-}Alcaraz and
                  Miguel Gast{\'{o}}n Cedillo{-}Campos},
  title        = {{BROSEMWEB:} {A} brokerage service for e-Procurement using Semantic
                  Web Technologies},
  journal      = {Comput. Ind.},
  volume       = {65},
  number       = {5},
  pages        = {828--840},
  year         = {2014},
  url          = {https://doi.org/10.1016/j.compind.2013.12.007},
  doi          = {10.1016/J.COMPIND.2013.12.007},
  timestamp    = {Mon, 05 Feb 2024 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/cii/Alor-HernandezSCRGC14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/fgcs/PalaciosSG14,
  author       = {Ricardo Colomo Palacios and
                  Vladimir Stantchev and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {Special issue on exploiting semantic technologies with particularization
                  on linked data over grid and cloud architectures},
  journal      = {Future Gener. Comput. Syst.},
  volume       = {32},
  pages        = {260--262},
  year         = {2014},
  url          = {https://doi.org/10.1016/j.future.2013.10.021},
  doi          = {10.1016/J.FUTURE.2013.10.021},
  timestamp    = {Wed, 19 Feb 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/fgcs/PalaciosSG14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/scp/Valencia-GarciaGP14,
  author       = {Rafael Valencia{-}Garc{\'{\i}}a and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Ricardo Colomo Palacios},
  title        = {Special issue on Systems Development by Means of Semantic Technologies},
  journal      = {Sci. Comput. Program.},
  volume       = {95},
  pages        = {1--2},
  year         = {2014},
  url          = {https://doi.org/10.1016/j.scico.2014.04.010},
  doi          = {10.1016/J.SCICO.2014.04.010},
  timestamp    = {Wed, 17 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/scp/Valencia-GarciaGP14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/GonzalezRAW14,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Marcos Mart{\'{\i}}nez Romero and
                  Mikel Ega{\~{n}}a Aranguren and
                  Mark D. Wilkinson},
  title        = {Nanopublishing Clinical Diagnoses: Tracking Diagnostic Knowledge Base
                  Content and Utilization},
  booktitle    = {2014 {IEEE} 27th International Symposium on Computer-Based Medical
                  Systems, New York, NY, USA, May 27-29, 2014},
  pages        = {335--340},
  publisher    = {{IEEE} Computer Society},
  year         = {2014},
  url          = {https://doi.org/10.1109/CBMS.2014.82},
  doi          = {10.1109/CBMS.2014.82},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/GonzalezRAW14.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/biomedsem/ArangurenFAMGW13,
  author       = {Mikel Ega{\~{n}}a Aranguren and
                  Jesualdo Tom{\'{a}}s Fern{\'{a}}ndez{-}Breis and
                  Erick Antezana and
                  Chris Mungall and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Mark D. Wilkinson},
  title        = {OPPL-Galaxy, a Galaxy tool for enhancing ontology exploitation as
                  part of bioinformatics workflows},
  journal      = {J. Biomed. Semant.},
  volume       = {4},
  pages        = {2},
  year         = {2013},
  url          = {https://doi.org/10.1186/2041-1480-4-2},
  doi          = {10.1186/2041-1480-4-2},
  timestamp    = {Thu, 13 Aug 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/biomedsem/ArangurenFAMGW13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbm/GonzalezA13,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Giner Alor{-}Hern{\'{a}}ndez},
  title        = {An approach for solving multi-level diagnosis in high sensitivity
                  medical diagnosis systems through the application of semantic technologies},
  journal      = {Comput. Biol. Medicine},
  volume       = {43},
  number       = {1},
  pages        = {51--62},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.compbiomed.2012.10.007},
  doi          = {10.1016/J.COMPBIOMED.2012.10.007},
  timestamp    = {Wed, 02 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cbm/GonzalezA13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cbm/GonzalezNVMA13,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Javier Torres Ni{\~{n}}o and
                  Rafael Valencia{-}Garc{\'{\i}}a and
                  Miguel Angel Mayer and
                  Giner Alor{-}Hern{\'{a}}ndez},
  title        = {Using experts feedback in clinical case resolution and arbitration
                  as accuracy diagnosis methodology},
  journal      = {Comput. Biol. Medicine},
  volume       = {43},
  number       = {8},
  pages        = {975--986},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.compbiomed.2013.05.003},
  doi          = {10.1016/J.COMPBIOMED.2013.05.003},
  timestamp    = {Wed, 02 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cbm/GonzalezNVMA13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmmm/Garcia-CrespoABG13,
  author       = {{\'{A}}ngel Garc{\'{\i}}a{-}Crespo and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Linamara Rizzo Battistella and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {Methods and Models for Diagnosis and Prognosis in Medical Systems},
  journal      = {Comput. Math. Methods Medicine},
  volume       = {2013},
  pages        = {184257:1--184257:2},
  year         = {2013},
  url          = {https://doi.org/10.1155/2013/184257},
  doi          = {10.1155/2013/184257},
  timestamp    = {Sat, 25 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cmmm/Garcia-CrespoABG13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/Monfil-ContrerasARGG13,
  author       = {Erick Ulisses Monfil{-}Contreras and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Guillermo Cortes Robles and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Israel Gonz{\'{a}}lez{-}Carrasco},
  title        = {{RESYGEN:} {A} Recommendation System Generator using domain-based
                  heuristics},
  journal      = {Expert Syst. Appl.},
  volume       = {40},
  number       = {1},
  pages        = {242--256},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.eswa.2012.07.016},
  doi          = {10.1016/J.ESWA.2012.07.016},
  timestamp    = {Tue, 29 Dec 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/eswa/Monfil-ContrerasARGG13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/Perez-GallardoARG13,
  author       = {Yuliana P{\'{e}}rez{-}Gallardo and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Guillermo Cortes Robles and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {Collective intelligence as mechanism of medical diagnosis: The iPixel
                  approach},
  journal      = {Expert Syst. Appl.},
  volume       = {40},
  number       = {7},
  pages        = {2726--2737},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.eswa.2012.11.020},
  doi          = {10.1016/J.ESWA.2012.11.020},
  timestamp    = {Tue, 06 Jun 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/eswa/Perez-GallardoARG13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/GonzalezNA13,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Javier Torres Ni{\~{n}}o and
                  Giner Alor{-}Hern{\'{a}}ndez},
  title        = {I\({}_{\mbox{KS}}\) index: {A} knowledge-model driven index to estimate
                  the capability of medical diagnosis systems to produce results},
  journal      = {Expert Syst. Appl.},
  volume       = {40},
  number       = {17},
  pages        = {6798--6804},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.eswa.2013.06.052},
  doi          = {10.1016/J.ESWA.2013.06.052},
  timestamp    = {Tue, 06 Jun 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/eswa/GonzalezNA13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdsst/GonzalezAMRP13,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Miguel Angel Mayer and
                  Guillermo Cortes Robles and
                  Yuliana P{\'{e}}rez{-}Gallardo},
  title        = {Application of Probabilistic Techniques for the Development of a Prognosis
                  Model of Stroke Using Epidemiological Studies},
  journal      = {Int. J. Decis. Support Syst. Technol.},
  volume       = {5},
  number       = {4},
  pages        = {34--58},
  year         = {2013},
  url          = {https://doi.org/10.4018/ijdsst.2013100103},
  doi          = {10.4018/IJDSST.2013100103},
  timestamp    = {Mon, 11 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijdsst/GonzalezAMRP13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jbi/GonzalezMF13,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Miguel Angel Mayer and
                  Jesualdo Tom{\'{a}}s Fern{\'{a}}ndez{-}Breis},
  title        = {Biomedical information through the implementation of social media
                  environments},
  journal      = {J. Biomed. Informatics},
  volume       = {46},
  number       = {6},
  pages        = {955--956},
  year         = {2013},
  url          = {https://doi.org/10.1016/j.jbi.2013.10.006},
  doi          = {10.1016/J.JBI.2013.10.006},
  timestamp    = {Tue, 16 Feb 2021 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jbi/GonzalezMF13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jucs/NinoGPJA13,
  author       = {Javier Torres Ni{\~{n}}o and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Ricardo Colomo Palacios and
                  Enrique Jim{\'{e}}nez{-}Domingo and
                  Giner Alor{-}Hern{\'{a}}ndez},
  title        = {Improving Accuracy of Decision Trees Using Clustering Techniques},
  journal      = {J. Univers. Comput. Sci.},
  volume       = {19},
  number       = {4},
  pages        = {484--501},
  year         = {2013},
  url          = {https://doi.org/10.3217/jucs-019-04-0483},
  doi          = {10.3217/JUCS-019-04-0483},
  timestamp    = {Fri, 18 Mar 2022 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jucs/NinoGPJA13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jwe/Colombo-MendozaAGP13,
  author       = {Luis Omar Colombo{-}Mendoza and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Ricardo Colomo Palacios},
  title        = {AlexandRIA: {A} Visual Tool for Generating Multi-device Rich Internet
                  Applications},
  journal      = {J. Web Eng.},
  volume       = {12},
  number       = {3{\&}4},
  pages        = {317--359},
  year         = {2013},
  url          = {http://www.rintonpress.com/xjwe12/jwe-12-34/317-359.pdf},
  timestamp    = {Thu, 12 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/jwe/Colombo-MendozaAGP13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iwbbio/IglesiasAGW13,
  author       = {Alejandro Rodriguez Iglesias and
                  Mikel Ega{\~{n}}a Aranguren and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Mark D. Wilkinson},
  editor       = {Ignacio Rojas and
                  Francisco M. Ortu{\~{n}}o Guzman},
  title        = {Plant Pathogen Interactions Ontology {(PPIO)}},
  booktitle    = {International Work-Conference on Bioinformatics and Biomedical Engineering,
                  {IWBBIO} 2013, Granada, Spain, March 18-20, 2013. Proceedings},
  pages        = {695--702},
  publisher    = {Copicentro Editorial},
  year         = {2013},
  url          = {http://iwbbio.ugr.es/papers/iwbbio\_110.pdf},
  timestamp    = {Thu, 12 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iwbbio/IglesiasAGW13.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/cmmm/GonzalezNMAW12,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Javier Torres Ni{\~{n}}o and
                  Miguel Angel Mayer and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Mark D. Wilkinson},
  title        = {Analysis of a Multilevel Diagnosis Decision Support System and Its
                  Implications: {A} Case Study},
  journal      = {Comput. Math. Methods Medicine},
  volume       = {2012},
  pages        = {367345:1--367345:9},
  year         = {2012},
  url          = {https://doi.org/10.1155/2012/367345},
  doi          = {10.1155/2012/367345},
  timestamp    = {Sat, 25 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/cmmm/GonzalezNMAW12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/comsis/GonzalezNJBA12,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Javier Torres Ni{\~{n}}o and
                  Enrique Jim{\'{e}}nez{-}Domingo and
                  Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and
                  Giner Alor{-}Hern{\'{a}}ndez},
  title        = {{AKNOBAS:} {A} knowledge-based segmentation recommender system based
                  on intelligent data mining techniques},
  journal      = {Comput. Sci. Inf. Syst.},
  volume       = {9},
  number       = {2},
  pages        = {713--740},
  year         = {2012},
  url          = {https://doi.org/10.2298/CSIS110722008R},
  doi          = {10.2298/CSIS110722008R},
  timestamp    = {Tue, 21 May 2019 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/comsis/GonzalezNJBA12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/Casado-LumbrerasGAP12,
  author       = {Cristina Casado{-}Lumbreras and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Jos{\'{e}} Mar{\'{\i}}a {\'{A}}lvarez Rodr{\'{\i}}guez and
                  Ricardo Colomo Palacios},
  title        = {PsyDis: Towards a diagnosis support system for psychological disorders},
  journal      = {Expert Syst. Appl.},
  volume       = {39},
  number       = {13},
  pages        = {11391--11403},
  year         = {2012},
  url          = {https://doi.org/10.1016/j.eswa.2012.04.033},
  doi          = {10.1016/J.ESWA.2012.04.033},
  timestamp    = {Wed, 22 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/eswa/Casado-LumbrerasGAP12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/GonzalezTHJA12,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Javier Torres Ni{\~{n}}o and
                  Gandhi Hern{\'{a}}ndez{-}Chan and
                  Enrique Jim{\'{e}}nez{-}Domingo and
                  Jos{\'{e}} Mar{\'{\i}}a {\'{A}}lvarez Rodr{\'{\i}}guez},
  title        = {Using agents to parallelize a medical reasoning system based on ontologies
                  and description logics as an application case},
  journal      = {Expert Syst. Appl.},
  volume       = {39},
  number       = {18},
  pages        = {13085--13092},
  year         = {2012},
  url          = {https://doi.org/10.1016/j.eswa.2012.05.093},
  doi          = {10.1016/J.ESWA.2012.05.093},
  timestamp    = {Wed, 22 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/eswa/GonzalezTHJA12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijhcitp/PalaciosSAG12,
  author       = {Ricardo Colomo Palacios and
                  Jos{\'{e}} Luis S{\'{a}}nchez{-}Cervantes and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {Linked Data: Perspectives for {IT} Professionals},
  journal      = {Int. J. Hum. Cap. Inf. Technol. Prof.},
  volume       = {3},
  number       = {3},
  pages        = {1--12},
  year         = {2012},
  url          = {https://doi.org/10.4018/jhcitp.2012070101},
  doi          = {10.4018/JHCITP.2012070101},
  timestamp    = {Sat, 25 Apr 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijhcitp/PalaciosSAG12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijmso/GonzalezRCP12,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Jos{\'{e}} Mar{\'{\i}}a {\'{A}}lvarez Rodr{\'{\i}}guez and
                  Cristina Casado{-}Lumbreras and
                  Ricardo Colomo Palacios},
  title        = {Towards an ontology for psychological disorders},
  journal      = {Int. J. Metadata Semant. Ontologies},
  volume       = {7},
  number       = {4},
  pages        = {260--268},
  year         = {2012},
  url          = {https://doi.org/10.1504/IJMSO.2012.051489},
  doi          = {10.1504/IJMSO.2012.051489},
  timestamp    = {Sun, 22 Oct 2023 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijmso/GonzalezRCP12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijseke/GonzalezVC12,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Rafael Valencia{-}Garc{\'{\i}}a and
                  Ricardo Colomo Palacios},
  title        = {Guest Editors' Introduction},
  journal      = {Int. J. Softw. Eng. Knowl. Eng.},
  volume       = {22},
  number       = {3},
  pages        = {323--324},
  year         = {2012},
  url          = {https://doi.org/10.1142/S0218194012020020},
  doi          = {10.1142/S0218194012020020},
  timestamp    = {Wed, 22 Jul 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijseke/GonzalezVC12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/isf/GonzalezPGBG12,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Ricardo Colomo Palacios and
                  Fernando Guldr{\'{\i}}s{-}Iglesias and
                  Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and
                  {\'{A}}ngel Garc{\'{\i}}a{-}Crespo},
  title        = {{FAST:} Fundamental Analysis Support for Financial Statements. Using
                  semantics for trading recommendations},
  journal      = {Inf. Syst. Frontiers},
  volume       = {14},
  number       = {5},
  pages        = {999--1017},
  year         = {2012},
  url          = {https://doi.org/10.1007/s10796-011-9321-1},
  doi          = {10.1007/S10796-011-9321-1},
  timestamp    = {Fri, 13 Mar 2020 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/journals/isf/GonzalezPGBG12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/jms/GonzalezGPMBG12,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Jos{\'{e}} Emilio Labra Gayo and
                  Ricardo Colomo Palacios and
                  Miguel Angel Mayer and
                  Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and
                  {\'{A}}ngel Garc{\'{\i}}a{-}Crespo},
  title        = {SeDeLo: Using Semantics and Description Logics to Support Aided Clinical
                  Diagnosis},
  journal      = {J. Medical Syst.},
  volume       = {36},
  number       = {4},
  pages        = {2471--2481},
  year         = {2012},
  url          = {https://doi.org/10.1007/s10916-011-9714-1},
  doi          = {10.1007/S10916-011-9714-1},
  timestamp    = {Mon, 08 Jun 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/jms/GonzalezGPMBG12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/conielecomp/Colombo-MendozaAG12,
  author       = {Luis Omar Colombo{-}Mendoza and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {Pedro Ba{\~{n}}uelos S{\'{a}}nchez and
                  Roberto Rosas{-}Romero and
                  Mauricio Javier Osorio Galindo},
  title        = {A novel approach for generating multi-device Rich Internet Applications},
  booktitle    = {22nd International Conference on Electrical Communications and Computers,
                  {CONIELECOMP} 2012, Cholula, Puebla, Mexico, February 27-29, 2012},
  pages        = {361--367},
  publisher    = {{IEEE}},
  year         = {2012},
  url          = {https://doi.org/10.1109/CONIELECOMP.2012.6189939},
  doi          = {10.1109/CONIELECOMP.2012.6189939},
  timestamp    = {Wed, 16 Oct 2019 14:14:52 +0200},
  biburl       = {https://dblp.org/rec/conf/conielecomp/Colombo-MendozaAG12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/intenv/SandovalTPR12,
  author       = {Oscar Sandoval and
                  Paolo Tripicchio and
                  Otniel Portillo{-}Rodr{\'{\i}}guez and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {Juan A. Bot{\'{\i}}a and
                  Hedda Rahel Schmidtke and
                  Tatsuo Nakashima and
                  Mohammed R. Al{-}Mulla and
                  Juan Carlos Augusto and
                  Asier Aztiria and
                  Matthew Ball and
                  Victor Callaghan and
                  Diane J. Cook and
                  James Dooley and
                  John O'Donoghue and
                  Simon Egerton and
                  Pablo A. Haya and
                  Miguel J. Hornos and
                  Eduardo Morales and
                  Juan Carlos Orozco and
                  Otniel Portillo{-}Rodr{\'{\i}}guez and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Oscar Sandoval and
                  Paolo Tripicchio and
                  Minjuan Wang and
                  V{\'{\i}}ctor Zamudio},
  title        = {Introduction to the Proceedings of IMIASH'12},
  booktitle    = {Workshop Proceedings of the 8th International Conference on Intelligent
                  Environments, Guanajuato, Mexico, June 26-29, 2012},
  series       = {Ambient Intelligence and Smart Environments},
  volume       = {13},
  pages        = {311},
  publisher    = {{IOS} Press},
  year         = {2012},
  timestamp    = {Sat, 23 Jun 2018 18:45:57 +0200},
  biburl       = {https://dblp.org/rec/conf/intenv/SandovalTPR12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/intenv/Posada-GomezRLAMR12,
  author       = {Rub{\'{e}}n Posada{-}G{\'{o}}mez and
                  Cristhian Omar Rodriguez{-}Bernardo and
                  Phares Salathiel Luna{-}Bravo and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Albino Mart{\'{\i}}nez{-}Sibaja and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {Juan A. Bot{\'{\i}}a and
                  Hedda Rahel Schmidtke and
                  Tatsuo Nakashima and
                  Mohammed R. Al{-}Mulla and
                  Juan Carlos Augusto and
                  Asier Aztiria and
                  Matthew Ball and
                  Victor Callaghan and
                  Diane J. Cook and
                  James Dooley and
                  John O'Donoghue and
                  Simon Egerton and
                  Pablo A. Haya and
                  Miguel J. Hornos and
                  Eduardo Morales and
                  Juan Carlos Orozco and
                  Otniel Portillo{-}Rodr{\'{\i}}guez and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Oscar Sandoval and
                  Paolo Tripicchio and
                  Minjuan Wang and
                  V{\'{\i}}ctor Zamudio},
  title        = {Development of a natural interaction interface for people with disabilities
                  in a home automation control room},
  booktitle    = {Workshop Proceedings of the 8th International Conference on Intelligent
                  Environments, Guanajuato, Mexico, June 26-29, 2012},
  series       = {Ambient Intelligence and Smart Environments},
  volume       = {13},
  pages        = {353--361},
  publisher    = {{IOS} Press},
  year         = {2012},
  url          = {https://doi.org/10.3233/978-1-61499-080-2-353},
  doi          = {10.3233/978-1-61499-080-2-353},
  timestamp    = {Tue, 23 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/intenv/Posada-GomezRLAMR12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/intenv/Herrera-AguilarSSJRAP12,
  author       = {Ignacio Herrera{-}Aguilar and
                  Oscar Osvaldo Sandoval{-}Gonzalez and
                  Blanca E. Gonz{\'{a}}lez S{\'{a}}nchez and
                  Juan Manuel Jacinto{-}Villegas and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Otniel Portillo{-}Rodr{\'{\i}}guez},
  editor       = {Juan A. Bot{\'{\i}}a and
                  Hedda Rahel Schmidtke and
                  Tatsuo Nakashima and
                  Mohammed R. Al{-}Mulla and
                  Juan Carlos Augusto and
                  Asier Aztiria and
                  Matthew Ball and
                  Victor Callaghan and
                  Diane J. Cook and
                  James Dooley and
                  John O'Donoghue and
                  Simon Egerton and
                  Pablo A. Haya and
                  Miguel J. Hornos and
                  Eduardo Morales and
                  Juan Carlos Orozco and
                  Otniel Portillo{-}Rodr{\'{\i}}guez and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Oscar Sandoval and
                  Paolo Tripicchio and
                  Minjuan Wang and
                  V{\'{\i}}ctor Zamudio},
  title        = {Visuo-Vibrotactile Stimuli Applied for Skills Transfer and Rehabilitation},
  booktitle    = {Workshop Proceedings of the 8th International Conference on Intelligent
                  Environments, Guanajuato, Mexico, June 26-29, 2012},
  series       = {Ambient Intelligence and Smart Environments},
  volume       = {13},
  pages        = {362--369},
  publisher    = {{IOS} Press},
  year         = {2012},
  url          = {https://doi.org/10.3233/978-1-61499-080-2-362},
  doi          = {10.3233/978-1-61499-080-2-362},
  timestamp    = {Tue, 23 May 2017 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/intenv/Herrera-AguilarSSJRAP12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/otm/PalaciosGCF12,
  author       = {Ricardo Colomo Palacios and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Antonio Cabanas{-}Abascal and
                  Joaqu{\'{\i}}n M. Fern{\'{a}}ndez{-}Gonz{\'{a}}lez},
  editor       = {Pilar Herrero and
                  Herv{\'{e}} Panetto and
                  Robert Meersman and
                  Tharam S. Dillon},
  title        = {Post-via: After Visit Tourist Services Enabled by Semantics},
  booktitle    = {On the Move to Meaningful Internet Systems: {OTM} 2012 Workshops,
                  Confederated International Workshops: {OTM} Academy, Industry Case
                  Studies Program, EI2N, INBAST, META4eS, OnToContent, ORM, SeDeS, SINCOM,
                  and {SOMOCO} 2012, Rome, Italy, September 10-14, 2012. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {7567},
  pages        = {183--193},
  publisher    = {Springer},
  year         = {2012},
  url          = {https://doi.org/10.1007/978-3-642-33618-8\_27},
  doi          = {10.1007/978-3-642-33618-8\_27},
  timestamp    = {Thu, 14 Oct 2021 10:28:28 +0200},
  biburl       = {https://dblp.org/rec/conf/otm/PalaciosGCF12.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/intenv/2012w,
  editor       = {Juan A. Bot{\'{\i}}a and
                  Hedda Rahel Schmidtke and
                  Tatsuo Nakashima and
                  Mohammed R. Al{-}Mulla and
                  Juan Carlos Augusto and
                  Asier Aztiria and
                  Matthew Ball and
                  Victor Callaghan and
                  Diane J. Cook and
                  James Dooley and
                  John O'Donoghue and
                  Simon Egerton and
                  Pablo A. Haya and
                  Miguel J. Hornos and
                  Eduardo Morales and
                  Juan Carlos Orozco and
                  Otniel Portillo{-}Rodr{\'{\i}}guez and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Oscar Sandoval and
                  Paolo Tripicchio and
                  Minjuan Wang and
                  V{\'{\i}}ctor Zamudio},
  title        = {Workshop Proceedings of the 8th International Conference on Intelligent
                  Environments, Guanajuato, Mexico, June 26-29, 2012},
  series       = {Ambient Intelligence and Smart Environments},
  volume       = {13},
  publisher    = {{IOS} Press},
  year         = {2012},
  url          = {http://www.booksonline.iospress.nl/Content/View.aspx?piid=30661},
  isbn         = {978-1-61499-079-6},
  timestamp    = {Sat, 23 Jun 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/intenv/2012w.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@proceedings{DBLP:conf/semweb/2012satbi,
  editor       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Jyotishman Pathak and
                  Mark D. Wilkinson and
                  Nigam Shah and
                  Robert Stevens and
                  Richard D. Boyce and
                  {\'{A}}ngel Garc{\'{\i}}a{-}Crespo},
  title        = {Proceedings of the Joint Workshop on Semantic Technologies Applied
                  to Biomedical Informatics and Individualized Medicine, Boston, USA,
                  November 12, 2012},
  series       = {{CEUR} Workshop Proceedings},
  volume       = {930},
  publisher    = {CEUR-WS.org},
  year         = {2012},
  url          = {https://ceur-ws.org/Vol-930},
  urn          = {urn:nbn:de:0074-930-6},
  timestamp    = {Fri, 10 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/semweb/2012satbi.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/GonzalezGPIB11,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  {\'{A}}ngel Garc{\'{\i}}a{-}Crespo and
                  Ricardo Colomo Palacios and
                  Fernando Guldr{\'{\i}}s{-}Iglesias and
                  Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s},
  title        = {{CAST:} Using neural networks to improve trading systems based on
                  technical analysis by means of the {RSI} financial indicator},
  journal      = {Expert Syst. Appl.},
  volume       = {38},
  number       = {9},
  pages        = {11489--11500},
  year         = {2011},
  url          = {https://doi.org/10.1016/j.eswa.2011.03.023},
  doi          = {10.1016/J.ESWA.2011.03.023},
  timestamp    = {Wed, 01 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/eswa/GonzalezGPIB11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijdsst/GonzalezGPGBA11,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  {\'{A}}ngel Garc{\'{\i}}a{-}Crespo and
                  Ricardo Colomo Palacios and
                  Jos{\'{e}} Emilio Labra Gayo and
                  Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and
                  Giner Alor{-}Hern{\'{a}}ndez},
  title        = {Automated Diagnosis Through Ontologies and Logical Descriptions: The
                  {ADONIS} Approach},
  journal      = {Int. J. Decis. Support Syst. Technol.},
  volume       = {3},
  number       = {1},
  pages        = {21--39},
  year         = {2011},
  url          = {https://doi.org/10.4018/jdsst.2011010102},
  doi          = {10.4018/JDSST.2011010102},
  timestamp    = {Mon, 11 May 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijdsst/GonzalezGPGBA11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/ijkbo/GonzalezGPBJ11,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  {\'{A}}ngel Garc{\'{\i}}a{-}Crespo and
                  Ricardo Colomo Palacios and
                  Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and
                  Enrique Jim{\'{e}}nez{-}Domingo},
  title        = {Using Ontologies in Drug Prescription: The SemMed Approach},
  journal      = {Int. J. Knowl. Based Organ.},
  volume       = {1},
  number       = {4},
  pages        = {1--15},
  year         = {2011},
  url          = {https://doi.org/10.4018/ijkbo.2011100101},
  doi          = {10.4018/IJKBO.2011100101},
  timestamp    = {Thu, 24 Sep 2020 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/ijkbo/GonzalezGPBJ11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/bcb/GonzalezDGABP11,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Enrique Jim{\'{e}}nez{-}Domingo and
                  {\'{A}}ngel Garc{\'{\i}}a{-}Crespo and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and
                  Rub{\'{e}}n Posada{-}G{\'{o}}mez},
  editor       = {Robert Grossman and
                  Andrey Rzhetsky and
                  Sun Kim and
                  Wei Wang},
  title        = {Designing an ontology to support the creation of diagnostic decision
                  support system},
  booktitle    = {{ACM} International Conference on Bioinformatics, Computational Biology
                  and Biomedicine, BCB' 11, Chicago, IL, {USA} - July 31 - August 03,
                  2011},
  pages        = {612--616},
  publisher    = {{ACM}},
  year         = {2011},
  url          = {https://doi.org/10.1145/2147805.2147911},
  doi          = {10.1145/2147805.2147911},
  timestamp    = {Thu, 14 Oct 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/bcb/GonzalezDGABP11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@incollection{DBLP:books/igi/11/GonzalezGPGG11,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  {\'{A}}ngel Garc{\'{\i}}a{-}Crespo and
                  Ricardo Colomo Palacios and
                  Jos{\'{e}} Emilio Labra Gayo and
                  Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s},
  editor       = {Miltiadis D. Lytras and
                  Patricia Ord{\'{o}}{\~{n}}ez de Pablos and
                  Ernesto Damiani},
  title        = {Locating Doctors using Social and Semantic Web Technologies: The MedFinder
                  Approach},
  booktitle    = {Semantic Web Personalization and Context Awareness - Management of
                  Personal Identities and Social Networking},
  pages        = {94--106},
  publisher    = {{IGI} Global},
  year         = {2011},
  url          = {https://doi.org/10.4018/978-1-61520-921-7.ch009},
  doi          = {10.4018/978-1-61520-921-7.CH009},
  timestamp    = {Mon, 16 Sep 2019 14:43:11 +0200},
  biburl       = {https://dblp.org/rec/books/igi/11/GonzalezGPGG11.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/eswa/Garcia-CrespoGMBP10,
  author       = {{\'{A}}ngel Garc{\'{\i}}a{-}Crespo and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Myriam Mencke and
                  Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and
                  Ricardo Colomo Palacios},
  title        = {{ODDIN:} Ontology-driven differential diagnosis based on logical inference
                  and probabilistic refinements},
  journal      = {Expert Syst. Appl.},
  volume       = {37},
  number       = {3},
  pages        = {2621--2628},
  year         = {2010},
  url          = {https://doi.org/10.1016/j.eswa.2009.08.016},
  doi          = {10.1016/J.ESWA.2009.08.016},
  timestamp    = {Wed, 01 Aug 2018 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/eswa/Garcia-CrespoGMBP10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@article{DBLP:journals/tcci/Alor-HernandezAJPRMBG10,
  author       = {Giner Alor{-}Hern{\'{a}}ndez and
                  Alberto Alfonso Aguilar{-}Lasserre and
                  Ulises Ju{\'{a}}rez{-}Mart{\'{\i}}nez and
                  Rub{\'{e}}n Posada{-}G{\'{o}}mez and
                  Guillermo Cortes Robles and
                  Mario Alberto Garcia Martinez and
                  Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  title        = {{HYDRA:} {A} Middleware-Oriented Integrated Architecture for e-Procurement
                  in Supply Chains},
  journal      = {Trans. Comput. Collect. Intell.},
  volume       = {1},
  pages        = {1--20},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-15034-0\_1},
  doi          = {10.1007/978-3-642-15034-0\_1},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/journals/tcci/Alor-HernandezAJPRMBG10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/GonzalezMABRL10,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Miguel Angel Mayer and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and
                  Guillermo Cortes Robles and
                  Angel Lagares Lemos},
  editor       = {Tharam S. Dillon and
                  Daniel L. Rubin and
                  William M. Gallagher and
                  Amandeep S. Sidhu and
                  Alexey Tsymbal},
  title        = {Using ontologies and probabilistic networks to develop a preventive
                  stroke diagnosis system {(PSDS)}},
  booktitle    = {{IEEE} 23rd International Symposium on Computer-Based Medical Systems
                  {(CBMS} 2010), Perth, Australia, October 12-15, 2010},
  pages        = {370--377},
  publisher    = {{IEEE} Computer Society},
  year         = {2010},
  url          = {https://doi.org/10.1109/CBMS.2010.6042672},
  doi          = {10.1109/CBMS.2010.6042672},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/GonzalezMABRL10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/pkaw/GonzalezGPBJAPR10,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Fernando Guldr{\'{\i}}s{-}Iglesias and
                  Ricardo Colomo Palacios and
                  Juan Miguel G{\'{o}}mez{-}Berb{\'{\i}}s and
                  Enrique Jim{\'{e}}nez{-}Domingo and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Rub{\'{e}}n Posada{-}G{\'{o}}mez and
                  Guillermo Cortes Robles},
  editor       = {Byeong Ho Kang and
                  Debbie Richards},
  title        = {Improving Trading Systems Using the {RSI} Financial Indicator and
                  Neural Networks},
  booktitle    = {Knowledge Management and Acquisition for Smart Systems and Services,
                  11th International Workshop, {PKAW} 2010, Daegu, Korea, August 20
                  - September 3, 2010. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {6232},
  pages        = {27--37},
  publisher    = {Springer},
  year         = {2010},
  url          = {https://doi.org/10.1007/978-3-642-15037-1\_3},
  doi          = {10.1007/978-3-642-15037-1\_3},
  timestamp    = {Tue, 30 Aug 2022 08:51:41 +0200},
  biburl       = {https://dblp.org/rec/conf/pkaw/GonzalezGPBJAPR10.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/cbms/GonzalezGAGP09,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Jos{\'{e}} Emilio Labra Gayo and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Juan Miguel G{\'{o}}mez and
                  Rub{\'{e}}n Posada{-}G{\'{o}}mez},
  title        = {{ADONIS:} Automated diagnosis system based on sound and precise logical
                  descriptions},
  booktitle    = {Proceedings of the Twenty-Second {IEEE} International Symposium on
                  Computer-Based Medical Systems, August 3-4, 2009, Albuquerque, New
                  Mexico, {USA}},
  pages        = {1--8},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://doi.org/10.1109/CBMS.2009.5255449},
  doi          = {10.1109/CBMS.2009.5255449},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/cbms/GonzalezGAGP09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/etelemed/RodriguezMAPGA09,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Myriam Mencke and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Rub{\'{e}}n Posada{-}G{\'{o}}mez and
                  Juan Miguel G{\'{o}}mez and
                  Alberto Alfonso Aguilar{-}Lasserre},
  title        = {{MEDBOLI:} Medical Diagnosis Based on Ontologies and Logical Inference},
  booktitle    = {International Conference on eHealth, Telemedicine, and Social Medicine,
                  eTELEMED 2009, February 1-7, 2009, Cancun, Mexico},
  pages        = {233--238},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://doi.org/10.1109/eTELEMED.2009.43},
  doi          = {10.1109/ETELEMED.2009.43},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/etelemed/RodriguezMAPGA09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccci/GonzalezJRGAPG09,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Enrique Jim{\'{e}}nez{-}Domingo and
                  Mateusz Radzimski and
                  Juan Miguel G{\'{o}}mez and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Rub{\'{e}}n Posada{-}G{\'{o}}mez and
                  Jos{\'{e}} Emilio Labra Gayo},
  editor       = {Ngoc Thanh Nguyen and
                  Radoslaw P. Katarzyniak and
                  Adam Janiak},
  title        = {Applying Caching Capabilities to Inference Applications Based on Semantic
                  Web},
  booktitle    = {New Challenges in Computational Collective Intelligence [selected
                  papers from the 1st International Conference on Collective Intelligence
                  - Semantic Web, Social Networks {\&} Multiagent Systems, {ICCCI}
                  2009]},
  series       = {Studies in Computational Intelligence},
  volume       = {244},
  pages        = {27--37},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-03958-4\_3},
  doi          = {10.1007/978-3-642-03958-4\_3},
  timestamp    = {Thu, 16 Mar 2023 20:00:29 +0100},
  biburl       = {https://dblp.org/rec/conf/iccci/GonzalezJRGAPG09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iccci/Alor-HernandezAJPRMGMG09,
  author       = {Giner Alor{-}Hern{\'{a}}ndez and
                  Alberto Alfonso Aguilar{-}Lasserre and
                  Ulises Ju{\'{a}}rez{-}Mart{\'{\i}}nez and
                  Rub{\'{e}}n Posada{-}G{\'{o}}mez and
                  Guillermo Cortes Robles and
                  Mario Alberto Garcia Martinez and
                  Juan Miguel G{\'{o}}mez and
                  Myriam Mencke and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {Ngoc Thanh Nguyen and
                  Ryszard Kowalczyk and
                  Shyi{-}Ming Chen},
  title        = {A Hybrid Architecture for E-Procurement},
  booktitle    = {Computational Collective Intelligence. Semantic Web, Social Networks
                  and Multiagent Systems, First International Conference, {ICCCI} 2009,
                  Wroclaw, Poland, October 5-7, 2009. Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {5796},
  pages        = {685--696},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-04441-0\_60},
  doi          = {10.1007/978-3-642-04441-0\_60},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/iccci/Alor-HernandezAJPRMGMG09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/iciw/GonzalezEMFJGAPR09,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Martin Eccius and
                  Myriam Mencke and
                  Jes{\'{u}}s Fern{\'{a}}ndez and
                  Enrique Jim{\'{e}}nez{-}Domingo and
                  Juan Miguel G{\'{o}}mez and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Rub{\'{e}}n Posada{-}G{\'{o}}mez and
                  Guillermo Cortes Robles},
  editor       = {Mark Perry and
                  Hideyasu Sasaki and
                  Matthias Ehmann and
                  Guadalupe Ortiz and
                  Oana Dini},
  title        = {A Multi-agent System for Traffic Control for Emergencies by Quadrants},
  booktitle    = {Fourth International Conference on Internet and Web Applications and
                  Services, {ICIW} 2009, 24-28 May 2009, Venice/Mestre, Italy},
  pages        = {247--253},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://doi.org/10.1109/ICIW.2009.42},
  doi          = {10.1109/ICIW.2009.42},
  timestamp    = {Fri, 24 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/iciw/GonzalezEMFJGAPR09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/ideal/RoblesAAJPGG09,
  author       = {Guillermo Cortes Robles and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Alberto Alfonso Aguilar{-}Lasserre and
                  Ulises Ju{\'{a}}rez{-}Mart{\'{\i}}nez and
                  Rub{\'{e}}n Posada{-}G{\'{o}}mez and
                  Juan Miguel G{\'{o}}mez and
                  Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez},
  editor       = {Emilio Corchado and
                  Hujun Yin},
  title        = {Resources Oriented Search: {A} Strategy to Transfer Knowledge in the
                  {TRIZ-CBR} Synergy},
  booktitle    = {Intelligent Data Engineering and Automated Learning - {IDEAL} 2009,
                  10th International Conference, Burgos, Spain, September 23-26, 2009.
                  Proceedings},
  series       = {Lecture Notes in Computer Science},
  volume       = {5788},
  pages        = {518--526},
  publisher    = {Springer},
  year         = {2009},
  url          = {https://doi.org/10.1007/978-3-642-04394-9\_63},
  doi          = {10.1007/978-3-642-04394-9\_63},
  timestamp    = {Tue, 07 May 2024 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/ideal/RoblesAAJPGG09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/intensive/GonzalezJFEGAPL09,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Enrique Jim{\'{e}}nez{-}Domingo and
                  Jes{\'{u}}s Fern{\'{a}}ndez and
                  Martin Eccius and
                  Juan Miguel G{\'{o}}mez and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Rub{\'{e}}n Posada{-}G{\'{o}}mez and
                  Carlos Laufer},
  editor       = {Fernando Boronat and
                  Cosmin Dini},
  title        = {SemMed: Applying Semantic Web to Medical Recommendation Systems},
  booktitle    = {First International Conference on Intensive Applications and Services,
                  {INTENSIVE} 2009, Valencia, Spain, 20-25 April 2009},
  pages        = {47--52},
  publisher    = {{IEEE} Computer Society},
  year         = {2009},
  url          = {https://doi.org/10.1109/INTENSIVE.2009.12},
  doi          = {10.1109/INTENSIVE.2009.12},
  timestamp    = {Thu, 23 Mar 2023 00:00:00 +0100},
  biburl       = {https://dblp.org/rec/conf/intensive/GonzalezJFEGAPL09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
@inproceedings{DBLP:conf/webist/GonzalezFJMRGAP09,
  author       = {Alejandro Rodr{\'{\i}}guez Gonz{\'{a}}lez and
                  Jes{\'{u}}s Fern{\'{a}}ndez and
                  Enrique Jim{\'{e}}nez{-}Domingo and
                  Myriam Mencke and
                  Mateusz Radzimski and
                  Juan Miguel G{\'{o}}mez and
                  Giner Alor{-}Hern{\'{a}}ndez and
                  Rub{\'{e}}n Posada{-}G{\'{o}}mez},
  editor       = {Joaquim Filipe and
                  Jos{\'{e}} Cordeiro},
  title        = {{MEDFINDER} - Using Semantic Web, Web 2.0 and Geolocation Methods
                  to Develop a Decision Support System to Locate Doctors},
  booktitle    = {{WEBIST} 2009 - Proceedings of the Fifth International Conference
                  on Web Information Systems and Technologies, Lisbon, Portugal, March
                  23-26, 2009},
  pages        = {288--293},
  publisher    = {{INSTICC} Press},
  year         = {2009},
  timestamp    = {Thu, 17 Jun 2021 01:00:00 +0200},
  biburl       = {https://dblp.org/rec/conf/webist/GonzalezFJMRGAP09.bib},
  bibsource    = {dblp computer science bibliography, https://dblp.org}
}
a service of  Schloss Dagstuhl - Leibniz Center for Informatics